Basic Information | |
---|---|
Family ID | F022056 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 216 |
Average Sequence Length | 40 residues |
Representative Sequence | VTEDSSRVAWLQQARSYLRNADPVLARLIDDRPDFDPRAW |
Number of Associated Samples | 189 |
Number of Associated Scaffolds | 216 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.66 % |
% of genes near scaffold ends (potentially truncated) | 97.22 % |
% of genes from short scaffolds (< 2000 bps) | 91.67 % |
Associated GOLD sequencing projects | 183 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.574 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.482 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.852 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.889 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 216 Family Scaffolds |
---|---|---|
PF00857 | Isochorismatase | 9.72 |
PF00196 | GerE | 6.94 |
PF07690 | MFS_1 | 4.17 |
PF13193 | AMP-binding_C | 2.31 |
PF00496 | SBP_bac_5 | 1.85 |
PF03060 | NMO | 1.85 |
PF00903 | Glyoxalase | 1.39 |
PF00676 | E1_dh | 1.39 |
PF12270 | Cyt_c_ox_IV | 1.39 |
PF00753 | Lactamase_B | 1.39 |
PF00582 | Usp | 0.93 |
PF13561 | adh_short_C2 | 0.93 |
PF01596 | Methyltransf_3 | 0.93 |
PF00440 | TetR_N | 0.93 |
PF01717 | Meth_synt_2 | 0.93 |
PF03328 | HpcH_HpaI | 0.93 |
PF13460 | NAD_binding_10 | 0.93 |
PF12681 | Glyoxalase_2 | 0.93 |
PF13683 | rve_3 | 0.93 |
PF12697 | Abhydrolase_6 | 0.93 |
PF13231 | PMT_2 | 0.93 |
PF07366 | SnoaL | 0.93 |
PF00106 | adh_short | 0.46 |
PF12802 | MarR_2 | 0.46 |
PF08281 | Sigma70_r4_2 | 0.46 |
PF05235 | CHAD | 0.46 |
PF12680 | SnoaL_2 | 0.46 |
PF00571 | CBS | 0.46 |
PF16124 | RecQ_Zn_bind | 0.46 |
PF12902 | Ferritin-like | 0.46 |
PF00892 | EamA | 0.46 |
PF01243 | Putative_PNPOx | 0.46 |
PF00924 | MS_channel | 0.46 |
PF00271 | Helicase_C | 0.46 |
PF04389 | Peptidase_M28 | 0.46 |
PF00355 | Rieske | 0.46 |
PF00144 | Beta-lactamase | 0.46 |
PF00248 | Aldo_ket_red | 0.46 |
PF01183 | Glyco_hydro_25 | 0.46 |
PF01638 | HxlR | 0.46 |
PF01027 | Bax1-I | 0.46 |
PF08125 | Mannitol_dh_C | 0.46 |
PF02779 | Transket_pyr | 0.46 |
PF07730 | HisKA_3 | 0.46 |
PF02148 | zf-UBP | 0.46 |
PF04545 | Sigma70_r4 | 0.46 |
PF00141 | peroxidase | 0.46 |
COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
---|---|---|---|
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 9.72 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 9.72 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 1.85 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.85 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 1.39 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 1.39 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.93 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.93 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.93 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.93 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG0246 | Mannitol-1-phosphate/altronate dehydrogenases | Carbohydrate transport and metabolism [G] | 0.46 |
COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.46 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.46 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.46 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.46 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.46 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.46 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.46 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.46 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.46 |
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.46 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.57 % |
Unclassified | root | N/A | 13.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000891|JGI10214J12806_11403917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
3300004091|Ga0062387_101375641 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300004629|Ga0008092_11161976 | Not Available | 506 | Open in IMG/M |
3300005334|Ga0068869_101454435 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005337|Ga0070682_101380453 | Not Available | 602 | Open in IMG/M |
3300005366|Ga0070659_100114986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2174 | Open in IMG/M |
3300005435|Ga0070714_100199147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 1831 | Open in IMG/M |
3300005436|Ga0070713_101684731 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005456|Ga0070678_102203501 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005535|Ga0070684_101487562 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300005544|Ga0070686_100573896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8 | 885 | Open in IMG/M |
3300005602|Ga0070762_10593037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 735 | Open in IMG/M |
3300005712|Ga0070764_10786111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
3300005764|Ga0066903_100774324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1710 | Open in IMG/M |
3300005764|Ga0066903_104410966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. ATCC 31491 | 751 | Open in IMG/M |
3300006028|Ga0070717_11066629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. ATCC 31491 | 736 | Open in IMG/M |
3300006028|Ga0070717_11168401 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300006028|Ga0070717_11982827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 525 | Open in IMG/M |
3300006058|Ga0075432_10061993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1332 | Open in IMG/M |
3300006059|Ga0075017_100373064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1066 | Open in IMG/M |
3300006102|Ga0075015_100784933 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006173|Ga0070716_100895047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
3300006175|Ga0070712_101628582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
3300006578|Ga0074059_11999503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300006606|Ga0074062_12516190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300006755|Ga0079222_10166627 | Not Available | 1277 | Open in IMG/M |
3300006794|Ga0066658_10003036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. DC12 | 5933 | Open in IMG/M |
3300006804|Ga0079221_10874339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium fulvum | 656 | Open in IMG/M |
3300006844|Ga0075428_102741988 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300006847|Ga0075431_102202676 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300006854|Ga0075425_102204928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300006904|Ga0075424_101821156 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300006954|Ga0079219_10768415 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300006954|Ga0079219_11032726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
3300007076|Ga0075435_101017303 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300007788|Ga0099795_10117228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1061 | Open in IMG/M |
3300009088|Ga0099830_10879379 | Not Available | 741 | Open in IMG/M |
3300009089|Ga0099828_11023919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
3300009156|Ga0111538_14103810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Gandjariella → Gandjariella thermophila | 503 | Open in IMG/M |
3300009162|Ga0075423_12337500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
3300009520|Ga0116214_1028210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2014 | Open in IMG/M |
3300009551|Ga0105238_10944389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
3300010042|Ga0126314_11438641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MBT53 | 518 | Open in IMG/M |
3300010043|Ga0126380_10278656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1176 | Open in IMG/M |
3300010358|Ga0126370_10606172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 946 | Open in IMG/M |
3300010361|Ga0126378_10834151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1030 | Open in IMG/M |
3300010361|Ga0126378_11996535 | Not Available | 661 | Open in IMG/M |
3300010366|Ga0126379_10406187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100 | 1411 | Open in IMG/M |
3300010366|Ga0126379_12849657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. ATCC 31491 | 579 | Open in IMG/M |
3300010376|Ga0126381_103382937 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300010398|Ga0126383_10169997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2058 | Open in IMG/M |
3300010398|Ga0126383_11670799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
3300010401|Ga0134121_11509558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium fulvum | 687 | Open in IMG/M |
3300011271|Ga0137393_10407743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1164 | Open in IMG/M |
3300012096|Ga0137389_11353543 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300012199|Ga0137383_10650498 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300012205|Ga0137362_11486259 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300012210|Ga0137378_10550544 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300012349|Ga0137387_10063357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2501 | Open in IMG/M |
3300012350|Ga0137372_10024086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5658 | Open in IMG/M |
3300012353|Ga0137367_10394470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
3300012354|Ga0137366_11112504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300012362|Ga0137361_11086501 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300012481|Ga0157320_1005311 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300012917|Ga0137395_10789099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
3300012951|Ga0164300_10808874 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300012951|Ga0164300_11211209 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300012971|Ga0126369_11896173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300012988|Ga0164306_10697914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300012988|Ga0164306_11094172 | Not Available | 662 | Open in IMG/M |
3300013100|Ga0157373_10342540 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300013307|Ga0157372_13179876 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300014495|Ga0182015_10819571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300014745|Ga0157377_11049212 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300015077|Ga0173483_10126091 | Not Available | 1101 | Open in IMG/M |
3300015242|Ga0137412_10072223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 2808 | Open in IMG/M |
3300015245|Ga0137409_10457858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1096 | Open in IMG/M |
3300015264|Ga0137403_11525311 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300015374|Ga0132255_103414472 | Not Available | 676 | Open in IMG/M |
3300016270|Ga0182036_11165335 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300016341|Ga0182035_10281281 | Not Available | 1356 | Open in IMG/M |
3300016357|Ga0182032_11854633 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300016371|Ga0182034_11434890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
3300016422|Ga0182039_11778974 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300017926|Ga0187807_1271564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
3300017928|Ga0187806_1075357 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300017942|Ga0187808_10059722 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300017947|Ga0187785_10077991 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300017994|Ga0187822_10146770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
3300018017|Ga0187872_10051140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 2210 | Open in IMG/M |
3300018075|Ga0184632_10371282 | Not Available | 607 | Open in IMG/M |
3300020579|Ga0210407_11313869 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300020581|Ga0210399_10181209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1749 | Open in IMG/M |
3300020581|Ga0210399_10333918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
3300020582|Ga0210395_10587184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 836 | Open in IMG/M |
3300020583|Ga0210401_10914094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
3300021180|Ga0210396_10993198 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300021180|Ga0210396_11244173 | Not Available | 621 | Open in IMG/M |
3300021180|Ga0210396_11593633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
3300021401|Ga0210393_11121911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
3300021402|Ga0210385_10633295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
3300021404|Ga0210389_11252253 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300021405|Ga0210387_11042464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
3300021407|Ga0210383_11392401 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300021433|Ga0210391_10310425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
3300021474|Ga0210390_10405357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1152 | Open in IMG/M |
3300021477|Ga0210398_10320686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
3300021477|Ga0210398_11249923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
3300021478|Ga0210402_10025109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5127 | Open in IMG/M |
3300021478|Ga0210402_10329830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 1414 | Open in IMG/M |
3300021560|Ga0126371_10235724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1939 | Open in IMG/M |
3300025625|Ga0208219_1121986 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300025703|Ga0208357_1033835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1788 | Open in IMG/M |
3300025898|Ga0207692_10915410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
3300025905|Ga0207685_10075151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1382 | Open in IMG/M |
3300025906|Ga0207699_11269174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300025908|Ga0207643_10373020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
3300025910|Ga0207684_10229156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1603 | Open in IMG/M |
3300025915|Ga0207693_10607651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
3300025916|Ga0207663_10510292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
3300025922|Ga0207646_11184441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
3300025928|Ga0207700_10474794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300025928|Ga0207700_11830018 | Not Available | 533 | Open in IMG/M |
3300025937|Ga0207669_10226060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8 | 1377 | Open in IMG/M |
3300025949|Ga0207667_10488000 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300025972|Ga0207668_11932254 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300026089|Ga0207648_11160455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8 | 725 | Open in IMG/M |
3300026089|Ga0207648_11775393 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 578 | Open in IMG/M |
3300026490|Ga0257153_1119754 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300027567|Ga0209115_1067931 | Not Available | 812 | Open in IMG/M |
3300027662|Ga0208565_1153580 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300027750|Ga0209461_10008671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1703 | Open in IMG/M |
3300027767|Ga0209655_10139498 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300027867|Ga0209167_10723073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300027908|Ga0209006_11386969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
3300027909|Ga0209382_11571097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
3300028780|Ga0302225_10241117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300028806|Ga0302221_10042497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2112 | Open in IMG/M |
3300028810|Ga0307294_10036656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. MH-G8 | 1375 | Open in IMG/M |
3300028814|Ga0307302_10046013 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
3300028828|Ga0307312_10535634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
3300028884|Ga0307308_10393166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
3300029999|Ga0311339_10478032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CB01881 | 1274 | Open in IMG/M |
3300030499|Ga0268259_10079295 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300030520|Ga0311372_10296079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2562 | Open in IMG/M |
3300030739|Ga0302311_10966677 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031091|Ga0308201_10228254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 630 | Open in IMG/M |
3300031114|Ga0308187_10429269 | Not Available | 528 | Open in IMG/M |
3300031544|Ga0318534_10022499 | Not Available | 3366 | Open in IMG/M |
3300031546|Ga0318538_10552745 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300031546|Ga0318538_10720468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
3300031549|Ga0318571_10150495 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300031572|Ga0318515_10020584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 3111 | Open in IMG/M |
3300031668|Ga0318542_10472307 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300031680|Ga0318574_10349096 | Not Available | 862 | Open in IMG/M |
3300031680|Ga0318574_10877465 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300031708|Ga0310686_104551934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
3300031708|Ga0310686_119451396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
3300031718|Ga0307474_10656807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
3300031724|Ga0318500_10583495 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300031740|Ga0307468_102243424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
3300031744|Ga0306918_10197611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1514 | Open in IMG/M |
3300031747|Ga0318502_10899839 | Not Available | 538 | Open in IMG/M |
3300031751|Ga0318494_10073383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1847 | Open in IMG/M |
3300031763|Ga0318537_10275721 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300031764|Ga0318535_10242036 | Not Available | 807 | Open in IMG/M |
3300031765|Ga0318554_10588826 | Not Available | 627 | Open in IMG/M |
3300031768|Ga0318509_10801587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300031781|Ga0318547_10441853 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300031793|Ga0318548_10307630 | Not Available | 778 | Open in IMG/M |
3300031793|Ga0318548_10448650 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300031795|Ga0318557_10313079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300031796|Ga0318576_10608653 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300031797|Ga0318550_10662882 | Not Available | 500 | Open in IMG/M |
3300031819|Ga0318568_10212805 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300031821|Ga0318567_10353165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300031823|Ga0307478_10395242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1144 | Open in IMG/M |
3300031833|Ga0310917_10378107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
3300031835|Ga0318517_10110519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1211 | Open in IMG/M |
3300031845|Ga0318511_10514983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
3300031846|Ga0318512_10363255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
3300031859|Ga0318527_10189438 | Not Available | 869 | Open in IMG/M |
3300031879|Ga0306919_10976819 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031880|Ga0318544_10448567 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031894|Ga0318522_10156265 | Not Available | 860 | Open in IMG/M |
3300031897|Ga0318520_10960906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300031910|Ga0306923_11059570 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300031946|Ga0310910_10147334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1798 | Open in IMG/M |
3300031947|Ga0310909_11612825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300031954|Ga0306926_12140626 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300032001|Ga0306922_10821392 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300032010|Ga0318569_10366848 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300032043|Ga0318556_10230101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
3300032043|Ga0318556_10607698 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300032060|Ga0318505_10407699 | Not Available | 642 | Open in IMG/M |
3300032060|Ga0318505_10436984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium ahvazicum | 619 | Open in IMG/M |
3300032066|Ga0318514_10584451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 595 | Open in IMG/M |
3300032067|Ga0318524_10195895 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300032068|Ga0318553_10264023 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300032068|Ga0318553_10620336 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300032076|Ga0306924_11089276 | Not Available | 871 | Open in IMG/M |
3300032089|Ga0318525_10184609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1072 | Open in IMG/M |
3300032089|Ga0318525_10374616 | Not Available | 730 | Open in IMG/M |
3300032160|Ga0311301_10147404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4276 | Open in IMG/M |
3300032174|Ga0307470_10358426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
3300032180|Ga0307471_102982617 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300032805|Ga0335078_11227119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 863 | Open in IMG/M |
3300032805|Ga0335078_11728941 | Not Available | 684 | Open in IMG/M |
3300032892|Ga0335081_10689486 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300032895|Ga0335074_10254987 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
3300033179|Ga0307507_10640864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Ornithinicoccus → Ornithinicoccus soli | 541 | Open in IMG/M |
3300033289|Ga0310914_10230810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1659 | Open in IMG/M |
3300033289|Ga0310914_10383379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1272 | Open in IMG/M |
3300033289|Ga0310914_11096155 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.02% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.09% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.39% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.93% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.46% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.46% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.46% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.46% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.46% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.46% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.46% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.46% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.46% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_114039171 | 3300000891 | Soil | MTDDSDRAAWLRQARDHLRAADPVLARLIDDRPDFDPRAW |
Ga0062387_1013756411 | 3300004091 | Bog Forest Soil | VTKDAGRAAWLRQARAYLRDADPVLARLIDERPDFDPQAWMA |
Ga0008092_111619762 | 3300004629 | Tropical Rainforest Soil | VEGAGSVTGDSTRVAWLQQGRSYLHHADTVLARLIDDRPDF |
Ga0068869_1014544352 | 3300005334 | Miscanthus Rhizosphere | VVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWL |
Ga0070682_1013804531 | 3300005337 | Corn Rhizosphere | MVTEDSGREAWLRHARSYLRNADPVLARLIDDRPDFDLAEA |
Ga0070659_1001149863 | 3300005366 | Corn Rhizosphere | VVERTNRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWL |
Ga0070714_1001991473 | 3300005435 | Agricultural Soil | VTTDTSRTEWLRRARSYLRDADPVLARLIDARPDFDPRAWLS |
Ga0070713_1016847312 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGHHGSVTDDADRAAGLSGARSYLRAADPVLARLIDDRPDFDP |
Ga0070678_1022035011 | 3300005456 | Miscanthus Rhizosphere | VVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAW |
Ga0070684_1014875621 | 3300005535 | Corn Rhizosphere | VTEDPGHDVWLRQARSHLRGADAVLARLIDDRPAPDPRAWLAPPVARLGSG* |
Ga0070686_1005738961 | 3300005544 | Switchgrass Rhizosphere | MVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLAQ |
Ga0070762_105930371 | 3300005602 | Soil | VTEDSGRAAWLRAARSYLHSADPVLARLIDERPDFDPRAW |
Ga0070764_107861111 | 3300005712 | Soil | MATGDSSHAEWLHRARSHLRNADPVLARVIDERPAFDPQESF |
Ga0066903_1007743241 | 3300005764 | Tropical Forest Soil | VSEDSSRAAWLQQARAYLREADPVLARLIEDRPDFDPRAWMA |
Ga0066903_1044109662 | 3300005764 | Tropical Forest Soil | VTEDSSRVAWLQQARSYLRNADPVLARLIDDRPDFDPRAW |
Ga0070717_110666291 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDPSRAVWLQQARSYLRNADPVLARLIDDRPAFDPR |
Ga0070717_111684012 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDPDPGRAAWLQQARSFLHDADPVLARLIDERPGFDPQEWMAQLP |
Ga0070717_119828273 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEDSDRAAWLRQARDHLRAADPVLARLIDDRPDFDPR |
Ga0075432_100619931 | 3300006058 | Populus Rhizosphere | VSEDSSSAVWLQQARSYQRDADPVLARLIDDRPTFDPRAWMA |
Ga0075017_1003730641 | 3300006059 | Watersheds | MTRDSGRAEWLRQARAYLRGADPVLARLIDDRPDFDPR |
Ga0075015_1007849332 | 3300006102 | Watersheds | MSSMTEDSSRAEWLQQARAYLSDADPVLARLIDER |
Ga0070716_1008950472 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDSGPAEGLEQARSYLRNADPVLARLIDDRPAFDP |
Ga0070712_1016285821 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEDSSRAVWLQQARSYLRDADPVLARLIDDRPDFDPQAWLAQLPPMD |
Ga0074059_119995031 | 3300006578 | Soil | VTEDSGRAMRLQQARGYLHNADPVLARLIDDRPAFDPQAWMA |
Ga0074062_125161902 | 3300006606 | Soil | VTEDSIRAVRLQQARSYLREADPVLAGLIDDRPAFDPQAWLAQL |
Ga0079222_101666272 | 3300006755 | Agricultural Soil | VTGGSSRDAWLRQARSYLHNADPVLARLIDERPEFDPRAWMTQL |
Ga0066658_100030369 | 3300006794 | Soil | VEGAGSVTGDSSRVVWLRQARSYLHHADPVLARLID |
Ga0079221_108743392 | 3300006804 | Agricultural Soil | MVTEDSGREAWLRHARSYLRNADPVLAPLIDDRPDFDLAEA |
Ga0075428_1027419882 | 3300006844 | Populus Rhizosphere | VSEDSSRAVSLQQARSYLRDADPVLARLIDDRPAFDPRAWLA |
Ga0075431_1022026762 | 3300006847 | Populus Rhizosphere | VTEDSSRAMWLQQARSYLRDADPVLARLIDDRPAFDPRAWMA |
Ga0075425_1022049282 | 3300006854 | Populus Rhizosphere | VTEDSGPGEGLEQARSYLRNADPVLARLIDDRPAFDPRAWL |
Ga0075424_1018211562 | 3300006904 | Populus Rhizosphere | VSEDSNRAVWLPGARSYLRHADAVLARLIDDRPAPDPRAWLAPPVARLGSG* |
Ga0079219_107684152 | 3300006954 | Agricultural Soil | MTEDPDHAAWLEQARSHLRNADPVLARLIDDRPDFDPR |
Ga0079219_110327262 | 3300006954 | Agricultural Soil | VTEDSGPAEGLEQARSYLRNADPVLARLIDDRPAFDPRAWLA |
Ga0075435_1010173032 | 3300007076 | Populus Rhizosphere | VTEDADRAAGLQQARSYLRQADPVLARLIDDRPAFDPRAWMA |
Ga0099795_101172282 | 3300007788 | Vadose Zone Soil | VTRDSSRAVWLQRERSYLRHTDPVLARLIDDRPDF |
Ga0099830_108793792 | 3300009088 | Vadose Zone Soil | VTEDSSRAEWLQQARSYLRNADPVLARLIDDRPAFDPRAW |
Ga0099828_110239191 | 3300009089 | Vadose Zone Soil | VTGDSGRAGWLAQARSYLRGADPVLARLIDERLDSIRGRGWLS |
Ga0111538_141038101 | 3300009156 | Populus Rhizosphere | MTELSSHAAWLQHARSALRDADPVLARLIDHRPDFDPRAWMAQ |
Ga0075423_123375001 | 3300009162 | Populus Rhizosphere | VTDDSDRAAWLRQARSYLRNADPVLARLIDDRPAFD |
Ga0116214_10282105 | 3300009520 | Peatlands Soil | VGSVSEDSSRAAWLRQARSYLRNADPVLARLIDGR |
Ga0105238_109443891 | 3300009551 | Corn Rhizosphere | VTGDGDRAERLERARARLRDADPVLASLIDKQPDFDPQ |
Ga0126314_114386411 | 3300010042 | Serpentine Soil | VSEDSSRAVWLPRARSYLRHADPVLARLIDDRPAFDPRAW |
Ga0126380_102786562 | 3300010043 | Tropical Forest Soil | VTEDSGRAGTLEQARSYLHGADPVLARLIDKRPDFDPRAW |
Ga0126370_106061721 | 3300010358 | Tropical Forest Soil | VTEDASRAEWLQQARSYLRGADPVLARLIDQRPDFDPRAWL |
Ga0126378_108341512 | 3300010361 | Tropical Forest Soil | MTDDAGRAAWLQQARSYLRGADPVLARLIDERPDFDPRA |
Ga0126378_119965351 | 3300010361 | Tropical Forest Soil | VEGVGSVTRDSSRIVWLRQARSYLHHADPVLARLIDDRPDFDPRA |
Ga0126379_104061871 | 3300010366 | Tropical Forest Soil | VTEDSSRAAWLQQARSYLRGADPVLARLIDDRPAFDPRAWLAQ |
Ga0126379_128496572 | 3300010366 | Tropical Forest Soil | VTEDSSRVVWLRQARSYLRNADPVLARLVDDRPDFDP |
Ga0126381_1033829371 | 3300010376 | Tropical Forest Soil | VTEDSSHDAWLQQARSSLRNADPVLARLIDDRPDFDPRAWL |
Ga0126383_101699971 | 3300010398 | Tropical Forest Soil | VTEDSSRAAWLQEARSYLRSADPVLARLIDDRPAFDPRAWM |
Ga0126383_116707991 | 3300010398 | Tropical Forest Soil | MTEDSSRTKWLMQARSYLRSADPVLARLIDDRPDFDPRAWMTQ |
Ga0134121_115095582 | 3300010401 | Terrestrial Soil | MVTEDSGREAWLRHARSYLRNADPVLARLIDDRPD |
Ga0137393_104077431 | 3300011271 | Vadose Zone Soil | MTEDSSRAEWLQQARSYLRNADPVLARLIDDRPAFDPRAWMAQ |
Ga0137389_113535431 | 3300012096 | Vadose Zone Soil | VSEDSSRAAWLRQARSYLHDADPVLARLIDDRPDFDPRAW |
Ga0137383_106504981 | 3300012199 | Vadose Zone Soil | VTEDANHAAWLQQARSHLGSADPVLARLIDDRPDFDPQA |
Ga0137362_114862591 | 3300012205 | Vadose Zone Soil | VSEDPRRAGWLPQARAYLRGADPVLARLIDARPDFDPRGVAGPAAAAGP |
Ga0137378_105505443 | 3300012210 | Vadose Zone Soil | VTEDSSRAEWLRQARSHLRSADPVLARLIDDRPAFDPRAWMAQ |
Ga0137387_100633573 | 3300012349 | Vadose Zone Soil | VTEDPSRAEWLQQARTYLRNADPVLARLIDDRPAFDPRAWM |
Ga0137372_100240861 | 3300012350 | Vadose Zone Soil | VTEDSSRAAWLRQARSYLRNADPVLARLINDRPAFDPR |
Ga0137367_103944703 | 3300012353 | Vadose Zone Soil | VTEDSSRAAWLQQARSYLRQADPVLARLIDDRPAF |
Ga0137366_111125041 | 3300012354 | Vadose Zone Soil | VTEEAERAAWLQQARSHLRQADPVLARLIDDRPGFDPQAWMAW |
Ga0137361_110865013 | 3300012362 | Vadose Zone Soil | VTEDSSRGEWLQQARSYLRNADPVLARLIDDRPAFDPRAWMAQ |
Ga0157320_10053112 | 3300012481 | Arabidopsis Rhizosphere | MVTEDSSREVRLRQARSYLRNTDPVLARLIDDRPDFDLAE |
Ga0137395_107890991 | 3300012917 | Vadose Zone Soil | VSEDSSRAGWLRQARSYLRRADPVLARLIDDRPDFDPRAW |
Ga0164300_108088741 | 3300012951 | Soil | VTEDSSRAAWLAQARSYLRHADPVLARLINDQPDFDPRAW |
Ga0164300_112112092 | 3300012951 | Soil | VTGGSSRAAGLRQARSTLRNADPVLARLIDERPEFDPRAW |
Ga0126369_118961732 | 3300012971 | Tropical Forest Soil | VTEDSSRATWLQQARFRLRNADPVLARLIDERPDFDPRAWLSQ |
Ga0164306_106979142 | 3300012988 | Soil | METEDSSRAVGLQQARSYLRKADPVLARLIDDRPDFDLAEAR |
Ga0164306_110941722 | 3300012988 | Soil | MVTEDSSREVRLRQARSYLRNADPVLARLIDDRPDFDL |
Ga0157373_103425402 | 3300013100 | Corn Rhizosphere | METEDSGREAWLRHARSYLRKADQVLARLIDDRPDFDPRAWRDN |
Ga0157372_131798761 | 3300013307 | Corn Rhizosphere | MAEGTSPVIERTYRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLAQL |
Ga0182015_108195711 | 3300014495 | Palsa | VSEDPKRAAGLRKIRSYLHKADPVLAALIDERPDFDPQAW |
Ga0157377_110492121 | 3300014745 | Miscanthus Rhizosphere | VTGDSSRAAWLRQARSTLRSADPVLARLIDERPDFDPRAWIAQ |
Ga0173483_101260913 | 3300015077 | Soil | LVTEDAGRAEWLQQARSYLHNADPVLARLIDDRPAFDP |
Ga0137412_100722231 | 3300015242 | Vadose Zone Soil | VTEDSGPAEGLEQARSYLRNTDPVLARVIDDRPAF |
Ga0137409_104578582 | 3300015245 | Vadose Zone Soil | VTEDSGPAEGPEQARSYLRNADPVLALVPADRRATLIA |
Ga0137403_115253112 | 3300015264 | Vadose Zone Soil | VSEDSSRAAWLRQARSYLRHADPVLARLIDDRPDFDPR |
Ga0132255_1034144721 | 3300015374 | Arabidopsis Rhizosphere | MSTTADGGSRATSLQQARARLHDADPVLARPIDSQPDFDPNAWLAQL |
Ga0182036_111653351 | 3300016270 | Soil | MTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPR |
Ga0182035_102812812 | 3300016341 | Soil | VTGDSGRAAWLRQARSHLGDADPVLARLIGERPDFDPRAW |
Ga0182032_118546331 | 3300016357 | Soil | MTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRAW |
Ga0182034_114348901 | 3300016371 | Soil | MTEDSGQAGRLAEARSYLHDADPVLARLIDDRPDFDPRAWLA |
Ga0182039_117789741 | 3300016422 | Soil | VTEDSSRAAWLQQTRSYLHDADPVLARLIDDRPDFDPRAWLTQ |
Ga0187807_12715642 | 3300017926 | Freshwater Sediment | VTEDSSRSAWLQQARSYLHHADPVLARLIDNRPDF |
Ga0187806_10753572 | 3300017928 | Freshwater Sediment | MTEDHSDAAWLRQARSHLRGADPVIARCIDARPDFDPR |
Ga0187808_100597221 | 3300017942 | Freshwater Sediment | VSEDSSRAVWLQQARSYLRDADPVLARLIDGRPDFDP |
Ga0187785_100779913 | 3300017947 | Tropical Peatland | VTEDSSRVVWLQQARSYLRNADPVLARLIDDRPDFDPR |
Ga0187822_101467701 | 3300017994 | Freshwater Sediment | VTEDSGPAQGGLEEARSYLRDADPVLARLIDDRPAFDP |
Ga0187872_100511404 | 3300018017 | Peatland | VSEDSSRAVWLPQARSYLRHADPVLARLIDERPDFD |
Ga0184632_103712822 | 3300018075 | Groundwater Sediment | VSEDSSRAMWLQQARSYLRDADPVLARLIDDRPAFDPRARLAQLPPM |
Ga0210407_113138692 | 3300020579 | Soil | VTGDSGRAVWLEQACSYLRGADPVLARLIGARPDFDPRVWL |
Ga0210399_101812094 | 3300020581 | Soil | VIKEDSARAAWLQQARSHLREADTVLARLIDDRPDF |
Ga0210399_103339183 | 3300020581 | Soil | VTEHPSRAAWLQQARSYLRNADPVLARLVDDRPDFDPW |
Ga0210395_105871841 | 3300020582 | Soil | VSEDPGRAVWLPQARSYLRDGDPVLARLIDDRPDFDPRAWM |
Ga0210401_109140941 | 3300020583 | Soil | VTEDPGRAAWLRQTRAYLRDADPVLARLIDERPDFD |
Ga0210400_108328442 | 3300021170 | Soil | MTSADARWLQQARSHLRDADPVLARLIDDRPDFDP |
Ga0210396_109931981 | 3300021180 | Soil | VSEDPGRAVWLPQARSYLRDGDPVLARLIDDRPDFDPRAW |
Ga0210396_112441732 | 3300021180 | Soil | MTDDSSRGASLRQARSYLGNADPVIAKLIDERPAF |
Ga0210396_115936331 | 3300021180 | Soil | VTDESGHAAWLEQARSYLHNADPVLAALIDDRPDFDPRA |
Ga0210393_111219111 | 3300021401 | Soil | VSEDPGRAVWLPQARSYLRDGDPVLARLIDDRPDFDPRAWMDQ |
Ga0210385_106332953 | 3300021402 | Soil | MATGDSSHAEWLHRARSHLRNADPVLARVIDERPAFDPQ |
Ga0210389_112522531 | 3300021404 | Soil | VTGDSGRAVWLEQACSYLRGADPVLARLIDARPNFDPR |
Ga0210387_110424641 | 3300021405 | Soil | VTEDSSRANWLVQARSYLRDADPVLARLIDERPDFD |
Ga0210383_113924011 | 3300021407 | Soil | VTEDSGPAEGLEQARAYLRNADPVLARLIDNRPAFDPRAWM |
Ga0210391_103104251 | 3300021433 | Soil | MATGDSSHAEWLHRARSHLRNADPVLARVIDERPAF |
Ga0210390_104053571 | 3300021474 | Soil | VTEDSGPAEGLEQARAYLRNADPVLARLIDNRPAFDPRAW |
Ga0210398_103206864 | 3300021477 | Soil | VTDDSSRAAWLQQARSHLRTADPVLARLIDERPAFD |
Ga0210398_112499231 | 3300021477 | Soil | MDRRTEDSSRAAWLGQARSYLRAADPVLARLIDDRPDFDPRAWMS |
Ga0210402_100251091 | 3300021478 | Soil | METEDSSRAVGLQQARSYLRKADPVLARLIDDRPHFDPRA |
Ga0210402_103298301 | 3300021478 | Soil | VATEASRAEWLRRARSHLRDADPVLARLIDARPDF |
Ga0126371_102357241 | 3300021560 | Tropical Forest Soil | VSEDSSRAAWLQQARAYLREADPVLARLIEDRPDFDPR |
Ga0208219_11219862 | 3300025625 | Arctic Peat Soil | VSEDPSRAVWLQQARSYLRNADPVLARLIDDRPDFDPRTWL |
Ga0208357_10338351 | 3300025703 | Arctic Peat Soil | VTEDSSRAVGLQQARSYLRDADPVLARLIGDRPEFDPRAWIA |
Ga0207692_109154102 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKDSSRAEWLPQARSYLRYADPVLARLIDDRPDFDP |
Ga0207685_100751514 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTEDSGRQVWLRHARSHLRNADPVLAGLIDDRPDFDPQAWLDNP |
Ga0207699_112691742 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDSGRAMRLQQARAYLHNADPVLAGLIDDRPAFDPQAWMA |
Ga0207643_103730203 | 3300025908 | Miscanthus Rhizosphere | VTEDSGRAMRLQQARADLHNADPVLARLIDDRPAFDPQAWMARLPP |
Ga0207684_102291561 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTEDSSREVWLRQARSYLRNADPVLARLIDDRPD |
Ga0207693_106076511 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEHPSRAAWLQQARSYLRNADPVLARLVDDRPDFDPWAWRDNAFGLPPS |
Ga0207663_105102923 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLQQARAYLHNADPVLARLIDDRPAFDPQAWMARLPPMDL |
Ga0207646_111844411 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDSGAAGSLPQARAYLRRADPVLARLIDDRPDFDPR |
Ga0207700_104747943 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDSSRAAWLAQARSYLRHADPVLERLINDQPDFDP |
Ga0207700_118300181 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTEDSGRQVWLRHARSHLRNADPVLAGLIDDRPDFDPQA |
Ga0207669_102260602 | 3300025937 | Miscanthus Rhizosphere | VVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLAQLP |
Ga0207667_104880003 | 3300025949 | Corn Rhizosphere | VSGDSSRAAWLRQARSTLRSADPVLARLIDERPDFDPRAWIAQ |
Ga0207668_119322541 | 3300025972 | Switchgrass Rhizosphere | VVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPDAWLA |
Ga0207648_111604552 | 3300026089 | Miscanthus Rhizosphere | VVERINRADRLQHARSTLRDADPVLARLIDDRPDFDPD |
Ga0207648_117753932 | 3300026089 | Miscanthus Rhizosphere | VIERTYRADRLQHARSTLRDADPVLARLIDDRPDF |
Ga0257153_11197541 | 3300026490 | Soil | VTEDSSPGEGLEQARSYLRSADPVLARLIDDRPAFDPRA |
Ga0209115_10679312 | 3300027567 | Forest Soil | VTEDSSRAGWLQQARTYLSDADPVLARLIGDRPEFDPR |
Ga0208565_11535802 | 3300027662 | Peatlands Soil | VSEDPSRAVWLPQARSYLRNVDPVLARLIDDRPDFDP |
Ga0209461_100086712 | 3300027750 | Agave | VTEDSSRAVWLQQARSYLRQADPVLARLIDDRPGFDPRAWM |
Ga0209655_101394982 | 3300027767 | Bog Forest Soil | VTEDSGRAAWLRQTRAYLREADPVLARLIDERPDFDPQAWMA |
Ga0209167_107230731 | 3300027867 | Surface Soil | MTEVSSHAAWLRQARSHLRDADPVLARLIDERPDFDP |
Ga0209006_113869691 | 3300027908 | Forest Soil | VSEDPSRAAWLRQTRSYLRNADPVLARLIDDRPDFDPQAWRAQL |
Ga0209382_115710973 | 3300027909 | Populus Rhizosphere | MGSVTDDSDRAAWLRKARSYLRNADPVLARLIDDRPAF |
Ga0265357_10079912 | 3300028023 | Rhizosphere | MTSADARWLQQARAHLRDADPVLARLIDDRPDFDP |
Ga0302225_102411171 | 3300028780 | Palsa | VTEDPDRAATLRQARAYLHDSDPVLARLIDERPGFDPQ |
Ga0302221_100424971 | 3300028806 | Palsa | VTEDPDRAATLRQARAYLHDSDPVLARLIDERPGFDPQAWMTRL |
Ga0307294_100366561 | 3300028810 | Soil | VVERTNRADRLQHARSTMRDADPVLARLIDDRPDFDPDAW |
Ga0307302_100460132 | 3300028814 | Soil | MKGAGSVTEDASRAAWLQQARSYLRNADPVLARLIDDRPAFDPRAWMA |
Ga0307312_105356342 | 3300028828 | Soil | VTEDSSRSAWLQQARSYLSNADPVLARLIEDRPDFDPRA |
Ga0307308_103931662 | 3300028884 | Soil | VTEDADRAAWLQRARTHLHQADPVLARLIDDRPAFYP |
Ga0311339_104780321 | 3300029999 | Palsa | VEGVSEDSGRTGWLQQARSHLRRADPVLARLIDDRPDAGPDP |
Ga0268259_100792951 | 3300030499 | Agave | VTEDSSRAVWLQQARSYLRNADPVLARLIDDRPAFDPRAWM |
Ga0311372_102960791 | 3300030520 | Palsa | VSEDSSRTAALLQTRSYLRNADPVLARLIDERPDFDPQ |
Ga0302311_109666772 | 3300030739 | Palsa | VSEDSSRAGGLRQTRSYLSQADPVLARLIDERPDFDPQAWR |
Ga0308201_102282541 | 3300031091 | Soil | VTLDASRVAWLQQTRSHLRNADPVLARLIDDRPDFDPRA |
Ga0308187_104292691 | 3300031114 | Soil | MKGAGSVPEDASRAAWLQQARSYLRNADPVLARLIDER |
Ga0318534_100224994 | 3300031544 | Soil | VTADAGGAEWLERARSYLAGADPVLARLIAQQPDFDPRQPD |
Ga0318538_105527452 | 3300031546 | Soil | MTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRAWIT |
Ga0318538_107204681 | 3300031546 | Soil | VTEDSSHDAWLQQARSYLRKADPVLARLIDDRPDFDPRAWLTQ |
Ga0318571_101504951 | 3300031549 | Soil | VTEDSSRVAWLQQARSHLHDADPVLARLIDDRPDFDPRAWMD |
Ga0318515_100205845 | 3300031572 | Soil | VSKDSSRAAWLQQARSYLRQADPVLARLIDDRPEFDPRAWMTQL |
Ga0318542_104723072 | 3300031668 | Soil | MTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRA |
Ga0318574_103490961 | 3300031680 | Soil | VTADAGGAEWLERARSYLAGADPVLARLIAQQPDFDPRAWLAQL |
Ga0318574_108774652 | 3300031680 | Soil | MTDDSSRAAWLQQARSYLRGADPVLARLIDDRPDFDPRTW |
Ga0310686_1045519342 | 3300031708 | Soil | VTEDSGRAALLRQARAYLREADPVLARLIDERPDFD |
Ga0310686_1194513961 | 3300031708 | Soil | VSEDSSRAAWLRQTRSYLRSADPVLARLIDDRPDFDPQAWRARLP |
Ga0307474_106568071 | 3300031718 | Hardwood Forest Soil | VNEDPSRAEWLPRARSYLRQADPVLARLIDDRPDFDPRAWL |
Ga0318500_105834952 | 3300031724 | Soil | VTVDSGRAAWLQQSRSHLGDADPVLARLIDERPDFDPGRG |
Ga0307468_1022434241 | 3300031740 | Hardwood Forest Soil | VTVDASRAAWLQQARSHLRNADPMLARLIDDRPDFDPR |
Ga0306918_101976113 | 3300031744 | Soil | MTEDPDHAAWLEQARLHLRNADPVLARLIDDRPDFDP |
Ga0318502_108998392 | 3300031747 | Soil | VTENSDRTMWLQDARAYLRKADPVLAGLIDDRPTFD |
Ga0318494_100733831 | 3300031751 | Soil | MTEDSSRAEWLTRARSYLKSADPVLAGLIDDRPAFDPRAW |
Ga0318537_102757212 | 3300031763 | Soil | VTEDSSRVAWLQQARSYLRQADPVLARLIDNRPDFDPRAWIT |
Ga0318535_102420361 | 3300031764 | Soil | MTGDSSRDAWLQQARSHLRSADPVLARLIDDRPAFDP |
Ga0318554_105888261 | 3300031765 | Soil | VTEDSSRAAWLQQTRSYLHDADPVLARLIDDRPDFD |
Ga0318509_108015871 | 3300031768 | Soil | VSEDPSRAVWLSQARAYLRHAEPVLARLIDGRPGFDPR |
Ga0318547_104418532 | 3300031781 | Soil | VTEDSSRAAWLAQARSYLRQADSVLARLIDDRPDFDPRAWMT |
Ga0318548_103076302 | 3300031793 | Soil | VTADAGGAEWLERARSYLAGADPVLARLIAQQPDFDPRQ |
Ga0318548_104486501 | 3300031793 | Soil | MTEDPDHAAWLEQARSHLRNADPVLARLIDDRPDFD |
Ga0318557_103130791 | 3300031795 | Soil | VTEDPSRTAWLQQARSHLRNADPVLARLIEDRPAFDPRAWLA |
Ga0318576_106086532 | 3300031796 | Soil | MTDDSSRADWLRQARSYLRGADPVLARLIDDRPDFDPRAW |
Ga0318550_106628821 | 3300031797 | Soil | VTEDSSHDAWLQEARSSLRNADPVLARLIDDRPDFD |
Ga0318568_102128051 | 3300031819 | Soil | VTEDSSRAAWLAQARSYLRQADSVLARLIDDRPDF |
Ga0318567_103531654 | 3300031821 | Soil | VSKDSSRAAWLAQARSYLRQADPVLARLIDDRPDFDPRAWMT |
Ga0307478_103952423 | 3300031823 | Hardwood Forest Soil | VTEHSKRVAWLRRARSYLRNADPVLARLIDERPDFDFAQARLDN |
Ga0310917_103781071 | 3300031833 | Soil | MTDDSSRADWLRQARSYLRGADPVLARLIDDRPDF |
Ga0318517_101105191 | 3300031835 | Soil | MTEDSSRAEWLTRARSYLKSADPVLAGLIDDRPAFDPRA |
Ga0318511_105149831 | 3300031845 | Soil | MTEDSSRVVWLQQARSHLRNADPVLARLIDDRPAFD |
Ga0318512_103632551 | 3300031846 | Soil | VTSDPGHAEWLQHARSHLRDADPVLARLIDDRPDFDPRGVA |
Ga0318527_101894382 | 3300031859 | Soil | VTVDSGRAAWLQQARSHLRNADPVLARLIDERPDFDPGRG |
Ga0306919_109768191 | 3300031879 | Soil | VVAVTEDSDRAVWLRQARSYLSTADPVLARLIGDRP |
Ga0318544_104485672 | 3300031880 | Soil | MTGDSSRDAWLQQARSHLRSADPVLARLIDDRPAFDPRAW |
Ga0318522_101562652 | 3300031894 | Soil | VTADAGGAEWLERARSYLAGADPVLARLIAQQPDFD |
Ga0318520_109609062 | 3300031897 | Soil | VTEDSSRDGWLREARSYLRSADPVLARLIDERPDFDPRAW |
Ga0306923_110595702 | 3300031910 | Soil | VSKDSSRAAWLQQARSYLRQADPVLARLIDDRPEFDPRAW |
Ga0310910_101473344 | 3300031946 | Soil | VTSDPGHAEWLQHARSHLRDADPVLARLIDDRPDFDPRGVAS |
Ga0310909_116128252 | 3300031947 | Soil | MTQDSSRAEWLRQARSHLRGADPVLARLIDDQPEFDPREWMSQLPP |
Ga0306926_121406261 | 3300031954 | Soil | MTEDPDHAAWLEQARSHLRHADPVLARLIDDRPDFDP |
Ga0306922_108213922 | 3300032001 | Soil | VNEDPSRAVWLSQARAYLRDADPVLARLIDGRPDFDPRAW |
Ga0318569_103668481 | 3300032010 | Soil | VVAVTEDSGRAVWLRQARSYLSTADPVLARLIHDRPDFNPRA |
Ga0318556_102301011 | 3300032043 | Soil | VTEDPSHDAWLQQARSYLRNADPVLARLIDARPDFDPRARLTQ |
Ga0318556_106076981 | 3300032043 | Soil | VSKDSSRAAWLQQARSYLRQADPVLARLIDDRPDFDPR |
Ga0318505_104076991 | 3300032060 | Soil | MTDDSSRADWLRQARSYLRGADPVLARLIDDRPDFD |
Ga0318505_104369841 | 3300032060 | Soil | MTEDPDHAAWLEQARSHLRRADPVLARLINDRPDFDPMAWLAQLP |
Ga0318514_105844511 | 3300032066 | Soil | VTQDPGRAGWLQRARSRLRAADPVLARLVDDRPDFDPRA |
Ga0318524_101958952 | 3300032067 | Soil | VVAVTEDSDRAVWLRQARSYLSTADPVLARLIHDRPDFDPRAWMSLA |
Ga0318553_102640232 | 3300032068 | Soil | VTEDSEHAAWLEQARSHLRDADPVLGRLIAERPDFD |
Ga0318553_106203361 | 3300032068 | Soil | VTVDSGRAAWLQQSRSHLGDADPVLARLIDERPDFDPRAWI |
Ga0306924_110892761 | 3300032076 | Soil | VTVDSGRAAWLQQSRSHLGDADPVLARLIDERPDFDPR |
Ga0318525_101846092 | 3300032089 | Soil | VTGDSGHAAWLQQARSYLRDADPVVARLIDERPGFDPRAW |
Ga0318525_103746162 | 3300032089 | Soil | VTEDSSHNAWLQQARSSLRNADPVLARLIDDRPDFDPR |
Ga0311301_101474041 | 3300032160 | Peatlands Soil | VSEDSSRAAWLRQARSYLRNADPVLARLIDGRPDFD |
Ga0307470_103584261 | 3300032174 | Hardwood Forest Soil | VTEDPGHDVWLRQARSHLRGADAVLARLIDDRPDF |
Ga0307471_1029826171 | 3300032180 | Hardwood Forest Soil | MVTEDSSREVWLRQARSYLRNADPVLARLIDDRPDFDLAEARL |
Ga0335078_112271192 | 3300032805 | Soil | VSEDPSRAVWLPQARAYLRQADPVLARLIDDRPEFDPQ |
Ga0335078_117289412 | 3300032805 | Soil | VTGDSSRTVWLQQARSCLRQADPVLARLIGERPGFDPRAWMIQPP |
Ga0335081_106894863 | 3300032892 | Soil | MTDLVSTGDRAAWTRSAVRHLRAADPVLARLIDERPDFDPR |
Ga0335074_102549873 | 3300032895 | Soil | VSVDSDRAARLSHTRSYLRAADPVMARLIDQRPDFDPQ |
Ga0307507_106408641 | 3300033179 | Ectomycorrhiza | VSEDSSRADWLLRARSRLRRADPVLARLIDDRPDFDPRA |
Ga0310914_102308103 | 3300033289 | Soil | MTDDSSRADWLRQARSYLRGADPVLARLIDDRPDFDP |
Ga0310914_103833791 | 3300033289 | Soil | VTGDSGHAAWLQQARSYLRDADPVVARLIDERPDFDPR |
Ga0310914_110961552 | 3300033289 | Soil | VVAVSEDSDRVAWLQQARAYLRHADPVLARLIDDRPDFD |
⦗Top⦘ |