NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F021762

Metagenome / Metatranscriptome Family F021762

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F021762
Family Type Metagenome / Metatranscriptome
Number of Sequences 217
Average Sequence Length 36 residues
Representative Sequence MKYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Number of Associated Samples 119
Number of Associated Scaffolds 215

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.04 %
% of genes near scaffold ends (potentially truncated) 16.13 %
% of genes from short scaffolds (< 2000 bps) 79.72 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.793 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil
(11.982 % of family members)
Environment Ontology (ENVO) Unclassified
(42.857 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.926 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.50%    β-sheet: 0.00%    Coil/Unstructured: 87.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 215 Family Scaffolds
PF13620CarboxypepD_reg 8.37
PF07687M20_dimer 6.98
PF01546Peptidase_M20 5.12
PF00793DAHP_synth_1 4.65
PF00015MCPsignal 4.19
PF14498Glyco_hyd_65N_2 2.79
PF01434Peptidase_M41 2.33
PF17200sCache_2 1.40
PF07495Y_Y_Y 0.93
PF11138DUF2911 0.93
PF06057VirJ 0.93
PF00733Asn_synthase 0.93
PF00326Peptidase_S9 0.93
PF01979Amidohydro_1 0.47
PF07859Abhydrolase_3 0.47
PF13545HTH_Crp_2 0.47
PF00970FAD_binding_6 0.47
PF07715Plug 0.47
PF02583Trns_repr_metal 0.47
PF07485DUF1529 0.47
PF00005ABC_tran 0.47
PF03446NAD_binding_2 0.47
PF10067DUF2306 0.47
PF09937DUF2169 0.47
PF02153PDH_N 0.47
PF12697Abhydrolase_6 0.47
PF09924LPG_synthase_C 0.47
PF00510COX3 0.47
PF12710HAD 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 215 Family Scaffolds
COG0840Methyl-accepting chemotaxis protein (MCP)Signal transduction mechanisms [T] 8.37
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 2.33
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.93
COG3946Type IV secretory pathway, VirJ componentIntracellular trafficking, secretion, and vesicular transport [U] 0.93
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.47
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.47
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 0.47
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.79 %
UnclassifiedrootN/A15.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_13559191All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1334Open in IMG/M
2170459014|G1P06HT01D6BZ8All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium525Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0656291All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1644Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100579464All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1173Open in IMG/M
3300000789|JGI1027J11758_12106406All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium544Open in IMG/M
3300000890|JGI11643J12802_12137947Not Available776Open in IMG/M
3300000956|JGI10216J12902_100970637All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium871Open in IMG/M
3300000956|JGI10216J12902_102227490All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium1312Open in IMG/M
3300000956|JGI10216J12902_111109421All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes768Open in IMG/M
3300005093|Ga0062594_101138441All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium767Open in IMG/M
3300005364|Ga0070673_101439975All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium649Open in IMG/M
3300005543|Ga0070672_100014906All Organisms → cellular organisms → Bacteria5519Open in IMG/M
3300005543|Ga0070672_100019144All Organisms → cellular organisms → Bacteria4963Open in IMG/M
3300005543|Ga0070672_100032258All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3951Open in IMG/M
3300005543|Ga0070672_100084331All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2551Open in IMG/M
3300005543|Ga0070672_100093881All Organisms → cellular organisms → Bacteria2424Open in IMG/M
3300005543|Ga0070672_100470270All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300005543|Ga0070672_100549621All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300005543|Ga0070672_100591709Not Available966Open in IMG/M
3300005543|Ga0070672_100904374Not Available780Open in IMG/M
3300005564|Ga0070664_100014444All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis6438Open in IMG/M
3300005564|Ga0070664_100019291All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes5609Open in IMG/M
3300005564|Ga0070664_100034967All Organisms → cellular organisms → Bacteria4217Open in IMG/M
3300005564|Ga0070664_100039541All Organisms → cellular organisms → Bacteria3974Open in IMG/M
3300005564|Ga0070664_100088547All Organisms → cellular organisms → Bacteria2677Open in IMG/M
3300005564|Ga0070664_100094362All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2594Open in IMG/M
3300005564|Ga0070664_100178748All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300005564|Ga0070664_100178748All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300005564|Ga0070664_100505156Not Available1115Open in IMG/M
3300005564|Ga0070664_100586780Not Available1033Open in IMG/M
3300005616|Ga0068852_100994073All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300005616|Ga0068852_102064349All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium592Open in IMG/M
3300005719|Ga0068861_100733337All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes921Open in IMG/M
3300005719|Ga0068861_101654405Not Available632Open in IMG/M
3300005841|Ga0068863_100491678All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1207Open in IMG/M
3300006031|Ga0066651_10056753All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1850Open in IMG/M
3300006046|Ga0066652_100000792All Organisms → cellular organisms → Bacteria15657Open in IMG/M
3300006046|Ga0066652_100000812All Organisms → cellular organisms → Bacteria15462Open in IMG/M
3300006606|Ga0074062_12462986All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1464Open in IMG/M
3300006755|Ga0079222_10624236All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300006791|Ga0066653_10050529All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300006846|Ga0075430_100167673All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1827Open in IMG/M
3300006853|Ga0075420_100875110All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300006876|Ga0079217_10007110All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3419Open in IMG/M
3300006876|Ga0079217_10026507All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2109Open in IMG/M
3300006876|Ga0079217_10307927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales882Open in IMG/M
3300006881|Ga0068865_100703632All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300006894|Ga0079215_10953468All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium623Open in IMG/M
3300006918|Ga0079216_10116646All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300006918|Ga0079216_10783407All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300007004|Ga0079218_10228264All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1448Open in IMG/M
3300007004|Ga0079218_10247464All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300009148|Ga0105243_11016307All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009156|Ga0111538_11989327All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium731Open in IMG/M
3300009174|Ga0105241_10568286All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300009174|Ga0105241_10680185All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium937Open in IMG/M
3300009174|Ga0105241_11455591All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium658Open in IMG/M
3300009174|Ga0105241_11512665All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium646Open in IMG/M
3300009177|Ga0105248_10457073All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300009551|Ga0105238_10314415All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300009789|Ga0126307_10032444All Organisms → cellular organisms → Bacteria4023Open in IMG/M
3300009789|Ga0126307_10060031All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2982Open in IMG/M
3300009789|Ga0126307_10078969All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2596Open in IMG/M
3300009789|Ga0126307_10675886All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes833Open in IMG/M
3300009789|Ga0126307_10848811All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium737Open in IMG/M
3300009789|Ga0126307_11595456Not Available530Open in IMG/M
3300009789|Ga0126307_11691167All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium514Open in IMG/M
3300009840|Ga0126313_10169527All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1661Open in IMG/M
3300009840|Ga0126313_10678289All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium834Open in IMG/M
3300009840|Ga0126313_10900542All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium722Open in IMG/M
3300009840|Ga0126313_11142214All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium641Open in IMG/M
3300009840|Ga0126313_11463212All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes567Open in IMG/M
3300010036|Ga0126305_10065050All Organisms → cellular organisms → Bacteria2110Open in IMG/M
3300010037|Ga0126304_11189263Not Available522Open in IMG/M
3300010039|Ga0126309_10104006All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1466Open in IMG/M
3300010039|Ga0126309_10185473All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1142Open in IMG/M
3300010039|Ga0126309_10246902Not Available1009Open in IMG/M
3300010040|Ga0126308_10016172All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3921Open in IMG/M
3300010041|Ga0126312_10637764All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes767Open in IMG/M
3300010041|Ga0126312_11242987All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium550Open in IMG/M
3300010042|Ga0126314_10767133All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300010042|Ga0126314_11117986All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium587Open in IMG/M
3300010044|Ga0126310_11030561All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300010166|Ga0126306_10015608All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium4919Open in IMG/M
3300010166|Ga0126306_10535557All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes929Open in IMG/M
3300010166|Ga0126306_10803616Not Available759Open in IMG/M
3300010321|Ga0134067_10288243Not Available630Open in IMG/M
3300010375|Ga0105239_10179868All Organisms → cellular organisms → Bacteria2366Open in IMG/M
3300010403|Ga0134123_10445729All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1202Open in IMG/M
3300010403|Ga0134123_11293436All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium764Open in IMG/M
3300011119|Ga0105246_11465443All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium640Open in IMG/M
3300012212|Ga0150985_101171846All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012212|Ga0150985_101607382All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium550Open in IMG/M
3300012212|Ga0150985_101908842All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012212|Ga0150985_105867981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter683Open in IMG/M
3300012212|Ga0150985_110267769All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium526Open in IMG/M
3300012212|Ga0150985_111962272All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1708Open in IMG/M
3300012212|Ga0150985_122347158Not Available1211Open in IMG/M
3300012469|Ga0150984_107438826All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1134Open in IMG/M
3300012914|Ga0157297_10129964All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium796Open in IMG/M
3300012951|Ga0164300_10473881Not Available708Open in IMG/M
3300012958|Ga0164299_11241883All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium566Open in IMG/M
3300012984|Ga0164309_11740960Not Available535Open in IMG/M
3300012986|Ga0164304_11507853All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium556Open in IMG/M
3300012987|Ga0164307_11042934All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium668Open in IMG/M
3300012989|Ga0164305_10312079All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1167Open in IMG/M
3300013100|Ga0157373_10831213All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium682Open in IMG/M
3300013102|Ga0157371_10178322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.BinA3051519Open in IMG/M
3300013104|Ga0157370_12132281All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium502Open in IMG/M
3300013297|Ga0157378_12427294All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium576Open in IMG/M
3300013307|Ga0157372_11526971All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes769Open in IMG/M
3300014326|Ga0157380_11070199All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes844Open in IMG/M
3300014326|Ga0157380_11948392All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium649Open in IMG/M
3300014745|Ga0157377_10958561Not Available644Open in IMG/M
3300015262|Ga0182007_10072807All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1126Open in IMG/M
3300015262|Ga0182007_10120987All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium876Open in IMG/M
3300015371|Ga0132258_10440772All Organisms → cellular organisms → Bacteria3245Open in IMG/M
3300015371|Ga0132258_10798008All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2380Open in IMG/M
3300015371|Ga0132258_12839020All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300015373|Ga0132257_101357948Not Available903Open in IMG/M
3300017792|Ga0163161_10680120All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes855Open in IMG/M
3300017792|Ga0163161_11009906Not Available710Open in IMG/M
3300018433|Ga0066667_11769054Not Available558Open in IMG/M
3300018433|Ga0066667_12014825All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium531Open in IMG/M
3300018466|Ga0190268_11612267Not Available572Open in IMG/M
3300018476|Ga0190274_10067765All Organisms → cellular organisms → Bacteria2678Open in IMG/M
3300018476|Ga0190274_10176779All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1843Open in IMG/M
3300018476|Ga0190274_11905817All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes690Open in IMG/M
3300018920|Ga0190273_10170167All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300018920|Ga0190273_10226720All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300018920|Ga0190273_11065171All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes674Open in IMG/M
3300018920|Ga0190273_11120086Not Available662Open in IMG/M
3300019361|Ga0173482_10180594All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300019377|Ga0190264_11464288Not Available590Open in IMG/M
3300019377|Ga0190264_12041164All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium527Open in IMG/M
3300021445|Ga0182009_10004338All Organisms → cellular organisms → Bacteria4345Open in IMG/M
3300021445|Ga0182009_10160497All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1073Open in IMG/M
3300021445|Ga0182009_10282091All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300021445|Ga0182009_10588277All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium595Open in IMG/M
3300022756|Ga0222622_10020058All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3386Open in IMG/M
3300022756|Ga0222622_10091573All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300022756|Ga0222622_10091573All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300022756|Ga0222622_10319749All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1073Open in IMG/M
3300022756|Ga0222622_10522446All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium850Open in IMG/M
3300022756|Ga0222622_11323113All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium530Open in IMG/M
3300024055|Ga0247794_10298127All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium542Open in IMG/M
3300025321|Ga0207656_10015891All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae2921Open in IMG/M
3300025321|Ga0207656_10036520All Organisms → cellular organisms → Bacteria2063Open in IMG/M
3300025552|Ga0210142_1029455All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1041Open in IMG/M
3300025899|Ga0207642_10011315All Organisms → cellular organisms → Bacteria3178Open in IMG/M
3300025900|Ga0207710_10545582All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium604Open in IMG/M
3300025903|Ga0207680_10686651Not Available733Open in IMG/M
3300025904|Ga0207647_10079949All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1961Open in IMG/M
3300025907|Ga0207645_10013894All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes5401Open in IMG/M
3300025909|Ga0207705_10405757All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300025911|Ga0207654_10887920All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium646Open in IMG/M
3300025919|Ga0207657_11288457All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium552Open in IMG/M
3300025920|Ga0207649_11128625All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300025926|Ga0207659_10018952All Organisms → cellular organisms → Bacteria4520Open in IMG/M
3300025931|Ga0207644_10461123All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae1045Open in IMG/M
3300025932|Ga0207690_10266720All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300025935|Ga0207709_11460349Not Available567Open in IMG/M
3300025936|Ga0207670_10009859All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium5470Open in IMG/M
3300025945|Ga0207679_10013030All Organisms → cellular organisms → Bacteria → Acidobacteria5441Open in IMG/M
3300025945|Ga0207679_10026446All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium4001Open in IMG/M
3300025945|Ga0207679_10866633All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium825Open in IMG/M
3300025945|Ga0207679_11434091Not Available633Open in IMG/M
3300025945|Ga0207679_12201052Not Available500Open in IMG/M
3300025972|Ga0207668_10533893All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1014Open in IMG/M
3300025986|Ga0207658_10792241All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium860Open in IMG/M
3300026116|Ga0207674_10441799All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300026121|Ga0207683_10582483All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1035Open in IMG/M
3300026142|Ga0207698_10471828All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300027637|Ga0209818_1080982All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium834Open in IMG/M
3300027886|Ga0209486_10164898All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium1231Open in IMG/M
3300027886|Ga0209486_10591723All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium702Open in IMG/M
3300028754|Ga0307297_10405235All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium504Open in IMG/M
3300030336|Ga0247826_11547045All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium539Open in IMG/M
3300030496|Ga0268240_10142725All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium586Open in IMG/M
3300030905|Ga0308200_1154545All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium533Open in IMG/M
3300030988|Ga0308183_1167366All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes552Open in IMG/M
3300031058|Ga0308189_10522375All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium514Open in IMG/M
3300031446|Ga0170820_16597722Not Available584Open in IMG/M
3300031548|Ga0307408_100195328All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium1634Open in IMG/M
3300031548|Ga0307408_100231135All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300031548|Ga0307408_100288194All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300031548|Ga0307408_100862027All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium826Open in IMG/M
3300031548|Ga0307408_102375568Not Available514Open in IMG/M
3300031716|Ga0310813_10146826All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1893Open in IMG/M
3300031731|Ga0307405_10237125Not Available1349Open in IMG/M
3300031731|Ga0307405_10448399All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300031731|Ga0307405_11027652All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium705Open in IMG/M
3300031824|Ga0307413_11517930All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium593Open in IMG/M
3300031901|Ga0307406_11321353Not Available630Open in IMG/M
3300031901|Ga0307406_11662759All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium565Open in IMG/M
3300031938|Ga0308175_100003082All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes11506Open in IMG/M
3300031938|Ga0308175_100025278All Organisms → cellular organisms → Bacteria4818Open in IMG/M
3300031938|Ga0308175_100092429All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium2762Open in IMG/M
3300031938|Ga0308175_100102173All Organisms → cellular organisms → Bacteria2643Open in IMG/M
3300031938|Ga0308175_100320724All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1588Open in IMG/M
3300031938|Ga0308175_100349695All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1527Open in IMG/M
3300031938|Ga0308175_100684625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora saelicesensis1112Open in IMG/M
3300031938|Ga0308175_102069497All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium638Open in IMG/M
3300031939|Ga0308174_10011359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5155Open in IMG/M
3300031939|Ga0308174_11684465Not Available545Open in IMG/M
3300031995|Ga0307409_102371177Not Available560Open in IMG/M
3300031996|Ga0308176_11140224All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes826Open in IMG/M
3300031996|Ga0308176_12061852All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300032074|Ga0308173_10006094All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes7116Open in IMG/M
3300032074|Ga0308173_10834395All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes850Open in IMG/M
3300032126|Ga0307415_101292572Not Available691Open in IMG/M
3300033412|Ga0310810_10106798All Organisms → cellular organisms → Bacteria3330Open in IMG/M
3300033550|Ga0247829_10503773All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300034384|Ga0372946_0027089All Organisms → cellular organisms → Bacteria2532Open in IMG/M
3300034384|Ga0372946_0071178All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1599Open in IMG/M
3300034384|Ga0372946_0393740All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium673Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil11.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.06%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere8.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.37%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere5.07%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere3.23%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.46%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.46%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.46%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.46%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0686.000002202162886012Miscanthus RhizosphereMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
2PV_038347702170459014Switchgrass, Maize And Mischanthus LitterHMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS
ICChiseqgaiiDRAFT_065629113300000033SoilMKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS*
INPhiseqgaiiFebDRAFT_10057946423300000364SoilMKYEKPAVQRYGSLREMTLGNGPRLGGDAVSLYHRS*
JGI1027J11758_1210640613300000789SoilMKYEKPAVQRFGSLREHTLGNGPRLGGDAVSLYHRS*
JGI11643J12802_1213794723300000890SoilEAMHMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
JGI10216J12902_10097063723300000956SoilMSYQKPTVQRFGSLRELTLGGGAQLSGDATNLYHRS*
JGI10216J12902_10222749033300000956SoilMTYEKPAVQRFGSLRELTLGGGAQMQGDATNLYHRS*
JGI10216J12902_11110942113300000956SoilMKYEKPVVQRFGSLRELTLGGGATLEGDATNLYHRS*
Ga0062594_10113844113300005093SoilQTRENCMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070673_10143997523300005364Switchgrass RhizosphereLVLQTRENCMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070672_10001490623300005543Miscanthus RhizosphereMKYEKPAVQRFGTVREITLGGGPNLAGDATNQYHRS*
Ga0070672_10001914463300005543Miscanthus RhizosphereMYEKPVVQRLGSLRELTLGLGPNLGGDPASVYHRS*
Ga0070672_10003225853300005543Miscanthus RhizosphereMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070672_10008433123300005543Miscanthus RhizosphereMYEKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS*
Ga0070672_10009388123300005543Miscanthus RhizosphereMKYEKPAVQRFGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0070672_10047027023300005543Miscanthus RhizosphereMKYEKPAVQRFGTVREITLGSGPNQPGDATNLYHRS*
Ga0070672_10054962113300005543Miscanthus RhizosphereMKYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070672_10059170923300005543Miscanthus RhizosphereMYEKPVVQRFGSLRELTLGQGANLGGDATSIYHRS*
Ga0070672_10090437413300005543Miscanthus RhizosphereMKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHR
Ga0070664_10001444463300005564Corn RhizosphereMTYQKPAVQRFGSLRELTLGGGAQLRGDATNLYHRS*
Ga0070664_10001929123300005564Corn RhizosphereMYEKPTVQRLGSLRELTLGLGPNLGGDPASVYHRS*
Ga0070664_10003496723300005564Corn RhizosphereMTYEKPMVQRFGTLRELTLGGGPQLSGDATNLYHRS*
Ga0070664_10003954133300005564Corn RhizosphereMTYEKPTVQRFGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0070664_10008854723300005564Corn RhizosphereMYQKPEVKRFGSVRELTQGGGPAGAGDATNVYHRS*
Ga0070664_10009436233300005564Corn RhizosphereMKYEKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070664_10017874823300005564Corn RhizosphereMKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS*
Ga0070664_10017874833300005564Corn RhizosphereMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0070664_10050515623300005564Corn RhizosphereMKYEKPAVQRFGTVREITLGGGPNLAGDATNTYHRS*
Ga0070664_10058678023300005564Corn RhizosphereMKYEKPAVQRLGTLRELTLGSGPSTPGDATNLYHRS*
Ga0068852_10099407323300005616Corn RhizosphereMKYEKPTVQRFGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0068852_10206434913300005616Corn RhizosphereMKYEKPAVQRYGSLREITLGNGPRLGGDATSLYHRS*
Ga0068861_10073333723300005719Switchgrass RhizosphereMKYEKPAVQRFGSLREVTLGNGPRLGGDAVSLYHRS*
Ga0068861_10165440523300005719Switchgrass RhizosphereMKYEKPAVQRWGTLRELTLGSGPNTPGDATSLYHRS*
Ga0068863_10049167833300005841Switchgrass RhizosphereTMKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0066651_1005675323300006031SoilMTYQKPSVQRFGSLRELTLGGGSTLQGDATNLYHRS*
Ga0066652_100000792103300006046SoilMYEKPEVKRFGSLRELTKGGGPAGGGDAASVYHRS*
Ga0066652_10000081293300006046SoilMKYEKPVVQRFGSLRELTLGGGSTLQGDATNLYHRS*
Ga0074062_1246298633300006606SoilMKYEKPAVQRYGSLRELTLGNGPRLGGDATSIYHRS*
Ga0079222_1062423613300006755Agricultural SoilMKYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0066653_1005052923300006791SoilLEMKYEKPVVQRFGSLRELTLGGGSTLQGDATNLYHRS*
Ga0075430_10016767333300006846Populus RhizosphereMKYEKPAVLRFGSLRELTLGGGPSLEGDATNPYHRS*
Ga0075420_10087511013300006853Populus RhizosphereMTYEKPAVQRFGSLRELTLGGGAQLTGDATNLYHRS*
Ga0079217_1000711023300006876Agricultural SoilMYQKPTVQRFGSLRELTLGGGQQLEGDATNLYHRS*
Ga0079217_1002650733300006876Agricultural SoilMKYEKPVVQRFGSLRELTLGGGPQEQGDATNLYHRS*
Ga0079217_1030792723300006876Agricultural SoilMKYEKPVVQRFGSLRELTLGGGPQTQGDATNLYHRS*
Ga0068865_10070363213300006881Miscanthus RhizosphereMKYEKPAVQRLGSLRELTLGSGPSTPGDATNLYHRS*
Ga0079215_1095346823300006894Agricultural SoilMKYEKPVVQRFGSLRELTLGGGPQSQGDATNLYHRS*
Ga0079216_1011664613300006918Agricultural SoilMYQKPTVQRFGSLRELTLGGGNQLEGDATNLYHRS*
Ga0079216_1078340713300006918Agricultural SoilMTYEKPAITRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0079218_1022826423300007004Agricultural SoilMYEKPEVKRFGSLRELTQGGGPGLGGDATNVYHRS*
Ga0079218_1024746423300007004Agricultural SoilMSYQKPQVTRYGTLVEVTNGAGANLGGDATSVYHRS*
Ga0105243_1101630723300009148Miscanthus RhizosphereMKYEKPAVQRFGSLRELTLGGGPQSSGDATNLYHRS*
Ga0111538_1198932723300009156Populus RhizosphereMYEKPKVERFGTLRELTLGGGPQLGGDGVDPYHRS*
Ga0105241_1056828613300009174Corn RhizosphereMKYEKPSVQRFGSLRELTLGGGSQRSGDATNLYHRS*
Ga0105241_1068018513300009174Corn RhizosphereMTKYEKPMVQRFGSLRELTLGGGPELSGDATNLYHRS*
Ga0105241_1145559113300009174Corn RhizosphereMHMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0105241_1151266513300009174Corn RhizosphereMTYQKPVVQRFGSLRELTLGGGPSLSGDATNLYHRS*
Ga0105248_1045707323300009177Switchgrass RhizosphereMKYEKPAVQRFGTVRESTLGAGQNTPGDATNLYHRS*
Ga0105238_1031441543300009551Corn RhizosphereYRGESTMKYEKPAVQRYGSLREITLGNGPRLGGDATSLYHRS*
Ga0126307_1003244453300009789Serpentine SoilMKYEKPAVTRFGTVRELTLGGGPQTNGDATNQFHRS*
Ga0126307_1006003133300009789Serpentine SoilMYEKPAVQRFGSLRDLTMGNGPAGGGDATSIWHRS*
Ga0126307_1007896913300009789Serpentine SoilMKYEKPAVQRFGSLRELTLGGGPQTSGDATNQYHRS*
Ga0126307_1067588623300009789Serpentine SoilMKYEKPVVQRFGSLRELTLGGGPQESGDDTNLYHRS*
Ga0126307_1084881123300009789Serpentine SoilMKYEKPVVQRFGSLRELTLGGGPQLAGDATNQFHRS*
Ga0126307_1159545613300009789Serpentine SoilMYEKPAVKRYVNLRDLTTGAGPAGGGDATSIWHRS*
Ga0126307_1169116723300009789Serpentine SoilMTYEKPAVQRFGSLRELTLGGGPSQGGDATNLYHRS*
Ga0126313_1016952733300009840Serpentine SoilMYEKPAVQRFGNLRDLTMGNGPAGGGDATSIWHRS*
Ga0126313_1067828913300009840Serpentine SoilKGVDMYEKPEVKRFGSLRELTQGGGPSGGGDATNVYHRS*
Ga0126313_1090054223300009840Serpentine SoilMTYQKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0126313_1114221423300009840Serpentine SoilMKYEKPTIQRFGTLRELTLGGGPQTSGDATNQFHR
Ga0126313_1146321213300009840Serpentine SoilMKYEKPVVQRFGSLRELTLGGGPQESGDATNLYHRS*
Ga0126305_1006505023300010036Serpentine SoilMTYQKPAVQRFGSLRELTLGGGAQLSGDATNQYHRS*
Ga0126304_1118926313300010037Serpentine SoilKSPGGCMKYEKPAVTRFGTVRELTLGGGPQTNGDATNQFHRS*
Ga0126309_1010400623300010039Serpentine SoilMKYEKPAVQRFGSLRELTLGGGPNLAGDATNQYHRS*
Ga0126309_1018547313300010039Serpentine SoilMKYEKPVVQRFGSLRELTLGGGPQMAGDATNQYHRS*
Ga0126309_1024690213300010039Serpentine SoilMKNEKVKVYEKPAIQRYGTFRELTLGTGPIPSGDATNLYHRS*
Ga0126308_1001617233300010040Serpentine SoilMTYQKPAVQRFGSLRELTLGGGPSLAGDATNQYHRS*
Ga0126312_1063776413300010041Serpentine SoilMKYEKPVVQRFGSLRELTLGGGAQTTGDATNLYHRS*
Ga0126312_1124298723300010041Serpentine SoilMYEKPAVQRFGTLRDLTMGNGPAGGGDATSIYHRS*
Ga0126314_1076713323300010042Serpentine SoilMKYEKPVVQRFGTLREMTLGGGPLSGGDATNVFHRS*
Ga0126314_1111798613300010042Serpentine SoilMTYQKPSVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0126310_1103056123300010044Serpentine SoilSTMTYEKPSVQRFGSLRELTLGNGPKLGGDATSLYHRS*
Ga0126306_1001560833300010166Serpentine SoilMYEKPAVQRFGNLRDLTMGNGPSGGGDATSIWHRS*
Ga0126306_1053555713300010166Serpentine SoilMKYEKPVVQRFGTLRELTLGGGPQSMGDATNLYHRS*
Ga0126306_1080361623300010166Serpentine SoilMVYEKPEVKRYGSVTELTLGGGAGMGGDATNLYHRS*
Ga0134067_1028824323300010321Grasslands SoilMKYEKPAVQRFGSLHELTLGAGPRLGGDATSVYHRS*
Ga0105239_1017986823300010375Corn RhizosphereMHMKYEKPAVQRFGTVREITLGAGNNTPGDATNLYHRS*
Ga0134123_1044572923300010403Terrestrial SoilMYEKPEVKRFGSLRELTQGGGPAGGGDATNMYHRS*
Ga0134123_1129343613300010403Terrestrial SoilMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHR
Ga0105246_1146544313300011119Miscanthus RhizosphereIWGRRLAMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0150985_10117184623300012212Avena Fatua RhizosphereMKYEKPVVQRFGTLREMTLGGGPQSAGDATNLFHRS*
Ga0150985_10160738223300012212Avena Fatua RhizosphereMTYQKPVVQRFGSLRELTLGGGASLAGDATNLYHRS*
Ga0150985_10190884213300012212Avena Fatua RhizosphereMYQKPEVERFGSLRELTKGGAQAHGGDATNVYHRS*
Ga0150985_10586798123300012212Avena Fatua RhizosphereMYEKPVVLRLGSLRELTLGLGPNLGGDPASVYHRS*
Ga0150985_11026776913300012212Avena Fatua RhizosphereMKYEKPAVQRFGSLREITLGGGSNSGGDATNLYHRS*
Ga0150985_11196227213300012212Avena Fatua RhizosphereMYEKPVVKRFGSLRELTAGMGPNLGGDAQSVYHRS*
Ga0150985_12234715813300012212Avena Fatua RhizosphereMYEKPAVQRYGTLREVTLGQGPALGGDATSVFHRS*
Ga0150984_10743882613300012469Avena Fatua RhizosphereMYEKPEVQRFGSLRELSKGGAQALGGDATNVYHRS*
Ga0157297_1012996423300012914SoilMKYEKPAVQRFGSLRELSLGGGPAETGDATNLYHRS*
Ga0164300_1047388113300012951SoilMKYEKPAVQRFGTVREITLGAGPNSPGDATNMYHRS*
Ga0164299_1124188313300012958SoilMKYEKPIVQRFGSLRELTLGGGPSLSGDATNLYHRS*
Ga0164309_1174096013300012984SoilMKYEKPAVLRLGSLREVTLGAGPNSPGDATNMYHRS*
Ga0164304_1150785313300012986SoilMHMKYEKPAVQRFGTVREITLGSGQNTPGDATNLYHRS*
Ga0164307_1104293423300012987SoilMKYEKPAVQRFGTVREITLGAGQNMPGDATNLYHRS*
Ga0164305_1031207923300012989SoilMKYEKPAVQRFGSLRELTLGNGPRLGGDAVSLDHRS*
Ga0157373_1083121313300013100Corn RhizosphereMKYEKPSVQRFGSLRELTLGGGSQLSGDATNLYHRS*
Ga0157371_1017832223300013102Corn RhizosphereYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0157370_1132642623300013104Corn RhizosphereMYEKPTVQRLGTLRELTLGLGPNLGGDPQSVYHRS*
Ga0157370_1213228113300013104Corn RhizosphereGESTMKYEKPAVQRYGSLRELTLGNGPRLGGDATSLYHRS*
Ga0157378_1242729423300013297Miscanthus RhizosphereIISGEAIHMKYEKPAVQRFGTVREITLGSGPNTPGDATNLYHRS*
Ga0157372_1152697123300013307Corn RhizosphereMYRGESTMKYEKPAVQRYGSLRELTLGNGPRLGGDATSLYHRS*
Ga0157380_1107019913300014326Switchgrass RhizosphereMQYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0157380_1194839213300014326Switchgrass RhizosphereMKYEKPAVQRFGSLLELTLGGGAQLSGDATNLYHRS*
Ga0157377_1095856113300014745Miscanthus RhizosphereMKYEKPAVQRLGSVRELTLGSGPSTPGDATNLYHRS*
Ga0182007_1007280713300015262RhizosphereMYQKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS*
Ga0182007_1012098723300015262RhizosphereTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0132258_1044077223300015371Arabidopsis RhizosphereMYEKPVVQRFGTLRELTLGQGPNLGGDAQSIYHRS*
Ga0132258_1079800833300015371Arabidopsis RhizosphereMYEKPAVQRFGSLRELTQGLGPNLGGDPASIYHRS*
Ga0132258_1283902023300015371Arabidopsis RhizosphereMYEKPVVQRLGSLRELTLGLGPNLGGDAASIYHRS*
Ga0132257_10135794813300015373Arabidopsis RhizospherePAASEQEERMTYQKPAVQRLGSLRELTLGAGQNTPGDATNLYHRS*
Ga0163161_1068012013300017792Switchgrass RhizosphereMKYEKPAVQRFGSLREVTLGNGPRLGGDAVSLYHRS
Ga0163161_1100990623300017792Switchgrass RhizosphereMKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS
Ga0066667_1176905423300018433Grasslands SoilMKYEKPAVQRLGSLRELTLGAGNNTPGDATNLYHRS
Ga0066667_1201482523300018433Grasslands SoilMKYEKPAVQRYGSLRELTLGNGPRLGGDAVSVYHRS
Ga0190268_1161226723300018466SoilMYEKPAVKRFGTLHELTLGGGSQEQGDATNLYHRS
Ga0190274_1006776523300018476SoilMYEKPEVKRFGSLRELTQGGGPGMGGDATNVYHRS
Ga0190274_1017677923300018476SoilMKYEKPVVQRFGSLRELTLGGGPQESGDATNLYHRS
Ga0190274_1190581723300018476SoilMKYEKPVVQRFGSLRELTLGGGPQEAGDATNLYHRS
Ga0190273_1017016713300018920SoilMKYEKPSVQRFGSLRELTLGGGQILGGDATNLYHRS
Ga0190273_1022672023300018920SoilMKYEKPVVQRFGTLRELTLGGGPNEAGDATNLFHRS
Ga0190273_1106517113300018920SoilMKYEKPSVQRFGSLRELTLGGGPAEAGDATNLYHRS
Ga0190273_1112008623300018920SoilMKYEKPAVQRLGTLRELTLGGGPQSTGDATNLYHRS
Ga0173482_1018059423300019361SoilMYEKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS
Ga0190264_1146428813300019377SoilMYQKPAVTRFGTLHELTLGGGPQDQGDATNLYHRS
Ga0190264_1204116423300019377SoilRSHRRTMYEKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS
Ga0182009_1000433833300021445SoilMYEKPRVERLGSLRELTLGLGPNLGGDPQSVYHRS
Ga0182009_1016049713300021445SoilMKYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0182009_1028209123300021445SoilMYQKPEVKRFGSFRELTQGGGPAGGGDPTNVFHRS
Ga0182009_1058827723300021445SoilMYEKPEVQRFGSLRELTKGGAQALGGDATNVYHRS
Ga0222622_1002005823300022756Groundwater SedimentMYQKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS
Ga0222622_1009157313300022756Groundwater SedimentMKYEKPAVQRFGTVREITLGSGPNTPGDATNLYHRS
Ga0222622_1009157323300022756Groundwater SedimentMKYEKPAVQRLGSLRELTLGSGPSTPGDATNLYHRS
Ga0222622_1031974923300022756Groundwater SedimentMKYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0222622_1052244623300022756Groundwater SedimentMYEKPEVKRFGSLRELTQGGGPSGGGDATNVYHRS
Ga0222622_1132311323300022756Groundwater SedimentMKYEKPVVQRFGSLRELTLGGGPQLAGDATNQFHRS
Ga0247794_1029812713300024055SoilMKYEKPAVQRFGSLRELTLGNGPRLGGDAVSLYHRS
Ga0207656_1001589133300025321Corn RhizosphereMYEKPTVQRLGSLRELTLGLGPNLGGDPASVYHRS
Ga0207656_1003652023300025321Corn RhizosphereMHMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS
Ga0210142_102945523300025552Natural And Restored WetlandsMTYVKPAVQRFGSLRELTLGNGPRLGGDATSLYHRS
Ga0207642_1001131523300025899Miscanthus RhizosphereMKYEKPAVQRFGTVREITLGGGPNLAGDATNQYHRS
Ga0207710_1054558213300025900Switchgrass RhizosphereMYEKPVVQRFGSLRELTLGQGANLGGDATSIYHRS
Ga0207680_1068665123300025903Switchgrass RhizosphereMKYEKPAVQRWGTLRELTLGSGPNTPGDATSLYHRS
Ga0207647_1007994923300025904Corn RhizosphereMKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS
Ga0207645_1001389423300025907Miscanthus RhizosphereMKYEKPAVQRFGTVREITLGSGPNQPGDATNLYHRS
Ga0207705_1040575723300025909Corn RhizosphereMTYEKPTVQRFGSLRELTLGNGPRLGGDAVSLYHRS
Ga0207654_1088792013300025911Corn RhizosphereMTYQKPVVQRFGSLRELTLGGGPSLSGDATNLYHRS
Ga0207657_1128845723300025919Corn RhizosphereLPWRDGMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207649_1112862523300025920Corn RhizosphereMTYEKPMVQRFGTLRELTLGGGPQLSGDATNLYHRS
Ga0207659_1001895233300025926Miscanthus RhizosphereMQYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207644_1046112323300025931Switchgrass RhizosphereMYEKPVVQRFGSLRELTLGQGASLGGDATSIYHRS
Ga0207690_1026672023300025932Corn RhizosphereAKESLMYEKPTVQRLGSLRELTLGLGPNLGGDPASVYHRS
Ga0207709_1146034913300025935Miscanthus RhizosphereGEDSMKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS
Ga0207670_1000985953300025936Switchgrass RhizosphereMYEKPEVKRFGSLRELTQGGGRAGGGDATNVYHRS
Ga0207679_1001303063300025945Corn RhizosphereMKYEKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207679_1002644613300025945Corn RhizosphereHRRKVMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207679_1086663313300025945Corn RhizosphereMYQKPEVKRFGSVRELTQGGGPAGAGDATNVYHRS
Ga0207679_1143409123300025945Corn RhizosphereMKYEKPAVQRFGTVREITLGGGPNLAGDATNTYHRS
Ga0207679_1220105213300025945Corn RhizosphereMKYEKPAVQRLGTLRELTLGSGPSTPGDATNLYHRS
Ga0207668_1053389323300025972Switchgrass RhizosphereMKYEKPAVQRFGSLRGVTLGNGPRLGGDAVSLYHRS
Ga0207658_1079224113300025986Switchgrass RhizosphereMTYEKPTVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207674_1044179923300026116Corn RhizosphereVYDKPKVERFGTLRELTLGGGPEMGGDGLNPYHRS
Ga0207683_1058248323300026121Miscanthus RhizosphereMTYQKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207698_1047182833300026142Corn RhizosphereGTGEDRMKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS
Ga0209818_108098223300027637Agricultural SoilMYQKPTVQRFGSLRELTLGGGQQLEGDATNLYHRS
Ga0209486_1016489833300027886Agricultural SoilMTYEKPAITRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0209486_1059172313300027886Agricultural SoilMYEKPEVKRFGSLRELTQGGGPGLGGDATNVYHRS
Ga0307297_1040523513300028754SoilDCMTYQKPAVQRFGSLRELTLGGGAQESGDATNLYHRS
Ga0247826_1154704513300030336SoilMKYEKPAVQRFGSLRELTLGGGPQSQGDATNLYHRS
Ga0268240_1014272513300030496SoilMKYEKPAVQRFGSLRELTLGGGPNLAGDATNQYHRS
Ga0308200_115454513300030905SoilMKYEKPVVQRFGSLRELTLGGGPQTAGDATNQFHRS
Ga0308183_116736623300030988SoilMKYEKPVVQRFGSLRELTLGGGPQMAGDATNQYHRS
Ga0308189_1052237513300031058SoilMKYEKPVVQRFGSLRELTLGGGPQSSGDATNQFHR
Ga0170820_1659772213300031446Forest SoilIRMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS
Ga0307408_10019532833300031548RhizosphereMKYEKPAVQRFGSLRELTLGGGAELSGDATNLYHRS
Ga0307408_10023113523300031548RhizosphereMYEKPIVTRFGSLRELTLGGGQQMSGDATNMYHRS
Ga0307408_10028819423300031548RhizosphereMYEKPMVQRFGSLRELTLGGGPNEAGDATNMYHRS
Ga0307408_10086202723300031548RhizosphereMYEKPEVKRFGSIRELTQGGGPAGGGDATNVYHRS
Ga0307408_10237556823300031548RhizosphereMPYQKPEVVRYGTFVELTNGNGANLGGDATSVYHRS
Ga0310813_1014682643300031716SoilMYEKPAVQRFGTLRDITQGLGPALGGDPQSVYHRS
Ga0307405_1023712523300031731RhizosphereMTYDKPAVQRFGSLRELTLGGGNQTQGDATNLYHRS
Ga0307405_1044839923300031731RhizosphereMKYEKPVVQRFGSLRELTLGGGPNESGDATNMYHRS
Ga0307405_1102765223300031731RhizosphereMYEKPEVTRFGSLRELTQGGGNSNGGDATNNYHRS
Ga0307413_1151793023300031824RhizosphereMTYQKPAVQRFGSLRELTLGGGAQMTGDATNLYHRS
Ga0307406_1132135323300031901RhizosphereMTYDKPAVQRFGSLRELTLGGGSQTQGDATNLYHRS
Ga0307406_1166275913300031901RhizosphereMYEKPEVTRFGSLRELTQGGGNSNGGDATNIYHRS
Ga0308175_10000308263300031938SoilMKYEKPAVQRFGTVREITLGAGQNTPGDAANLYHRS
Ga0308175_10002527833300031938SoilMKYEKPVVQRFGSLRELTLGGGPQLAGDATNLYHRS
Ga0308175_10009242953300031938SoilMTYQKPAVQRFGSLRELTLGGGAQLAGDATNLYHRS
Ga0308175_10010217333300031938SoilMYEKPRVQRLGTLRELTLGMGPSLGGDPQSVYHRS
Ga0308175_10032072423300031938SoilMTYEKPAVQRYGSLRELTLGNGPRLGGDAASLYHRS
Ga0308175_10034969523300031938SoilMTKYEKPMVQRFGSLRELTLGGGPELSGDATNLYHRS
Ga0308175_10068462513300031938SoilMYEKPTVQRLGTLRELTLGLGPNLGGDPQSVYHRS
Ga0308175_10206949713300031938SoilMYRGESTMKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS
Ga0308174_1001135963300031939SoilMKYEKPVVQRFGSLRELTLGGGAQLAGDATNLYHRS
Ga0308174_1168446523300031939SoilVSMYEKPTVQRYGTLRELTFGQGPSTGGDATTVYHRS
Ga0307409_10237117713300031995RhizosphereMYEKPKVQRYGSLRELTLGGGPAAQGDQTNLYHRS
Ga0308176_1114022413300031996SoilMKYEKPAVQRFGSLRELTLGGGPSNGGDATNIYHRS
Ga0308176_1206185213300031996SoilMKYEKPVVQRFGTLREITLGGGPLNGGDATNVYHRS
Ga0308173_1000609493300032074SoilMTYQKPAVQRFGSLRELTLGGGANLAGDATNLYHRS
Ga0308173_1083439523300032074SoilMTYEKPVVQRFGSLRELTLGGGAQLAGDATNLYHRS
Ga0307415_10129257213300032126RhizosphereMYEKPKVQRYGSLRELTLGGGPSTQGDQTNLYHRS
Ga0310810_1010679823300033412SoilMKYEKPAVQRFGSLRELTLGNGPQLGGDATSLYHRS
Ga0247829_1050377323300033550SoilMKYEKPAVQRFGSLRELTLGGGPQSSGDATNLYHRS
Ga0372946_0027089_1467_15773300034384SoilMKYEKPAVQRYGTLRELTLGGGPALGGDATNLYHRS
Ga0372946_0071178_1301_14113300034384SoilMTYQKPAVQRFGTLRELTLGGGPSLGGDATNLYHRS
Ga0372946_0393740_3_1103300034384SoilTYTKPAVQRFGTMTELTLGGGPSLGGDATNLYHRS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.