Metagenome / Metatranscriptome Family F021980

Basic Information
Family ID	F021980
Family Type	Metagenome / Metatranscriptome
Number of Sequences	216
Average Sequence Length	40 residues
Representative Sequence	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK
Number of Associated Samples	140
Number of Associated Scaffolds	215

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	9.72 %
% of genes near scaffold ends (potentially truncated)	18.98 %
% of genes from short scaffolds (< 2000 bps)	67.13 %
Associated GOLD sequencing projects	126
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Unclassified (48.148 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.204 % of family members)
Environment Ontology (ENVO)	Unclassified (37.037 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (42.593 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 23.88% Coil/Unstructured: 76.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 215 Family Scaffolds
PF00149	Metallophos	4.19
PF07603	DUF1566	2.33
PF07728	AAA_5	1.86
PF13392	HNH_3	1.86
PF12850	Metallophos_2	1.86
PF01541	GIY-YIG	1.40
PF02617	ClpS	1.40
PF04851	ResIII	0.93
PF13203	DUF2201_N	0.93
PF00271	Helicase_C	0.93
PF00692	dUTPase	0.93
PF08406	CbbQ_C	0.93
PF01503	PRA-PH	0.93
PF02511	Thy1	0.47
PF01555	N6_N4_Mtase	0.47
PF00092	VWA	0.47
PF03167	UDG	0.47
PF13604	AAA_30	0.47
PF07453	NUMOD1	0.47
PF07661	MORN_2	0.47
PF00004	AAA	0.47
PF07463	NUMOD4	0.47
PF06940	DUF1287	0.47
PF09471	Peptidase_M64	0.47
PF13479	AAA_24	0.47
PF00136	DNA_pol_B	0.47
PF00085	Thioredoxin	0.47

COG ID	Name	Functional Category	% Frequency in 215 Family Scaffolds
COG2127	ATP-dependent Clp protease adapter protein ClpS	Posttranslational modification, protein turnover, chaperones [O]	1.40
COG0714	MoxR-like ATPase	General function prediction only [R]	0.93
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	0.93
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	0.93
COG0417	DNA polymerase B elongation subunit	Replication, recombination and repair [L]	0.47
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.47
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.47
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.47
COG1351	Thymidylate synthase ThyX, FAD-dependent family	Nucleotide transport and metabolism [F]	0.47
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.47
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.47
COG2849	Antitoxin component YwqK of the YwqJK toxin-antitoxin module	Defense mechanisms [V]	0.47
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	0.47
COG3738	Uncharacterized conserved protein YijF, DUF1287 family	Function unknown [S]	0.47

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	51.85 %
Unclassified	root	N/A	48.15 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Viruses	superkingdom	All Organisms → Viruses	28.24 %
cellular organisms	root	All Organisms → cellular organisms	23.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	23.15 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	16.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.46 %
unclassified viruses	clade	All Organisms → Viruses → unclassified viruses	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	16.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	5.56 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	2.78 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.39 %
TACK group	clade	All Organisms → cellular organisms → Archaea → TACK group	0.46 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.46 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.46 %
unclassified DNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses	0.93 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	16.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	5.56 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	2.78 %
Armatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes	0.46 %
Candidatus Bathyarchaeota	phylum	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota	0.46 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.46 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %
unclassified dsDNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses	0.93 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	16.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	5.56 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2.78 %
Moraxellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales	0.46 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.46 %
Candidatus Dojkabacteria	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria	0.46 %
unclassified Candidatus Bathyarchaeota	no rank	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota	0.46 %
Armatimonadia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia	0.46 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.93 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	9.72 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	3.70 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	3.70 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2.78 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.46 %
Capsulimonadales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales	0.46 %
Moraxellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae	0.46 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.46 %
Candidatus Dojkabacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium	0.46 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.46 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	0.46 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	0.93 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.93 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.93 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9.72 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	3.70 %
Podoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae	3.70 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2.78 %
Escherichia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia	0.46 %
Capsulimonadaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae	0.46 %
Marinilabiliales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales	0.46 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.46 %
Alkanindiges	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Alkanindiges	0.46 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.46 %
Candidatus Dojkabacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium	0.46 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.93 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	0.93 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.93 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9.72 %
unclassified Podoviridae	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae	3.70 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	3.70 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2.78 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.46 %
Capsulimonas	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas	0.46 %
Alkanindiges illinoisensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Alkanindiges → Alkanindiges illinoisensis	0.46 %
Sphingobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae	0.46 %
Prolixibacteraceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae	0.46 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.46 %
Candidatus Dojkabacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium	0.46 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.93 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	0.93 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.93 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9.72 %
crAss-like viruses	clade	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses	3.70 %
Flavobacterium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium	3.70 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2.78 %
Capsulimonas corticalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis	0.46 %
unclassified Prolixibacteraceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae	0.46 %
Mucilaginibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter	0.46 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.46 %
Alkanindiges illinoisensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Alkanindiges → Alkanindiges illinoisensis	0.46 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.46 %
Candidatus Dojkabacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium	0.46 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.93 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	0.93 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.93 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9.72 %
unclassified Crassvirales	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales	3.70 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2.78 %
Flavobacterium aciduliphilum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum	2.31 %
unclassified Flavobacterium	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium	1.39 %
Prolixibacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium	0.46 %
Mucilaginibacter endophyticus	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter endophyticus	0.46 %
Capsulimonas corticalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis	0.46 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.46 %
Alkanindiges illinoisensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Alkanindiges → Alkanindiges illinoisensis	0.46 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.46 %
Candidatus Dojkabacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium	0.46 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.93 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	0.93 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.93 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.65 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9.72 %
Podoviridae sp. ctrTa16	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	3.70 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2.78 %
Flavobacterium aciduliphilum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum	2.31 %
Flavobacterium sp. ACAM 123	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123	1.39 %
Prolixibacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium	0.46 %
Mucilaginibacter endophyticus	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter endophyticus	0.46 %
Capsulimonas corticalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis	0.46 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.46 %
Alkanindiges illinoisensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Alkanindiges → Alkanindiges illinoisensis	0.46 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.46 %
Candidatus Dojkabacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium	0.46 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.93 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	0.93 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.93 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352005\|2200041723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	1973	Open in IMG/M
3300000882\|FwDRAFT_10052801	All Organisms → cellular organisms → Bacteria	2018	Open in IMG/M
3300000882\|FwDRAFT_10141210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2580	Open in IMG/M
3300001213\|JGIcombinedJ13530_106480908	Not Available	601	Open in IMG/M
3300002447\|JGI24768J34885_10038451	Not Available	1591	Open in IMG/M
3300002447\|JGI24768J34885_10044138	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300002835\|B570J40625_100019913	Not Available	11390	Open in IMG/M
3300002835\|B570J40625_100138043	All Organisms → cellular organisms → Bacteria	2830	Open in IMG/M
3300002835\|B570J40625_100246081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1870	Open in IMG/M
3300002835\|B570J40625_101602882	Not Available	532	Open in IMG/M
3300003277\|JGI25908J49247_10005870	Not Available	3913	Open in IMG/M
3300003277\|JGI25908J49247_10007882	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3361	Open in IMG/M
3300003277\|JGI25908J49247_10104245	Not Available	681	Open in IMG/M
3300003394\|JGI25907J50239_1006365	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2831	Open in IMG/M
3300003430\|JGI25921J50272_10024525	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1571	Open in IMG/M
3300003860\|Ga0031658_1010528	All Organisms → Viruses → Predicted Viral	1571	Open in IMG/M
3300003860\|Ga0031658_1050780	Not Available	716	Open in IMG/M
3300004096\|Ga0066177_10451915	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	564	Open in IMG/M
3300005517\|Ga0070374_10284112	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	842	Open in IMG/M
3300005527\|Ga0068876_10463540	Not Available	700	Open in IMG/M
3300005580\|Ga0049083_10103277	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	987	Open in IMG/M
3300005582\|Ga0049080_10115724	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	908	Open in IMG/M
3300005656\|Ga0073902_10232550	Not Available	827	Open in IMG/M
3300005662\|Ga0078894_10002658	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	13507	Open in IMG/M
3300005662\|Ga0078894_10618157	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium	963	Open in IMG/M
3300005758\|Ga0078117_1042602	All Organisms → Viruses → Predicted Viral	1834	Open in IMG/M
3300005805\|Ga0079957_1051100	All Organisms → Viruses → Predicted Viral	2533	Open in IMG/M
3300005832\|Ga0074469_10015060	Not Available	791	Open in IMG/M
3300006037\|Ga0075465_10026984	All Organisms → Viruses → Predicted Viral	1158	Open in IMG/M
3300006056\|Ga0075163_10000352	All Organisms → cellular organisms → Bacteria	58596	Open in IMG/M
3300006484\|Ga0070744_10177312	Not Available	609	Open in IMG/M
3300006484\|Ga0070744_10196381	Not Available	575	Open in IMG/M
3300006484\|Ga0070744_10198603	Not Available	571	Open in IMG/M
3300006484\|Ga0070744_10206038	Not Available	559	Open in IMG/M
3300006805\|Ga0075464_10712756	Not Available	621	Open in IMG/M
3300006920\|Ga0070748_1129841	Not Available	946	Open in IMG/M
3300006920\|Ga0070748_1261022	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	621	Open in IMG/M
3300007622\|Ga0102863_1254875	Not Available	514	Open in IMG/M
3300008108\|Ga0114341_10001140	All Organisms → cellular organisms → Bacteria	52653	Open in IMG/M
3300008113\|Ga0114346_1009162	Not Available	7998	Open in IMG/M
3300008259\|Ga0114841_1021957	All Organisms → cellular organisms → Bacteria	7996	Open in IMG/M
3300008259\|Ga0114841_1042800	All Organisms → Viruses → Predicted Viral	2251	Open in IMG/M
3300008261\|Ga0114336_1000685	All Organisms → cellular organisms → Bacteria	60271	Open in IMG/M
3300008261\|Ga0114336_1012555	All Organisms → cellular organisms → Bacteria	5250	Open in IMG/M
3300008267\|Ga0114364_1047391	Not Available	1564	Open in IMG/M
3300008267\|Ga0114364_1060679	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Alkanindiges → Alkanindiges illinoisensis	1311	Open in IMG/M
3300008448\|Ga0114876_1137008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	914	Open in IMG/M
3300008450\|Ga0114880_1002990	Not Available	9436	Open in IMG/M
3300008459\|Ga0114865_1127440	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	826	Open in IMG/M
3300009079\|Ga0102814_10476615	Not Available	680	Open in IMG/M
3300009082\|Ga0105099_10292019	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	954	Open in IMG/M
3300009082\|Ga0105099_10655860	Not Available	648	Open in IMG/M
3300009085\|Ga0105103_10002433	Not Available	9689	Open in IMG/M
3300009085\|Ga0105103_10151888	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum	1223	Open in IMG/M
3300009085\|Ga0105103_10835662	Not Available	536	Open in IMG/M
3300009085\|Ga0105103_10899195	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123	519	Open in IMG/M
3300009160\|Ga0114981_10352139	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	796	Open in IMG/M
3300009161\|Ga0114966_10021511	All Organisms → cellular organisms → Bacteria	4881	Open in IMG/M
3300009165\|Ga0105102_10166524	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1083	Open in IMG/M
3300009165\|Ga0105102_10244704	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	911	Open in IMG/M
3300009165\|Ga0105102_10690571	Not Available	572	Open in IMG/M
3300009168\|Ga0105104_10082804	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1728	Open in IMG/M
3300009169\|Ga0105097_10002857	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	8570	Open in IMG/M
3300009169\|Ga0105097_10090473	Not Available	1669	Open in IMG/M
3300009169\|Ga0105097_10782632	Not Available	543	Open in IMG/M
3300009169\|Ga0105097_10932157	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	500	Open in IMG/M
3300009170\|Ga0105096_10766818	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300009181\|Ga0114969_10239860	Not Available	1094	Open in IMG/M
3300009419\|Ga0114982_1016967	All Organisms → Viruses → Predicted Viral	2462	Open in IMG/M
3300009506\|Ga0118657_11475107	All Organisms → cellular organisms → Bacteria → Proteobacteria	804	Open in IMG/M
3300009681\|Ga0116174_10567662	Not Available	511	Open in IMG/M
3300010354\|Ga0129333_10173193	All Organisms → Viruses → Predicted Viral	1973	Open in IMG/M
3300010354\|Ga0129333_10715791	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	859	Open in IMG/M
3300010354\|Ga0129333_11238187	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	619	Open in IMG/M
3300010368\|Ga0129324_10143850	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	998	Open in IMG/M
3300010885\|Ga0133913_10201746	Not Available	5301	Open in IMG/M
3300010885\|Ga0133913_12853563	Not Available	1161	Open in IMG/M
3300010942\|Ga0139176_112940	Not Available	856	Open in IMG/M
3300010946\|Ga0139175_107729	All Organisms → Viruses → Predicted Viral	1404	Open in IMG/M
3300010966\|Ga0137675_1000206	Not Available	5112	Open in IMG/M
3300012012\|Ga0153799_1000011	All Organisms → cellular organisms → Bacteria	124151	Open in IMG/M
3300012667\|Ga0157208_10000087	All Organisms → cellular organisms → Bacteria	31202	Open in IMG/M
3300015050\|Ga0181338_1007039	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1888	Open in IMG/M
3300015050\|Ga0181338_1030142	Not Available	826	Open in IMG/M
3300015050\|Ga0181338_1044894	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	652	Open in IMG/M
3300015050\|Ga0181338_1066255	Not Available	516	Open in IMG/M
3300017700\|Ga0181339_1025238	Not Available	659	Open in IMG/M
3300017700\|Ga0181339_1037704	Not Available	526	Open in IMG/M
3300017716\|Ga0181350_1001965	Not Available	5995	Open in IMG/M
3300017716\|Ga0181350_1055639	Not Available	1040	Open in IMG/M
3300017722\|Ga0181347_1040250	All Organisms → Viruses → Predicted Viral	1433	Open in IMG/M
3300017747\|Ga0181352_1071062	Not Available	983	Open in IMG/M
3300017754\|Ga0181344_1107936	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	806	Open in IMG/M
3300017754\|Ga0181344_1171639	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123	615	Open in IMG/M
3300017778\|Ga0181349_1025798	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum	2383	Open in IMG/M
3300017780\|Ga0181346_1004596	Not Available	6012	Open in IMG/M
3300017784\|Ga0181348_1054373	Not Available	1632	Open in IMG/M
3300017785\|Ga0181355_1066703	Not Available	1515	Open in IMG/M
3300018416\|Ga0181553_10360236	Not Available	797	Open in IMG/M
3300019781\|Ga0181360_104562	Not Available	1175	Open in IMG/M
3300020048\|Ga0207193_1000139	Not Available	122312	Open in IMG/M
3300020159\|Ga0211734_10930316	Not Available	540	Open in IMG/M
3300020167\|Ga0194035_1000660	All Organisms → cellular organisms → Bacteria	19326	Open in IMG/M
3300020205\|Ga0211731_11614456	Not Available	753	Open in IMG/M
3300020525\|Ga0207938_1036134	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	747	Open in IMG/M
3300020541\|Ga0208359_1009583	All Organisms → cellular organisms → Bacteria	1676	Open in IMG/M
3300020561\|Ga0207934_1059364	Not Available	642	Open in IMG/M
3300020562\|Ga0208597_1065059	Not Available	653	Open in IMG/M
3300021075\|Ga0194063_10082399	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1458	Open in IMG/M
3300021079\|Ga0194055_10278877	Not Available	624	Open in IMG/M
3300021141\|Ga0214163_1059355	Not Available	966	Open in IMG/M
3300021519\|Ga0194048_10145632	Not Available	892	Open in IMG/M
3300021600\|Ga0194059_1110261	Not Available	853	Open in IMG/M
3300021602\|Ga0194060_10139795	All Organisms → Viruses → Predicted Viral	1294	Open in IMG/M
3300022179\|Ga0181353_1075990	Not Available	853	Open in IMG/M
3300022407\|Ga0181351_1001878	Not Available	7070	Open in IMG/M
3300022407\|Ga0181351_1118051	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum	999	Open in IMG/M
3300022543\|Ga0212119_1047535	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	677	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10150628	All Organisms → cellular organisms → Bacteria	996	Open in IMG/M
3300024346\|Ga0244775_10003811	Not Available	15953	Open in IMG/M
3300024346\|Ga0244775_10399071	Not Available	1131	Open in IMG/M
3300024346\|Ga0244775_10440905	All Organisms → Viruses → Predicted Viral	1068	Open in IMG/M
3300024346\|Ga0244775_10939985	Not Available	685	Open in IMG/M
3300024346\|Ga0244775_11129481	Not Available	613	Open in IMG/M
3300024549\|Ga0256308_1000004	Not Available	27337	Open in IMG/M
3300027418\|Ga0208022_1082847	Not Available	676	Open in IMG/M
3300027631\|Ga0208133_1105304	Not Available	658	Open in IMG/M
3300027693\|Ga0209704_1031417	Not Available	1405	Open in IMG/M
3300027705\|Ga0209063_1247503	Not Available	592	Open in IMG/M
3300027707\|Ga0209443_1008454	Not Available	5136	Open in IMG/M
3300027710\|Ga0209599_10013181	All Organisms → Viruses → Predicted Viral	2462	Open in IMG/M
3300027721\|Ga0209492_1000743	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	10029	Open in IMG/M
3300027721\|Ga0209492_1079143	Not Available	1161	Open in IMG/M
3300027732\|Ga0209442_1075697	Not Available	1398	Open in IMG/M
3300027743\|Ga0209593_10089239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1143	Open in IMG/M
3300027754\|Ga0209596_1038013	All Organisms → Viruses → Predicted Viral	2634	Open in IMG/M
3300027764\|Ga0209134_10005363	All Organisms → Viruses → Predicted Viral	3757	Open in IMG/M
3300027769\|Ga0209770_10011736	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3959	Open in IMG/M
3300027769\|Ga0209770_10203014	Not Available	782	Open in IMG/M
3300027770\|Ga0209086_10008102	All Organisms → cellular organisms → Bacteria	7281	Open in IMG/M
3300027836\|Ga0209230_10002833	All Organisms → cellular organisms → Bacteria	7189	Open in IMG/M
3300027899\|Ga0209668_10000056	All Organisms → cellular organisms → Bacteria	43794	Open in IMG/M
3300027899\|Ga0209668_10011897	All Organisms → Viruses → Predicted Viral	4116	Open in IMG/M
3300027899\|Ga0209668_10083191	All Organisms → Viruses → Predicted Viral	1821	Open in IMG/M
3300027899\|Ga0209668_10707041	Not Available	676	Open in IMG/M
3300027900\|Ga0209253_10980732	Not Available	586	Open in IMG/M
3300027972\|Ga0209079_10021230	All Organisms → Viruses → Predicted Viral	2155	Open in IMG/M
3300027974\|Ga0209299_1320660	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	535	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10016090	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2781	Open in IMG/M
3300031539\|Ga0307380_10169050	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium	2148	Open in IMG/M
3300031539\|Ga0307380_10293866	Not Available	1512	Open in IMG/M
3300031539\|Ga0307380_10297323	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	1500	Open in IMG/M
3300031539\|Ga0307380_10298030	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis	1498	Open in IMG/M
3300031539\|Ga0307380_10394802	All Organisms → cellular organisms → Bacteria	1249	Open in IMG/M
3300031539\|Ga0307380_10702889	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	851	Open in IMG/M
3300031539\|Ga0307380_10788392	All Organisms → cellular organisms → Bacteria	787	Open in IMG/M
3300031565\|Ga0307379_10023791	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7536	Open in IMG/M
3300031565\|Ga0307379_10205292	Not Available	2013	Open in IMG/M
3300031565\|Ga0307379_11446291	Not Available	551	Open in IMG/M
3300031566\|Ga0307378_10023646	All Organisms → cellular organisms → Bacteria	7373	Open in IMG/M
3300031578\|Ga0307376_10182995	Not Available	1437	Open in IMG/M
3300031578\|Ga0307376_10262073	Not Available	1163	Open in IMG/M
3300031673\|Ga0307377_10025775	Not Available	5305	Open in IMG/M
3300031707\|Ga0315291_10083241	All Organisms → Viruses → Predicted Viral	3494	Open in IMG/M
3300031707\|Ga0315291_10413460	Not Available	1279	Open in IMG/M
3300031746\|Ga0315293_10178210	All Organisms → Viruses → Predicted Viral	1760	Open in IMG/M
3300031746\|Ga0315293_10332878	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1210	Open in IMG/M
3300031746\|Ga0315293_10365190	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1143	Open in IMG/M
3300031746\|Ga0315293_10455377	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	996	Open in IMG/M
3300031772\|Ga0315288_10702656	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300031784\|Ga0315899_10026385	Not Available	6143	Open in IMG/M
3300031784\|Ga0315899_10323631	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum	1519	Open in IMG/M
3300031784\|Ga0315899_10943833	Not Available	773	Open in IMG/M
3300031786\|Ga0315908_10361545	Not Available	1215	Open in IMG/M
3300031857\|Ga0315909_10023804	Not Available	6084	Open in IMG/M
3300031857\|Ga0315909_10132396	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum	2086	Open in IMG/M
3300031857\|Ga0315909_10356220	All Organisms → Viruses → Predicted Viral	1067	Open in IMG/M
3300031952\|Ga0315294_10009717	All Organisms → cellular organisms → Bacteria	10556	Open in IMG/M
3300031952\|Ga0315294_10160994	All Organisms → Viruses → Predicted Viral	2267	Open in IMG/M
3300031952\|Ga0315294_10857123	Not Available	775	Open in IMG/M
3300031952\|Ga0315294_10984965	Not Available	705	Open in IMG/M
3300031952\|Ga0315294_11448898	Not Available	540	Open in IMG/M
3300031963\|Ga0315901_10455145	All Organisms → Viruses → Predicted Viral	1010	Open in IMG/M
3300031963\|Ga0315901_10555400	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter endophyticus	882	Open in IMG/M
3300031963\|Ga0315901_10669299	Not Available	775	Open in IMG/M
3300031999\|Ga0315274_10020423	All Organisms → cellular organisms → Bacteria	9295	Open in IMG/M
3300031999\|Ga0315274_10505753	All Organisms → cellular organisms → Bacteria	1365	Open in IMG/M
3300031999\|Ga0315274_10838320	Not Available	968	Open in IMG/M
3300031999\|Ga0315274_10911654	Not Available	913	Open in IMG/M
3300032050\|Ga0315906_10061696	All Organisms → cellular organisms → Bacteria	3857	Open in IMG/M
3300032050\|Ga0315906_11284784	Not Available	523	Open in IMG/M
3300032053\|Ga0315284_10029688	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	7668	Open in IMG/M
3300032053\|Ga0315284_10108006	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	3711	Open in IMG/M
3300032053\|Ga0315284_10108006	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	3711	Open in IMG/M
3300032116\|Ga0315903_10273953	Not Available	1443	Open in IMG/M
3300032116\|Ga0315903_10887287	Not Available	639	Open in IMG/M
3300032118\|Ga0315277_10154613	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	2537	Open in IMG/M
3300032516\|Ga0315273_12325500	Not Available	624	Open in IMG/M
3300033978\|Ga0334977_0072170	Not Available	1880	Open in IMG/M
3300033984\|Ga0334989_0109066	Not Available	1537	Open in IMG/M
3300033984\|Ga0334989_0207280	Not Available	1075	Open in IMG/M
3300033984\|Ga0334989_0285653	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	882	Open in IMG/M
3300033993\|Ga0334994_0000890	Not Available	21960	Open in IMG/M
3300033996\|Ga0334979_0248854	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. ACAM 123	1028	Open in IMG/M
3300034018\|Ga0334985_0007193	Not Available	8961	Open in IMG/M
3300034022\|Ga0335005_0000015	Not Available	117174	Open in IMG/M
3300034060\|Ga0334983_0054891	All Organisms → Viruses → Predicted Viral	2596	Open in IMG/M
3300034063\|Ga0335000_0411475	Not Available	802	Open in IMG/M
3300034068\|Ga0334990_0009194	Not Available	5286	Open in IMG/M
3300034082\|Ga0335020_0003362	Not Available	10642	Open in IMG/M
3300034096\|Ga0335025_0246727	Not Available	981	Open in IMG/M
3300034104\|Ga0335031_0000349	Not Available	36817	Open in IMG/M
3300034105\|Ga0335035_0449968	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → crAss-like viruses → unclassified Crassvirales → Podoviridae sp. ctrTa16	717	Open in IMG/M
3300034108\|Ga0335050_0051625	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	2562	Open in IMG/M
3300034109\|Ga0335051_0008527	Not Available	5686	Open in IMG/M
3300034111\|Ga0335063_0315019	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	824	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	97.22%
Engineered	Engineered	2.78%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	89.81%
Terrestrial	Environmental → Terrestrial	7.41%
Wastewater	Engineered → Wastewater	2.78%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	77.31%
Marine	Environmental → Aquatic → Marine	12.04%
Soil	Environmental → Terrestrial → Soil	6.48%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.93%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.93%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.93%
Sediment	Environmental → Aquatic → Sediment	0.46%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.46%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.46%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	32.41%
Lentic	Environmental → Aquatic → Freshwater → Lentic	26.39%
Sediment	Environmental → Aquatic → Freshwater → Sediment	9.26%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	6.94%
Clay	Environmental → Terrestrial → Soil → Clay	6.48%
Unclassified	Environmental → Aquatic → Marine → Unclassified	4.63%
Coastal	Environmental → Aquatic → Marine → Coastal	3.70%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.85%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.39%
Inlet	Environmental → Aquatic → Marine → Inlet	0.93%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.93%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.93%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.93%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified	0.93%
River	Environmental → Aquatic → Freshwater → River	0.46%
Pond	Environmental → Aquatic → Freshwater → Pond	0.46%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.46%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.46%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	22.22%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	18.52%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	10.19%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	9.26%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	6.94%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	6.48%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	4.63%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	4.63%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	3.70%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	3.24%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.39%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.39%
Unclassified	Environmental → Aquatic → Marine → Inlet → Unclassified	0.93%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.93%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.93%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.93%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.46%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.46%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.46%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.46%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.46%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	16.20%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	9.72%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	9.26%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	8.33%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	6.48%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	6.48%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	4.63%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	4.63%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.70%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	3.70%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	3.24%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	2.78%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.85%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	1.85%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.39%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.39%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.39%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.39%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.93%
Freshwater And Marine	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine	0.93%
Seawater	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater	0.93%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.93%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.93%
Wastewater	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater	0.93%
Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water	0.46%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.46%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.46%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.46%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.46%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.46%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	0.46%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.46%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.46%
Mangrove Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment	0.46%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.46%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.46%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	0.46%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352005	Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion	Environmental	Open in IMG/M
3300000882	Freshwater microbial communities from the Columbia River	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300002447	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003394	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN	Environmental	Open in IMG/M
3300003430	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD	Environmental	Open in IMG/M
3300003860	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL	Environmental	Open in IMG/M
3300004096	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005656	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit	Engineered	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005758	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005832	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB	Environmental	Open in IMG/M
3300006037	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA	Environmental	Open in IMG/M
3300006056	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA	Engineered	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006920	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12	Environmental	Open in IMG/M
3300007622	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300008459	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs	Environmental	Open in IMG/M
3300009079	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300009506	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8	Environmental	Open in IMG/M
3300009681	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG	Engineered	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300010942	Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C3	Engineered	Open in IMG/M
3300010946	Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C1	Engineered	Open in IMG/M
3300010966	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017700	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300018416	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019781	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020167	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020525	Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020541	Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020561	Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020562	Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021075	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m	Environmental	Open in IMG/M
3300021079	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m	Environmental	Open in IMG/M
3300021141	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021600	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m	Environmental	Open in IMG/M
3300021602	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022543	Indian_combined assembly	Environmental	Open in IMG/M
3300023210 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024549	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027418	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)	Environmental	Open in IMG/M
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental	Open in IMG/M
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027705	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes)	Engineered	Open in IMG/M
3300027707	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027743	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027836	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027972	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027974	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027996 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031566	Soil microbial communities from Risofladan, Vaasa, Finland - UN-1	Environmental	Open in IMG/M
3300031578	Soil microbial communities from Risofladan, Vaasa, Finland - TR-2	Environmental	Open in IMG/M
3300031673	Soil microbial communities from Risofladan, Vaasa, Finland - TR-3	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033984	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034060	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034068	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034096	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental	Open in IMG/M
3300034108	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157	Environmental	Open in IMG/M
3300034109	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158	Environmental	Open in IMG/M
3300034111	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F021980

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2200257569	2199352005	Freshwater	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNK
FwDRAFT_100528016	3300000882	Freshwater And Marine	MNNFICSECGTKYSSPETTPPPGIKWSDGHVCTPEPVKNKL*
FwDRAFT_101412104	3300000882	Freshwater And Marine	MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKPVNK*
JGIcombinedJ13530_1064809081	3300001213	Wetland	KFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVE*
JGI24768J34885_100384512	3300002447	Freshwater And Sediment	MNKFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSK*
JGI24768J34885_100441382	3300002447	Freshwater And Sediment	MNKFICSECGTIYGSPETTPPPGIKWSDGHICTPKPVNNG*
B570J40625_10001991323	3300002835	Freshwater	MNKFECSECGTIYRSPETTPPPGIKWSDGHTCNPKPVNNEK*
B570J40625_1001380434	3300002835	Freshwater	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNK*
B570J40625_1002460816	3300002835	Freshwater	MNKFICNECGTKYSSPELTPPPGIKWSDGHVCKPKPINHEK*
B570J40625_1016028821	3300002835	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVDNEK*
JGI25908J49247_100058705	3300003277	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVNK*
JGI25908J49247_100078826	3300003277	Freshwater Lake	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK*
JGI25908J49247_101042453	3300003277	Freshwater Lake	MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPLKQTT*
JGI25907J50239_10063651	3300003394	Freshwater Lake	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENG
JGI25921J50272_100245253	3300003430	Freshwater Lake	MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVDNGK*
Ga0031658_10105286	3300003860	Freshwater Lake Sediment	MNRFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK*
Ga0031658_10507803	3300003860	Freshwater Lake Sediment	MNKFICSECGTKXXSPXLTPPPGIKWSDGHVCTPKPVNNGK*
Ga0066177_104519151	3300004096	Freshwater Lake	MNKFECSECGTRYSSPEKTPPPGIKWSDGHVCTPKPINKQ*
Ga0070374_102841121	3300005517	Freshwater Lake	MNKFECSECGTRYSSPEKTPPPGIKWSDGHVCTPK
Ga0068876_104635403	3300005527	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKK*
Ga0049083_101032772	3300005580	Freshwater Lentic	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVTS*
Ga0049080_101157243	3300005582	Freshwater Lentic	MNNFVCSECGTKYSSPETTPPPGIKWSDGHVCTPQPVKK*
Ga0073902_102325501	3300005656	Activated Sludge	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVEKV*
Ga0078894_100026584	3300005662	Freshwater Lake	MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK*
Ga0078894_106181574	3300005662	Freshwater Lake	MNKFECSECGTSYSSPETTPPPGIKWSDGHVCTPKPVNK*
Ga0078117_10426023	3300005758	Lake Water	MYKFICKECGTRFTSAHKEPPPGIKWDDGHVCTPVPVKQ*
Ga0079957_10511001	3300005805	Lake	MNEFICNVCGTKYRSPKTTPPPGIKWSDGHICTPKPIKTK*
Ga0074469_100150602	3300005832	Sediment (Intertidal)	MNNTMMKPLNQNKAMNKFICSECGTKYSSPETTPPPGIKWSDGHICTPKAVN*
Ga0075465_100269843	3300006037	Aqueous	MNKFVCSECGTKYSSPETTPPPGIKWSDGHVCTPQPVSK*
Ga0075163_1000035213	3300006056	Wastewater Effluent	MNKFVCSECGTKYQSPELTPPPGIKWSDGHVCTPKPVEKCQEMQ*
Ga0070744_101773121	3300006484	Estuarine	MNKFECSECGTKYNSPETTPPPGIKWSDGHTCNPKPVNNEK*
Ga0070744_101963812	3300006484	Estuarine	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKLVKQ*
Ga0070744_101986031	3300006484	Estuarine	MNNFICDECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEQAN*
Ga0070744_102060382	3300006484	Estuarine	MNNFECSECGTKYSSQETTPPPGIKWSDGHICNPKPVDNG*
Ga0075464_107127562	3300006805	Aqueous	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK*
Ga0070748_11298413	3300006920	Aqueous	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNKQHGNIHP*
Ga0070748_12610221	3300006920	Aqueous	NKFICSECGTKYSSPEKTPPPGIKWSDGHVCTPKSVNK*
Ga0102863_12548752	3300007622	Estuarine	MNKFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVKQ*
Ga0114341_1000114025	3300008108	Freshwater, Plankton	MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK*
Ga0114346_100916215	3300008113	Freshwater, Plankton	MNKFKCSECGTIYSSPETTPPPGIKWSDGHVCTPKPLKQ*
Ga0114841_102195716	3300008259	Freshwater, Plankton	MNNFICSGCGTKYTSPETTPPPGIKWSDGHVCTPVPVKP*
Ga0114841_10428004	3300008259	Freshwater, Plankton	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK*
Ga0114336_100068530	3300008261	Freshwater, Plankton	MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVNNGK*
Ga0114336_101255511	3300008261	Freshwater, Plankton	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK*
Ga0114364_10473912	3300008267	Freshwater, Plankton	MNKFVCSECGTKYSSPETTPPPGIKWSDGHVCTPVPVKP*
Ga0114364_10606791	3300008267	Freshwater, Plankton	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKP
Ga0114876_11370084	3300008448	Freshwater Lake	SECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK*
Ga0114880_100299012	3300008450	Freshwater Lake	MNKFVCNECGTKYSSPETTPPPGIKWSDGHTCNPKPVKK*
Ga0114865_11274404	3300008459	Freshwater Lake	NFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK*
Ga0102814_104766151	3300009079	Estuarine	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVK*
Ga0105099_102920193	3300009082	Freshwater Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVDNGR*
Ga0105099_106558602	3300009082	Freshwater Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHICTPKPVK*
Ga0105103_100024333	3300009085	Freshwater Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKLVKE*
Ga0105103_101518884	3300009085	Freshwater Sediment	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCNPKPLKTK*
Ga0105103_108356621	3300009085	Freshwater Sediment	ICSECGTKYSSPETTPPPGIKWSDGHVCTPKSVKE*
Ga0105103_108991952	3300009085	Freshwater Sediment	MNKFICSECGTKYSSPETTPPPGIKWSDGHTCKPKLVKE*
Ga0114981_103521393	3300009160	Freshwater Lake	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTLKPVDNGK*
Ga0114966_1002151114	3300009161	Freshwater Lake	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK*
Ga0105102_101665243	3300009165	Freshwater Sediment	MNKFICNECGTKYSSPETTPPPGIKWSDGHTCNPKLVNNGK*
Ga0105102_102447042	3300009165	Freshwater Sediment	MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPEPVKTK*
Ga0105102_106905712	3300009165	Freshwater Sediment	MNKFICNECGTKYSSPETTPPPGIKWSDGHVCTPKPVNNGR*
Ga0105104_100828044	3300009168	Freshwater Sediment	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKLVDNGK*
Ga0105097_100028579	3300009169	Freshwater Sediment	MNKFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVKR*
Ga0105097_100904734	3300009169	Freshwater Sediment	MNKFICSECGTKYSSPETTPPPGIKWNDGHVCTPKLVKE*
Ga0105097_107826322	3300009169	Freshwater Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKKSL*
Ga0105097_109321571	3300009169	Freshwater Sediment	TMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK*
Ga0105096_107668181	3300009170	Freshwater Sediment	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK*
Ga0114969_102398604	3300009181	Freshwater Lake	MNKFICSKCGTKYSSPELTPPPGIKWSDGHVCTPKLVENGK*
Ga0114982_10169672	3300009419	Deep Subsurface	MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKTLN*
Ga0118657_114751072	3300009506	Mangrove Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKS*
Ga0116174_105676621	3300009681	Anaerobic Digestor Sludge	MNKFKCSECGTKYQSPESTPPPGIKWSDGHVCTPKPVKNEQKS*
Ga0129333_101731938	3300010354	Freshwater To Marine Saline Gradient	FICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVSSEQSK*
Ga0129333_107157911	3300010354	Freshwater To Marine Saline Gradient	MNEFICSECGTKYRSPETTPPPGIKWSDGHVCTPKPVNNEK*
Ga0129333_112381872	3300010354	Freshwater To Marine Saline Gradient	MNEFICSECGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK*
Ga0129324_101438501	3300010368	Freshwater To Marine Saline Gradient	KKKKMNKFECSECGTKYSSPETTPPPGIKWSDGHICTPKSVNK*
Ga0133913_102017462	3300010885	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKLVKE*
Ga0133913_128535633	3300010885	Freshwater Lake	MNKFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSKQS*
Ga0139176_1129401	3300010942	Wastewater	CGTKYSSPETTPPPGIKWSDGHVCTPKPVKNEQERRN*
Ga0139175_1077296	3300010946	Wastewater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNEQERRN*
Ga0137675_10002063	3300010966	Pond Fresh Water	MNKFVCSECGTKYSSPETTPPPGIKWSDGHVCTPKPLNK*
Ga0153799_100001196	3300012012	Freshwater	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK*
Ga0157208_1000008766	3300012667	Freshwater	MNNFICSECGTKYSSPELTSPPGIKWSDGHVCTLKPVENENNKNQIY*
Ga0181338_10070395	3300015050	Freshwater Lake	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK*
Ga0181338_10301424	3300015050	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIRWIDGHVCTPKPIKE*
Ga0181338_10448941	3300015050	Freshwater Lake	TEMNKFICSECGTIYGSPETTPPPGIKWSDGHTCTPKPVNNG*
Ga0181338_10662551	3300015050	Freshwater Lake	SECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK*
Ga0181339_10252382	3300017700	Freshwater Lake	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK
Ga0181339_10377042	3300017700	Freshwater Lake	MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKSVNK
Ga0181350_100196514	3300017716	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIRWSDGHVCTPKPVTS
Ga0181350_10556393	3300017716	Freshwater Lake	MNKFICSECGTIYGSPETTPPPGIKWSDGHTCNPKPVNNGK
Ga0181347_10402504	3300017722	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDEHVCTPKPVNK
Ga0181352_10710623	3300017747	Freshwater Lake	MNKFICSECGTKYSSPEVTPPPGIKWSDGHVCTPKPIDNGK
Ga0181344_11079361	3300017754	Freshwater Lake	IFYMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK
Ga0181344_11716393	3300017754	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHICTPKPVK
Ga0181349_10257986	3300017778	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPIKE
Ga0181346_100459616	3300017780	Freshwater Lake	MNRFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSK
Ga0181348_10543731	3300017784	Freshwater Lake	MTKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK
Ga0181355_10667032	3300017785	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHTCTPKLVNNGK
Ga0181553_103602364	3300018416	Salt Marsh	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKNEQERRN
Ga0181360_1045622	3300019781	Freshwater Lake	MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPLKQTT
Ga0207193_100013983	3300020048	Freshwater Lake Sediment	MNNFVCSECGTKYSSPETTPPPGIKWSDGHVCTPQPVSK
Ga0211734_109303163	3300020159	Freshwater	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVENGK
Ga0194035_100066027	3300020167	Anoxic Zone Freshwater	MNKFICSECGTKYQSPESTPPPGIKWDDGHVCTPKLVENGNN
Ga0211731_116144562	3300020205	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVSK
Ga0207938_10361342	3300020525	Freshwater	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK
Ga0208359_10095834	3300020541	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNNGK
Ga0207934_10593643	3300020561	Freshwater	NKDMNKFECSECGTRYSSSETTPPPGIKWSDGHVCTPKPVNNDK
Ga0208597_10650592	3300020562	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKKKSL
Ga0194063_100823993	3300021075	Anoxic Zone Freshwater	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK
Ga0194055_102788773	3300021079	Anoxic Zone Freshwater	KTMNNFICNECGTKYSSPELTPPPGIKWSDGHVCTPKLVDK
Ga0214163_10593553	3300021141	Freshwater	MNKFECSECGTIYRSPETTPPPGIKWSDGHVCTPKPVNK
Ga0194048_101456323	3300021519	Anoxic Zone Freshwater	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTLKPVENGK
Ga0194059_11102611	3300021600	Anoxic Zone Freshwater	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGNN
Ga0194060_101397953	3300021602	Anoxic Zone Freshwater	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGK
Ga0181353_10759903	3300022179	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKPVNNEK
Ga0181351_100187810	3300022407	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVTS
Ga0181351_11180513	3300022407	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK
Ga0212119_10475353	3300022543	Freshwater	MNKFECSECGTKYSSAETTPPPGIKWSDGHVCTPKPVNK
(restricted) Ga0233412_101506282	3300023210	Seawater	MNPLKKIQMNNFICEECGTKYSTSSETPPPSPKWDDGHVCKPIPIKDE
Ga0244775_100038114	3300024346	Estuarine	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVK
Ga0244775_103990713	3300024346	Estuarine	MNKFECSECGTKYSSSETTPPPGIKWSDGHVCTPKPVTS
Ga0244775_104409052	3300024346	Estuarine	MTKTMNKFICSECGSKYSSPETTPPPGIKWSDGHTCNPKPVNNGK
Ga0244775_109399851	3300024346	Estuarine	EMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNNGK
Ga0244775_111294813	3300024346	Estuarine	FICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEQAN
Ga0256308_100000453	3300024549	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKS
Ga0208022_10828471	3300027418	Estuarine	ETEMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVK
Ga0208133_11053041	3300027631	Estuarine	MNKFECSECGTKYNSPETTPPPGIKWSDGHTCNPKPVNNGK
Ga0209704_10314173	3300027693	Freshwater Sediment	MNKFICNECGTKYSSPETTPPPGIKWSDGHTCNPKLVNNGK
Ga0209063_12475032	3300027705	Activated Sludge	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVEKV
Ga0209443_100845412	3300027707	Freshwater Lake	MNKFICSECGTRYSSPETTPPPGIKWGDGHVCTPKPVSK
Ga0209599_100131812	3300027710	Deep Subsurface	MNKFECSECGTKYSSPETTPPPGIKWSDGHTCNPKTLN
Ga0209492_100074313	3300027721	Freshwater Sediment	MNKFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVKR
Ga0209492_10791433	3300027721	Freshwater Sediment	MNKFICSECGTKYSSPETTPPPGIKWNDGHVCTPKLVKE
Ga0209442_10756973	3300027732	Freshwater Lake	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKSVNK
Ga0209593_100892394	3300027743	Freshwater Sediment	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKLVDNGK
Ga0209596_10380137	3300027754	Freshwater Lake	MNKFICSKCGTKYSSPELTPPPGIKWSDGHVCTPKLVENGK
Ga0209134_100053636	3300027764	Freshwater Lake	MNNFVCNECGTKYSSPETTPPPGIKWNDGHVCTPQPISK
Ga0209770_100117364	3300027769	Freshwater Lake	MNEFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK
Ga0209770_102030143	3300027769	Freshwater Lake	MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVDNGK
Ga0209086_100081021	3300027770	Freshwater Lake	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK
Ga0209230_1000283316	3300027836	Freshwater And Sediment	MNKFICSECGTIYGSPETTPPPGIKWSDGHICTPKPVNNG
Ga0209668_1000005642	3300027899	Freshwater Lake Sediment	MNKFICSECGTKYSSPESTPPPGIKWSDGHICTPKPVDNGK
Ga0209668_100118975	3300027899	Freshwater Lake Sediment	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVNNGK
Ga0209668_100831912	3300027899	Freshwater Lake Sediment	MNRFECNECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK
Ga0209668_107070411	3300027899	Freshwater Lake Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKE
Ga0209253_109807323	3300027900	Freshwater Lake Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKNE
Ga0209079_100212307	3300027972	Freshwater Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKLVKE
Ga0209299_13206604	3300027974	Freshwater Lake	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNAKXI
(restricted) Ga0233413_100160902	3300027996	Seawater	MNNFICEECGTKYSTSSETPPPSPKWDDGHVCKPIPIKDE
Ga0307380_101690505	3300031539	Soil	NEFICKECGTKYQSPEETPPPGIKWNDGHVCIPIPVTIKKV
Ga0307380_102938662	3300031539	Soil	MNEFICKGCGTKYQSPEITPPPGIKWSDGHVCIPISITIKNN
Ga0307380_102973233	3300031539	Soil	MNEFICNECGTKYQSPQETPPPGIKWNDGHVCIPIPVTSTK
Ga0307380_102980303	3300031539	Soil	MNKFICSECGTKYSSPEETPPPGIKWSDGHVCTPEPVKDEK
Ga0307380_103948025	3300031539	Soil	MNEFICKECGTKYQSPEETPPPGIKWNDGHVCIPILVTIKKV
Ga0307380_107028892	3300031539	Soil	MTKLKLNGQMNEFVCSECGTKYRSPETTPPPGIKWSDGHVCTPKPVNK
Ga0307380_107883922	3300031539	Soil	MNNFICSECGTKYSSPSKEPPPGIKWDDGHVCTPIPVKDEPFDINN
Ga0307379_1002379116	3300031565	Soil	MNKFICSECGTNYSSPEETPPPGIKWSDGHVCTPEPVKDEK
Ga0307379_102052923	3300031565	Soil	MNEFICNGCGTKYQSPEITPPPGIKWSDGHVCIPISVTIKKV
Ga0307379_114462911	3300031565	Soil	MNKFICSECGTNYSSPEETPPPGIKWNDDHVCTPK
Ga0307378_100236463	3300031566	Soil	MNNFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNKSKL
Ga0307376_101829953	3300031578	Soil	MNEFICSECGTKYSSPEITPPPGIKWSDGHVCTPKPLKETT
Ga0307376_102620732	3300031578	Soil	MNKFICEDCGTKYESPETKPPPGIKWSDGHLCTPIPVDKAMGISEKL
Ga0307377_100257758	3300031673	Soil	MNEFICSECGTKYSSPEITPPPGIKWSDGHVCTPKPLKQTT
Ga0315291_100832418	3300031707	Sediment	MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKPINK
Ga0315291_104134603	3300031707	Sediment	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK
Ga0315293_101782102	3300031746	Sediment	MNKFICSECGTRYSSPETTPPPGIKWSDGHVCTPKPINK
Ga0315293_103328784	3300031746	Sediment	FICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVDNE
Ga0315293_103651902	3300031746	Sediment	MNKFICSECGTIYGSPETTPPPGIKWSDGHVCTPKPVTS
Ga0315293_104553772	3300031746	Sediment	MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPINNGK
Ga0315288_107026561	3300031772	Sediment	MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPK
Ga0315899_100263854	3300031784	Freshwater	MNKFECSECGTRYSSPETTPPPGIKWSDGHVCTPKPVNK
Ga0315899_103236312	3300031784	Freshwater	MNKFKCSECGTIYSSPETTPPPGIKWSDGHVCTPKPLKQ
Ga0315899_109438332	3300031784	Freshwater	MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK
Ga0315908_103615452	3300031786	Freshwater	MNKFVCNECGTKYSSPETTPPPGIKWSDGHTCNPKPVKK
Ga0315909_100238049	3300031857	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKK
Ga0315909_101323964	3300031857	Freshwater	MNKFKCSECGTIYRSPETTPPPGIKWSDGHVCTPKLVDNEPISKN
Ga0315909_103562203	3300031857	Freshwater	MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNAK
Ga0315294_1000971717	3300031952	Sediment	MNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVNK
Ga0315294_101609943	3300031952	Sediment	MNKFECSECGTIYRSPETTPPPPIKWSDGHVCTPKLVDNEK
Ga0315294_108571233	3300031952	Sediment	KTMNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGKR
Ga0315294_109849651	3300031952	Sediment	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVEN
Ga0315294_114488981	3300031952	Sediment	SECGTKYSSPELTPPPGIKWSDGHVCTPKPIDNGK
Ga0315901_104551454	3300031963	Freshwater	YTMNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK
Ga0315901_105554002	3300031963	Freshwater	MNNFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKDEKEKED
Ga0315901_106692991	3300031963	Freshwater	MNEFICSVCGTKYRSPELTPPPGIKWSDGHVCTPKPVNN
Ga0315274_100204232	3300031999	Sediment	MNNFICSDCGTKYSSPELTPPPGIKWSDGHVCTPKPVDNGKR
Ga0315274_105057534	3300031999	Sediment	MNNFICSECGTKYSSPELTPPPGIKWSDGHVCTLKPIKQ
Ga0315274_108383201	3300031999	Sediment	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPK
Ga0315274_109116542	3300031999	Sediment	NKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVNK
Ga0315906_100616964	3300032050	Freshwater	MNNFICSGCGTKYTSPETTPPPGIKWSDGHVCTPVPVKP
Ga0315906_112847841	3300032050	Freshwater	MNNFICSECGTKYTSPQSTPPPGIKWSDGHVCTPVPVK
Ga0315284_100296883	3300032053	Sediment	MNEFVCSECGTKYRSPETTPPPGINWSDGHVCTPKPVNK
Ga0315284_101080067	3300032053	Sediment	MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVDNGK
Ga0315284_101080069	3300032053	Sediment	MNNFICSECGTKYSSPESTPPPGIKWSDGHVCTPKPVDNE
Ga0315903_102739535	3300032116	Freshwater	KHLNQNKTMNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKK
Ga0315903_108872872	3300032116	Freshwater	MNKFECSECGTIYRSPETTPPPGIKWSDGHVCTPKLVKE
Ga0315277_101546131	3300032118	Sediment	MNEFVCSECGTKYRSPETTPPPGIKWSDGHVCTPKPVNK
Ga0315273_123255002	3300032516	Sediment	MNNFICNECGTKYSSPQTTPPPGIKWDDGHVCKPEPVKKSPFKSE
Ga0334977_0072170_1772_1879	3300033978	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKP
Ga0334989_0109066_429_554	3300033984	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPVDNEK
Ga0334989_0207280_142_261	3300033984	Freshwater	MNKFICSECGTKYSSPETTPPPGIKWSDGHVCTPKPVKE
Ga0334989_0285653_1_108	3300033984	Freshwater	ICSECGTKYSSPETTPPPGIKWSDGHVCTPKSVNK
Ga0334994_0000890_3491_3616	3300033993	Freshwater	MNKFECSECGTIYRSPETTPPPGIKWSDGHTCNPKPVNNEK
Ga0334979_0248854_1_111	3300033996	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPV
Ga0334985_0007193_7032_7151	3300034018	Freshwater	MNKFECSECGTKYSSPKTTPPPGIKWSDGHVCTPKPINK
Ga0335005_0000015_22861_22980	3300034022	Freshwater	MNKFICSECGTTYSSPETTPPPGIKWSDGHVCTPKLVKE
Ga0334983_0054891_1774_1911	3300034060	Freshwater	MNKFECSECGTIYRSPETTPPPGIKWSDGHTCTLKPVDNELISKD
Ga0335000_0411475_571_690	3300034063	Freshwater	MNKFECSECGTIYRSPETTPPPPIKWSDGHVCTPKPVKE
Ga0334990_0009194_1171_1290	3300034068	Freshwater	MNKFECSECGTRYSSSETTPPPGIKWSDGHVCTPKSVNK
Ga0335020_0003362_7660_7785	3300034082	Freshwater	MNKFECSECGTKYSSPETTPPPGIKWSDGHVCTPKPLKKSL
Ga0335025_0246727_569_694	3300034096	Freshwater	MNKFECSECGTKYSSPEITPPPGIKWSDGHVCTPKPVNNGK
Ga0335031_0000349_34623_34742	3300034104	Freshwater	MNKFECSECGTKYSSPELTPPPGIKWSDGHVCTPKPVKS
Ga0335035_0449968_562_717	3300034105	Freshwater	TIIHQLKNKTMNKFICSECGTKYSSPELTPPPGIKWSDGHVCTPKPVDNEK
Ga0335050_0051625_2238_2357	3300034108	Freshwater	MNKFECSECGTKYSSPELTPPPGIKWSDGHVCTPKLINK
Ga0335051_0008527_261_386	3300034109	Freshwater	MNKFICNECGTKYSSPELTPPPGIKWSDGHVCKPKPINHEK
Ga0335063_0315019_289_444	3300034111	Freshwater	MLKIFLNKKTMNEFICSECGTKYRSPELTPPPGIKWSDGHVCTPKPVNNGK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign