


| Basic Information | |
|---|---|
| Family ID | F021761 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 217 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAHHNHPACNTNLKP |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 217 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 39.17 % |
| % of genes near scaffold ends (potentially truncated) | 22.12 % |
| % of genes from short scaffolds (< 2000 bps) | 74.65 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.622 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (13.825 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.198 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (35.484 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.67% β-sheet: 0.00% Coil/Unstructured: 57.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 217 Family Scaffolds |
|---|---|---|
| PF08774 | VRR_NUC | 15.21 |
| PF12684 | DUF3799 | 14.29 |
| PF00436 | SSB | 2.76 |
| PF11753 | DUF3310 | 2.76 |
| PF08707 | PriCT_2 | 1.84 |
| PF03837 | RecT | 1.84 |
| PF08291 | Peptidase_M15_3 | 1.84 |
| PF04542 | Sigma70_r2 | 1.38 |
| PF14279 | HNH_5 | 1.38 |
| PF01555 | N6_N4_Mtase | 0.92 |
| PF02768 | DNA_pol3_beta_3 | 0.92 |
| PF12728 | HTH_17 | 0.92 |
| PF13384 | HTH_23 | 0.92 |
| PF01047 | MarR | 0.92 |
| PF11922 | DUF3440 | 0.92 |
| PF01844 | HNH | 0.92 |
| PF05939 | Phage_min_tail | 0.46 |
| PF05866 | RusA | 0.46 |
| PF00140 | Sigma70_r1_2 | 0.46 |
| PF14659 | Phage_int_SAM_3 | 0.46 |
| PF04883 | HK97-gp10_like | 0.46 |
| PF00392 | GntR | 0.46 |
| PF00271 | Helicase_C | 0.46 |
| PF13936 | HTH_38 | 0.46 |
| PF08809 | DUF1799 | 0.46 |
| PF09250 | Prim-Pol | 0.46 |
| PF13538 | UvrD_C_2 | 0.46 |
| PF00709 | Adenylsucc_synt | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 217 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.76 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.76 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.84 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 1.84 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.38 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.38 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.38 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.92 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.92 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.92 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.46 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.46 |
| COG4718 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.38 % |
| Unclassified | root | N/A | 45.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10023548 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
| 3300000756|JGI12421J11937_10006855 | All Organisms → cellular organisms → Bacteria | 4474 | Open in IMG/M |
| 3300000756|JGI12421J11937_10155885 | Not Available | 560 | Open in IMG/M |
| 3300001963|GOS2229_1028985 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300004481|Ga0069718_16011454 | Not Available | 40546 | Open in IMG/M |
| 3300004481|Ga0069718_16153768 | All Organisms → cellular organisms → Bacteria | 10111 | Open in IMG/M |
| 3300005582|Ga0049080_10260547 | Not Available | 564 | Open in IMG/M |
| 3300005805|Ga0079957_1030480 | All Organisms → cellular organisms → Bacteria | 3578 | Open in IMG/M |
| 3300005941|Ga0070743_10002678 | Not Available | 6649 | Open in IMG/M |
| 3300005955|Ga0073922_1003003 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300005955|Ga0073922_1034423 | Not Available | 628 | Open in IMG/M |
| 3300005955|Ga0073922_1042058 | Not Available | 575 | Open in IMG/M |
| 3300005990|Ga0073921_1005632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2292 | Open in IMG/M |
| 3300006007|Ga0073917_1010616 | Not Available | 916 | Open in IMG/M |
| 3300006637|Ga0075461_10000741 | All Organisms → cellular organisms → Bacteria | 9578 | Open in IMG/M |
| 3300006637|Ga0075461_10127752 | Not Available | 788 | Open in IMG/M |
| 3300006802|Ga0070749_10002838 | All Organisms → Viruses | 11617 | Open in IMG/M |
| 3300006802|Ga0070749_10323836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 860 | Open in IMG/M |
| 3300006810|Ga0070754_10072964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1749 | Open in IMG/M |
| 3300006919|Ga0070746_10474621 | Not Available | 553 | Open in IMG/M |
| 3300007344|Ga0070745_1017282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3268 | Open in IMG/M |
| 3300007346|Ga0070753_1026271 | Not Available | 2530 | Open in IMG/M |
| 3300007539|Ga0099849_1084629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1279 | Open in IMG/M |
| 3300007539|Ga0099849_1221360 | All Organisms → Viruses | 705 | Open in IMG/M |
| 3300007540|Ga0099847_1141692 | Not Available | 718 | Open in IMG/M |
| 3300007542|Ga0099846_1236994 | All Organisms → Viruses | 636 | Open in IMG/M |
| 3300007544|Ga0102861_1000160 | Not Available | 17717 | Open in IMG/M |
| 3300007544|Ga0102861_1001498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 4973 | Open in IMG/M |
| 3300007544|Ga0102861_1039749 | Not Available | 1211 | Open in IMG/M |
| 3300007544|Ga0102861_1149287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 634 | Open in IMG/M |
| 3300007545|Ga0102873_1061638 | Not Available | 1143 | Open in IMG/M |
| 3300007554|Ga0102820_1119833 | Not Available | 633 | Open in IMG/M |
| 3300007559|Ga0102828_1034178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 1149 | Open in IMG/M |
| 3300007560|Ga0102913_1241171 | Not Available | 578 | Open in IMG/M |
| 3300007560|Ga0102913_1304818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 508 | Open in IMG/M |
| 3300007585|Ga0102916_1153647 | Not Available | 622 | Open in IMG/M |
| 3300007593|Ga0102918_1050366 | All Organisms → Viruses | 1198 | Open in IMG/M |
| 3300007603|Ga0102921_1140845 | Not Available | 874 | Open in IMG/M |
| 3300007603|Ga0102921_1143595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 864 | Open in IMG/M |
| 3300007622|Ga0102863_1138745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 716 | Open in IMG/M |
| 3300007622|Ga0102863_1232491 | Not Available | 542 | Open in IMG/M |
| 3300007640|Ga0070751_1049456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1850 | Open in IMG/M |
| 3300007642|Ga0102876_1185463 | Not Available | 553 | Open in IMG/M |
| 3300007670|Ga0102862_1115620 | Not Available | 676 | Open in IMG/M |
| 3300007972|Ga0105745_1052817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 1119 | Open in IMG/M |
| 3300007974|Ga0105747_1074564 | Not Available | 1032 | Open in IMG/M |
| 3300008108|Ga0114341_10025952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7189 | Open in IMG/M |
| 3300008266|Ga0114363_1008289 | Not Available | 9405 | Open in IMG/M |
| 3300008448|Ga0114876_1128460 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300008450|Ga0114880_1191689 | Not Available | 694 | Open in IMG/M |
| 3300008996|Ga0102831_1171543 | All Organisms → Viruses | 719 | Open in IMG/M |
| 3300008999|Ga0102816_1042346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 1346 | Open in IMG/M |
| 3300009024|Ga0102811_1365964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 544 | Open in IMG/M |
| 3300009056|Ga0102860_1031725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1389 | Open in IMG/M |
| 3300009056|Ga0102860_1241048 | Not Available | 523 | Open in IMG/M |
| 3300009075|Ga0105090_10780180 | Not Available | 581 | Open in IMG/M |
| 3300009075|Ga0105090_10947282 | Not Available | 525 | Open in IMG/M |
| 3300009079|Ga0102814_10326975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 834 | Open in IMG/M |
| 3300009085|Ga0105103_10253812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 950 | Open in IMG/M |
| 3300009085|Ga0105103_10258983 | All Organisms → Viruses | 941 | Open in IMG/M |
| 3300009146|Ga0105091_10060497 | All Organisms → Viruses | 1695 | Open in IMG/M |
| 3300009146|Ga0105091_10525056 | Not Available | 604 | Open in IMG/M |
| 3300009149|Ga0114918_10046315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2955 | Open in IMG/M |
| 3300009149|Ga0114918_10089642 | All Organisms → Viruses | 1935 | Open in IMG/M |
| 3300009149|Ga0114918_10370375 | Not Available | 786 | Open in IMG/M |
| 3300009149|Ga0114918_10400811 | All Organisms → Viruses | 748 | Open in IMG/M |
| 3300009149|Ga0114918_10512893 | All Organisms → Viruses | 641 | Open in IMG/M |
| 3300009149|Ga0114918_10564412 | Not Available | 604 | Open in IMG/M |
| 3300009155|Ga0114968_10096345 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 1815 | Open in IMG/M |
| 3300009165|Ga0105102_10383290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 744 | Open in IMG/M |
| 3300009168|Ga0105104_10298169 | Not Available | 885 | Open in IMG/M |
| 3300009170|Ga0105096_10071538 | Not Available | 1719 | Open in IMG/M |
| 3300009451|Ga0127402_1023479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1466 | Open in IMG/M |
| 3300009469|Ga0127401_1001077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7080 | Open in IMG/M |
| 3300009470|Ga0126447_1031373 | All Organisms → Viruses | 1324 | Open in IMG/M |
| 3300009504|Ga0114946_10029907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 3202 | Open in IMG/M |
| 3300009504|Ga0114946_10091879 | All Organisms → Viruses | 1701 | Open in IMG/M |
| 3300009504|Ga0114946_10299032 | All Organisms → Viruses | 849 | Open in IMG/M |
| 3300009504|Ga0114946_10419139 | Not Available | 692 | Open in IMG/M |
| 3300009504|Ga0114946_10539071 | All Organisms → Viruses | 594 | Open in IMG/M |
| 3300010296|Ga0129348_1173286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 740 | Open in IMG/M |
| 3300010318|Ga0136656_1165664 | Not Available | 751 | Open in IMG/M |
| 3300011116|Ga0151516_10318 | Not Available | 25845 | Open in IMG/M |
| 3300012012|Ga0153799_1091152 | Not Available | 544 | Open in IMG/M |
| 3300013004|Ga0164293_10133074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1868 | Open in IMG/M |
| 3300013005|Ga0164292_10693919 | Not Available | 650 | Open in IMG/M |
| 3300013010|Ga0129327_10423500 | All Organisms → Viruses | 710 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10920834 | Not Available | 535 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10377747 | Not Available | 923 | Open in IMG/M |
| 3300013372|Ga0177922_10870327 | Not Available | 567 | Open in IMG/M |
| 3300013372|Ga0177922_11224867 | All Organisms → Viruses | 605 | Open in IMG/M |
| 3300017788|Ga0169931_10049142 | Not Available | 4573 | Open in IMG/M |
| 3300018682|Ga0188851_1012775 | Not Available | 1079 | Open in IMG/M |
| 3300018682|Ga0188851_1019484 | Not Available | 813 | Open in IMG/M |
| 3300018682|Ga0188851_1030221 | Not Available | 599 | Open in IMG/M |
| 3300018682|Ga0188851_1033737 | Not Available | 555 | Open in IMG/M |
| 3300018682|Ga0188851_1035276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 538 | Open in IMG/M |
| 3300018682|Ga0188851_1036880 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300019122|Ga0188839_1007806 | Not Available | 1326 | Open in IMG/M |
| 3300019122|Ga0188839_1014624 | Not Available | 862 | Open in IMG/M |
| 3300020074|Ga0194113_10498909 | Not Available | 875 | Open in IMG/M |
| 3300020074|Ga0194113_10684733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 713 | Open in IMG/M |
| 3300020084|Ga0194110_10192382 | All Organisms → Viruses | 1549 | Open in IMG/M |
| 3300020141|Ga0211732_1505157 | All Organisms → Viruses | 1369 | Open in IMG/M |
| 3300020141|Ga0211732_1569792 | All Organisms → Viruses | 5289 | Open in IMG/M |
| 3300020162|Ga0211735_11221366 | All Organisms → Viruses | 731 | Open in IMG/M |
| 3300020179|Ga0194134_10004446 | All Organisms → Viruses | 14029 | Open in IMG/M |
| 3300020179|Ga0194134_10213609 | Not Available | 818 | Open in IMG/M |
| 3300020183|Ga0194115_10008499 | Not Available | 9922 | Open in IMG/M |
| 3300020183|Ga0194115_10032399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3651 | Open in IMG/M |
| 3300020190|Ga0194118_10009966 | Not Available | 8496 | Open in IMG/M |
| 3300020196|Ga0194124_10024901 | All Organisms → cellular organisms → Bacteria | 4143 | Open in IMG/M |
| 3300020197|Ga0194128_10209910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 1038 | Open in IMG/M |
| 3300020204|Ga0194116_10018018 | All Organisms → Viruses | 6131 | Open in IMG/M |
| 3300020204|Ga0194116_10375861 | All Organisms → Viruses | 713 | Open in IMG/M |
| 3300020205|Ga0211731_10947785 | Not Available | 4344 | Open in IMG/M |
| 3300020205|Ga0211731_11593522 | Not Available | 1092 | Open in IMG/M |
| 3300020222|Ga0194125_10307706 | All Organisms → Viruses | 1046 | Open in IMG/M |
| 3300020578|Ga0194129_10171525 | All Organisms → Viruses | 1359 | Open in IMG/M |
| 3300021092|Ga0194122_10226159 | Not Available | 978 | Open in IMG/M |
| 3300021425|Ga0213866_10002354 | Not Available | 13385 | Open in IMG/M |
| 3300021425|Ga0213866_10007812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 6720 | Open in IMG/M |
| 3300021961|Ga0222714_10666364 | Not Available | 512 | Open in IMG/M |
| 3300021963|Ga0222712_10178056 | All Organisms → Viruses | 1411 | Open in IMG/M |
| 3300021964|Ga0222719_10260574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1147 | Open in IMG/M |
| 3300021964|Ga0222719_10455144 | All Organisms → Viruses | 781 | Open in IMG/M |
| 3300022167|Ga0212020_1071022 | Not Available | 587 | Open in IMG/M |
| 3300022407|Ga0181351_1017563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3004 | Open in IMG/M |
| 3300023174|Ga0214921_10171576 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 1419 | Open in IMG/M |
| 3300024262|Ga0210003_1012530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5660 | Open in IMG/M |
| 3300024262|Ga0210003_1116250 | All Organisms → Viruses | 1192 | Open in IMG/M |
| 3300024343|Ga0244777_10021677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4066 | Open in IMG/M |
| 3300024343|Ga0244777_10558516 | Not Available | 697 | Open in IMG/M |
| 3300024346|Ga0244775_10000792 | Not Available | 38385 | Open in IMG/M |
| 3300024346|Ga0244775_10000808 | Not Available | 38115 | Open in IMG/M |
| 3300025135|Ga0209498_1024919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 3012 | Open in IMG/M |
| 3300025135|Ga0209498_1065354 | Not Available | 1584 | Open in IMG/M |
| 3300025543|Ga0208303_1029890 | All Organisms → Viruses | 1457 | Open in IMG/M |
| 3300025646|Ga0208161_1000857 | Not Available | 16931 | Open in IMG/M |
| 3300025674|Ga0208162_1066559 | All Organisms → Viruses | 1153 | Open in IMG/M |
| 3300025674|Ga0208162_1082781 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300025687|Ga0208019_1031499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1973 | Open in IMG/M |
| 3300025769|Ga0208767_1256327 | Not Available | 542 | Open in IMG/M |
| 3300025889|Ga0208644_1003645 | All Organisms → Viruses | 11845 | Open in IMG/M |
| 3300025889|Ga0208644_1113666 | Not Available | 1306 | Open in IMG/M |
| 3300026931|Ga0209850_1000890 | All Organisms → Viruses | 2845 | Open in IMG/M |
| 3300027205|Ga0208926_1000259 | Not Available | 10094 | Open in IMG/M |
| 3300027205|Ga0208926_1025364 | All Organisms → Viruses | 892 | Open in IMG/M |
| 3300027205|Ga0208926_1042404 | Not Available | 678 | Open in IMG/M |
| 3300027210|Ga0208802_1016186 | Not Available | 1021 | Open in IMG/M |
| 3300027213|Ga0208555_1004917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2045 | Open in IMG/M |
| 3300027393|Ga0209867_1031857 | Not Available | 771 | Open in IMG/M |
| 3300027486|Ga0255086_1047393 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027571|Ga0208897_1043442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1209 | Open in IMG/M |
| 3300027608|Ga0208974_1000477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16511 | Open in IMG/M |
| 3300027683|Ga0209392_1091149 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300027693|Ga0209704_1041397 | All Organisms → Viruses | 1245 | Open in IMG/M |
| 3300027720|Ga0209617_10003697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7161 | Open in IMG/M |
| 3300027797|Ga0209107_10006536 | All Organisms → Viruses | 6547 | Open in IMG/M |
| 3300027797|Ga0209107_10132811 | All Organisms → Viruses | 1292 | Open in IMG/M |
| 3300027805|Ga0209229_10017663 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
| 3300031539|Ga0307380_10809996 | Not Available | 773 | Open in IMG/M |
| 3300031539|Ga0307380_10992486 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031539|Ga0307380_11023899 | Not Available | 657 | Open in IMG/M |
| 3300031539|Ga0307380_11055098 | All Organisms → Viruses | 643 | Open in IMG/M |
| 3300031539|Ga0307380_11069802 | Not Available | 637 | Open in IMG/M |
| 3300031539|Ga0307380_11137389 | Not Available | 611 | Open in IMG/M |
| 3300031539|Ga0307380_11301954 | Not Available | 555 | Open in IMG/M |
| 3300031539|Ga0307380_11305122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 554 | Open in IMG/M |
| 3300031565|Ga0307379_10164157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2317 | Open in IMG/M |
| 3300031565|Ga0307379_10828336 | Not Available | 811 | Open in IMG/M |
| 3300031565|Ga0307379_10933311 | Not Available | 747 | Open in IMG/M |
| 3300031565|Ga0307379_11213423 | Not Available | 624 | Open in IMG/M |
| 3300031565|Ga0307379_11254966 | Not Available | 610 | Open in IMG/M |
| 3300031566|Ga0307378_10730161 | Not Available | 846 | Open in IMG/M |
| 3300031578|Ga0307376_10430667 | Not Available | 863 | Open in IMG/M |
| 3300031578|Ga0307376_10512603 | Not Available | 774 | Open in IMG/M |
| 3300031669|Ga0307375_10727501 | Not Available | 569 | Open in IMG/M |
| 3300031669|Ga0307375_10759797 | Not Available | 552 | Open in IMG/M |
| 3300031673|Ga0307377_10173104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1696 | Open in IMG/M |
| 3300031673|Ga0307377_10219770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1470 | Open in IMG/M |
| 3300031673|Ga0307377_10504796 | Not Available | 880 | Open in IMG/M |
| 3300031673|Ga0307377_10831945 | Not Available | 636 | Open in IMG/M |
| 3300031707|Ga0315291_10550674 | Not Available | 1058 | Open in IMG/M |
| 3300031707|Ga0315291_10598714 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300031707|Ga0315291_10701733 | Not Available | 898 | Open in IMG/M |
| 3300031758|Ga0315907_10001023 | Not Available | 38421 | Open in IMG/M |
| 3300031787|Ga0315900_10557209 | All Organisms → Viruses | 851 | Open in IMG/M |
| 3300031857|Ga0315909_10447418 | Not Available | 909 | Open in IMG/M |
| 3300031857|Ga0315909_10806505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300031873|Ga0315297_10686476 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031885|Ga0315285_10543492 | Not Available | 785 | Open in IMG/M |
| 3300031951|Ga0315904_10014175 | All Organisms → cellular organisms → Bacteria | 9931 | Open in IMG/M |
| 3300031951|Ga0315904_10255350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1676 | Open in IMG/M |
| 3300031952|Ga0315294_11294368 | Not Available | 584 | Open in IMG/M |
| 3300031999|Ga0315274_11086521 | Not Available | 807 | Open in IMG/M |
| 3300032050|Ga0315906_10339663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1334 | Open in IMG/M |
| 3300032053|Ga0315284_10089761 | All Organisms → cellular organisms → Bacteria | 4134 | Open in IMG/M |
| 3300032053|Ga0315284_11076289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 897 | Open in IMG/M |
| 3300032143|Ga0315292_10000261 | Not Available | 23075 | Open in IMG/M |
| 3300032156|Ga0315295_10965801 | Not Available | 847 | Open in IMG/M |
| 3300032164|Ga0315283_11600603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 663 | Open in IMG/M |
| 3300032342|Ga0315286_11484763 | All Organisms → Viruses | 650 | Open in IMG/M |
| 3300033233|Ga0334722_10071834 | Not Available | 2673 | Open in IMG/M |
| 3300033233|Ga0334722_11060900 | All Organisms → Viruses | 569 | Open in IMG/M |
| 3300033816|Ga0334980_0000106 | Not Available | 39941 | Open in IMG/M |
| 3300033978|Ga0334977_0137023 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300033980|Ga0334981_0305862 | Not Available | 703 | Open in IMG/M |
| 3300033996|Ga0334979_0074656 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300033996|Ga0334979_0373480 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300034019|Ga0334998_0046266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3055 | Open in IMG/M |
| 3300034066|Ga0335019_0036066 | All Organisms → cellular organisms → Bacteria | 3408 | Open in IMG/M |
| 3300034071|Ga0335028_0167650 | Not Available | 1384 | Open in IMG/M |
| 3300034103|Ga0335030_0432475 | Not Available | 846 | Open in IMG/M |
| 3300034118|Ga0335053_0238874 | Not Available | 1172 | Open in IMG/M |
| 3300034283|Ga0335007_0414037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 838 | Open in IMG/M |
| 3300034374|Ga0348335_085386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1048 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 13.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.60% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 10.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.07% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.15% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.69% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.23% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 3.23% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.84% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.84% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.38% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.38% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.92% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.92% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.92% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.92% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.46% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.46% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.46% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.46% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.46% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300005990 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_30-Apr-14 | Environmental | Open in IMG/M |
| 3300006007 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100235488 | 3300000117 | Marine | MIANPWINRITVLVVMVAIYAAGYAGGRDNAVQSFNNHPACNTNLKP* |
| JGI12421J11937_100068555 | 3300000756 | Freshwater And Sediment | MISNPWVNRITALVTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP* |
| JGI12421J11937_101558853 | 3300000756 | Freshwater And Sediment | MITNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACHTNLKP* |
| GOS2229_10289852 | 3300001963 | Marine | MTNRILVLVLLAATYAIGYSSGRDNAVQAFNNHPACNTNLKP* |
| Ga0069718_1601145425 | 3300004481 | Sediment | MITNPWINRISALLLLCVIYAAGYSGGRDQAVQAYHNHPACNTNLKP* |
| Ga0069718_1615376814 | 3300004481 | Sediment | MITNPWVNRISALLLLAVIYAAGYSGGRDATTLAHHDHPACHPNLKP* |
| Ga0049080_102605472 | 3300005582 | Freshwater Lentic | MISNPWVNRITALVTLLAIYAAGYAGGRDQAVQAHHQHPACNTNLKP* |
| Ga0079957_10304808 | 3300005805 | Lake | MITNLWINRIFALTTLAAIYAAGYAGGRDAAVQAHNDHPACHAPLKP* |
| Ga0070743_100026781 | 3300005941 | Estuarine | MVTNPWVNRITALVVLAAIYAAGYAGGKDAAIQAHQNHPACHSNLKP* |
| Ga0073922_10030036 | 3300005955 | Sand | MISNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACNTNLKP* |
| Ga0073922_10344234 | 3300005955 | Sand | VNRITALVTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP* |
| Ga0073922_10420581 | 3300005955 | Sand | MISNPWVNRITALVVLAAIYAAGYAGGRDATAQAHHNHPACHTNLKP* |
| Ga0073921_10056323 | 3300005990 | Sand | MITNPWVNRITALVVLAAIYAAGYAGGKEAAIQAHQNHPACHGNLKP* |
| Ga0073917_10106162 | 3300006007 | Sand | MISNLWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACHTNLKP* |
| Ga0075461_100007414 | 3300006637 | Aqueous | MIANPWINRITVLVVMVAIYAAGYAGGRDQAILAHQQQLTCVK* |
| Ga0075461_101277522 | 3300006637 | Aqueous | MTHSPWLSRAAALVTLLCVYAAGYAGGKDQAIQAHHNHPACHTNLKP* |
| Ga0070749_100028385 | 3300006802 | Aqueous | MIGNPWINRITVLVVMFAIYAAGYAGGRDQATLAHHQHPACNTNLKP* |
| Ga0070749_103238362 | 3300006802 | Aqueous | MITNHWINRITALVTLAAIYAAGYAGGRDAAVQAHHDHPACHAPLKP* |
| Ga0070754_100729645 | 3300006810 | Aqueous | MIANPWINRITVLVVMVAIYAAGYAGGRDQAILAQQQQLTCVK* |
| Ga0070746_104746211 | 3300006919 | Aqueous | MIANPWINRITVLVVMVAIYAAGYAGGRDQAILAQQ |
| Ga0070745_101728215 | 3300007344 | Aqueous | WINRITALVTLAAIYAAGYAGGRDAAVQAHHDHPACHAPLKP* |
| Ga0070753_10262717 | 3300007346 | Aqueous | MITNPWINRIFALTTLAAIYAAGYAGGRDAAVQAHNDHPACHAPLKP* |
| Ga0099849_10846293 | 3300007539 | Aqueous | MTNRILVLVLLVATYAIGYASGRDNAVQAFNNHPACNTNLKP* |
| Ga0099849_12213601 | 3300007539 | Aqueous | MISNPWINRITVLVVMVAIYAAGYAGGRDQAILAQQQQLTCVK* |
| Ga0099847_11416922 | 3300007540 | Aqueous | MIANPWINRITVLVVMIAIYAAGYAGGRDQAILAQQQQLTCVK* |
| Ga0099846_12369943 | 3300007542 | Aqueous | CIMIANPWINRITVLVVMVAIYAAGYAGGRDQAILAQQQQLTCVK* |
| Ga0102861_100016017 | 3300007544 | Estuarine | MITNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACNTNLKP* |
| Ga0102861_10014988 | 3300007544 | Estuarine | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAHYNHPACNTNLKP* |
| Ga0102861_10397492 | 3300007544 | Estuarine | MISNLWVNRITALVVLAAIYAAGYAGGRDQSILAHHQHPACNTNLKP* |
| Ga0102861_11492871 | 3300007544 | Estuarine | TNPWINRITVLVVMFAVYAAGYAGGRDQATLAHHQHPACHTNLKP* |
| Ga0102873_10616383 | 3300007545 | Estuarine | MISNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACHTNLKP* |
| Ga0102820_11198333 | 3300007554 | Estuarine | LHRFTFMVTNPWVNRITALVVLAAIYAAGYAGGKDAAIQAHQNHPACHSNLKP* |
| Ga0102828_10341781 | 3300007559 | Estuarine | NLWVNRITALVVLAAIYAAGYAGGRDQSILAHHQHPACNTNLKP* |
| Ga0102913_12411712 | 3300007560 | Estuarine | MITNPWVNRITALVTLLAIYAAGYAGGRDQATLAHQNHPACHSNLKP* |
| Ga0102913_13048181 | 3300007560 | Estuarine | RMISNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACHTNLKP* |
| Ga0102916_11536473 | 3300007585 | Estuarine | MITNPWVNRITALVTLLAIYAAGYAGGRDQATLAHQNHPACH |
| Ga0102918_10503663 | 3300007593 | Estuarine | MITNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACHTNLKP* |
| Ga0102921_11408453 | 3300007603 | Estuarine | MINNPWINRITVLVVMFAVYAAGYAGGRDQATLAHHQHPACHTNLKP* |
| Ga0102921_11435952 | 3300007603 | Estuarine | MITNPWVNRITALVVLAAIYAAGYAGGRDQATLAHNQHPACHSNLKP* |
| Ga0102863_11387453 | 3300007622 | Estuarine | MISNPWVNRITALVTLLAIYAAGYAGGRDATVQAHHQHPACHTNLKP* |
| Ga0102863_12324913 | 3300007622 | Estuarine | MITNPWVNRITALVVLAAIYAAGYAGGRDQSILAHHQHPACNTNLKP* |
| Ga0070751_10494565 | 3300007640 | Aqueous | MITNPWINRITALVTLAAIYAAGYAGGRDAAVQAHHDHPACHAPLKP* |
| Ga0102876_11854631 | 3300007642 | Estuarine | SGACIMITNPWVNRITALVTLLAIYAAGYAGGRDQATLAHQNHPACHSNLKP* |
| Ga0102862_11156203 | 3300007670 | Estuarine | MITNPWVNRITALVTLLAIYAGGYAGGRDATVQAHHNYPACNTNLKP* |
| Ga0105745_10528172 | 3300007972 | Estuary Water | MISNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHDHPACHTNLKP* |
| Ga0105747_10745641 | 3300007974 | Estuary Water | HPLPRPSGTRMISNPWVNRITALVTLLAIYAAGYAGGRDATVQAHHQHPACHTNLKP* |
| Ga0114341_100259527 | 3300008108 | Freshwater, Plankton | MITHPIVNRITVLVVMFAIYAAGYAGGRDQATLAHNQHPACNVNLKP* |
| Ga0114363_10082893 | 3300008266 | Freshwater, Plankton | MINNPWINRITVLVVMFAIYAAGYAGGRDQATLAHQQHPACHTNLKP* |
| Ga0114876_11284603 | 3300008448 | Freshwater Lake | MINNPWINRITVLVVMFAIYAAGYAGGRDQATLAHHQHPA |
| Ga0114880_11916892 | 3300008450 | Freshwater Lake | MITTPWINRITILVVMFAIYAAGYAGGRDQAVQAHHQHPACHTNLKP* |
| Ga0102831_11715432 | 3300008996 | Estuarine | MISNPWVNRITALVVLLAIYAAGYAGGRDATAQAHHNHPACNTNLKP* |
| Ga0102816_10423463 | 3300008999 | Estuarine | MITNPWVNRITALVVLAAIYAAGYAGGKEAAIQAHQNHPSGHGNLKP* |
| Ga0102811_13659641 | 3300009024 | Estuarine | MISNPWVNRITALVTLLAIYAAGYAGGRDQATLAHHNHPACHTNLKP* |
| Ga0102860_10317252 | 3300009056 | Estuarine | MITNPWINRITVLVVMFAVYAAGYAGGRDQATLAHHQHPACHTNLKP* |
| Ga0102860_12410483 | 3300009056 | Estuarine | MISNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACNTNLKP* |
| Ga0105090_107801802 | 3300009075 | Freshwater Sediment | MITNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACNTNLKP* |
| Ga0105090_109472823 | 3300009075 | Freshwater Sediment | MITNPWINRAAALVVLLMVYAAGHAGGKEAAALAHHNHPACHTNLKP* |
| Ga0102814_103269753 | 3300009079 | Estuarine | PRPSGTRMISNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACHTNLKP* |
| Ga0105103_102538122 | 3300009085 | Freshwater Sediment | MITNPWVNRITALVTLLAIYAAGYAGGRDQATLAHHQHPACNTNLKP* |
| Ga0105103_102589833 | 3300009085 | Freshwater Sediment | MISNPWVNRITALVVLLMIYAAGHAGGRDQAVQAHHSHPACHTNLKP* |
| Ga0105091_100604974 | 3300009146 | Freshwater Sediment | MISNPWVNRITALVVLLMIYAAGHAGGRDQAVQAHHNHPACHTNLKP* |
| Ga0105091_105250561 | 3300009146 | Freshwater Sediment | TNPWINRITALVVLAAIYAAGYAGGKDAAIQAHQNHPACHSNLKP* |
| Ga0114918_100463158 | 3300009149 | Deep Subsurface | MTNRILVLVLLAATYAIGYASGRDNAVQAQLNHPACNANLKS* |
| Ga0114918_100896424 | 3300009149 | Deep Subsurface | MTTNPWVNRISALLLLCVIYAAGYAGGRDQAILAQQQQLTCNTK* |
| Ga0114918_103703753 | 3300009149 | Deep Subsurface | MTNRILVLVLLVATYAIGYAGGRDQAVQAFNNLSACNTK* |
| Ga0114918_104008112 | 3300009149 | Deep Subsurface | MTNRILVLVLLVATYAIGYAGGRDQAVQAFTQQSTCVK* |
| Ga0114918_105128932 | 3300009149 | Deep Subsurface | MTNRILVLVLLVATYAIGYAGGREQAVQAFTQQSTCVK* |
| Ga0114918_105644122 | 3300009149 | Deep Subsurface | MVTNPWINRITVLVVMFAIYAAGYAGGRDQATLRFNHSACNTNLKP* |
| Ga0114968_100963453 | 3300009155 | Freshwater Lake | MVTNPWINRIAVLAMMFAIYAVGYVDGRDNAVQAYHNHPACNTNLKP* |
| Ga0105102_103832901 | 3300009165 | Freshwater Sediment | SGTRMISNPWVNRITALVVLLMIYAAGHAGGRDQAVQAHHSHPACHTNLKP* |
| Ga0105104_102981693 | 3300009168 | Freshwater Sediment | MITNPWISRITALVTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP* |
| Ga0105096_100715381 | 3300009170 | Freshwater Sediment | MITNPWINRAAALVVLLMVYAAGHAGGKEAAALAHHNHP |
| Ga0127402_10234791 | 3300009451 | Meromictic Pond | VLLAATYAIGYASGRDNAVQAQLNHPACNANLKP* |
| Ga0127401_100107716 | 3300009469 | Meromictic Pond | MTNRILVLVLLAATYAIGYASGRDNAVQAQLNHPACNANLKP* |
| Ga0126447_10313731 | 3300009470 | Meromictic Pond | CGACIMTNRICVLVLLVATYAIGYAGGRDQAVQAFTQQSTCVK* |
| Ga0114946_100299074 | 3300009504 | Sediment | MITNPWINRIAALVMLVCIYYAGYAGGRDQATLTYQQQAACNLNLKP* |
| Ga0114946_100918793 | 3300009504 | Sediment | MITNPWVNRITALVMLLAVYAAGYAGGRDQATLAHHNHPACHTNLKP* |
| Ga0114946_102990323 | 3300009504 | Sediment | MITNPWVNRITALVMLLAVYAAGYAGGRDQAILAQQQQLTCNTK* |
| Ga0114946_104191393 | 3300009504 | Sediment | MITNPWINRAAALVTLLMVYAAGYAGGRDQAVQAHHQQQHACNTK* |
| Ga0114946_105390711 | 3300009504 | Sediment | RITALVMLLAVYAAGYAGGRDQAIYAHHNHPACNINREP* |
| Ga0129348_11732862 | 3300010296 | Freshwater To Marine Saline Gradient | MINNPWLNRAAVLATLLMVYAAGYAGGKDQAIQAHHNHPACHANLKP* |
| Ga0136656_11656643 | 3300010318 | Freshwater To Marine Saline Gradient | MIANPWINRITVLVVMVAIYAAGYAGGRDQTILAQQQQLTCVK* |
| Ga0151516_1031827 | 3300011116 | Freshwater | MIRNPWINRIGVLVLLFAVYTAGRVDGRDQATFAHSCHVK* |
| Ga0153799_10911522 | 3300012012 | Freshwater | MITNPWINRISALLLLAVIYAAGYSGGRDAATLAHHDHPACHPNLKP* |
| Ga0164293_101330743 | 3300013004 | Freshwater | MVTNPWVNRITALVTLAAIYAAGYAGGRDQATMAHQQQQHACQIK* |
| Ga0164292_106939192 | 3300013005 | Freshwater | MTNRICVLVLLAAMYAIGYSGGRDQAVQAYNNHPACNTNVRP* |
| Ga0129327_104235003 | 3300013010 | Freshwater To Marine Saline Gradient | MVINPWINRITALVMLAAIYAAGYAGGRDQAILAQQQQLTCVK* |
| (restricted) Ga0172364_109208342 | 3300013129 | Sediment | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLKP* |
| (restricted) Ga0172363_103777474 | 3300013130 | Sediment | MITNPWINRITVLVVMFAVYAAGYAGGRDQAVQAYNNHPACNTNLKP* |
| Ga0177922_108703271 | 3300013372 | Freshwater | ALVVLLAIYAAGYAGGRDAATMARLNHPACHGNLKP* |
| Ga0177922_112248673 | 3300013372 | Freshwater | VTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP* |
| Ga0169931_100491426 | 3300017788 | Freshwater | MITNPWINRITVLVVMFAVYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0188851_10127752 | 3300018682 | Freshwater Lake | MVTNPWVNRITALVVLAAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0188851_10194844 | 3300018682 | Freshwater Lake | WVNRITVLVVMFAIYAAGYAGGRDNAVQAHHNHPACNTNLKP |
| Ga0188851_10302212 | 3300018682 | Freshwater Lake | MITNPWVNRITALVVLLAIYAAGYAGGRDQATLRFNHSACNTNLKP |
| Ga0188851_10337372 | 3300018682 | Freshwater Lake | MKTTKFPTMINNPWVNRITVLVVMSAIYAAGYAGGRDQAVQAYNNHPACNTNLRP |
| Ga0188851_10352761 | 3300018682 | Freshwater Lake | PLTLMVTNPWVNRITVLVVLAAIYAAGYAGGRDAATMARLNHPACHGNLKP |
| Ga0188851_10368802 | 3300018682 | Freshwater Lake | MVTNPWINRITVLVVMFAIYAAGSASGRDAAVQAHNNHPACNTNLK |
| Ga0188839_10078062 | 3300019122 | Freshwater Lake | MITNPWINRITVLVVMFAIYAAGYAGGRDQATLRFNHPACNTNLKP |
| Ga0188839_10146243 | 3300019122 | Freshwater Lake | MITNPWVNRITALVVLLAIYAAGYAGGRDQATLAHHNHPACNTNLKP |
| Ga0194113_104989091 | 3300020074 | Freshwater Lake | VTQPVITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACN |
| Ga0194113_106847333 | 3300020074 | Freshwater Lake | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0194110_101923824 | 3300020084 | Freshwater Lake | VITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACHTNLKP |
| Ga0211732_15051573 | 3300020141 | Freshwater | MTNRITVLVLLIAMYAIGYSGGRDQAVQAHHNHPACNTNLKP |
| Ga0211732_15697923 | 3300020141 | Freshwater | MITNPWVNRITALVVLAAIYAAGYAGGRDQATLAHNQHPACHSNLKP |
| Ga0211735_112213663 | 3300020162 | Freshwater | MISNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACHTNLKP |
| Ga0194134_1000444616 | 3300020179 | Freshwater Lake | MITNPWINRISCLVVLIAIYAAGYAGGRDQAELRFQQHPAAHLPLKP |
| Ga0194134_102136093 | 3300020179 | Freshwater Lake | VITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0194115_1000849914 | 3300020183 | Freshwater Lake | VTQPVITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTN |
| Ga0194115_100323998 | 3300020183 | Freshwater Lake | MITNPWINRITVLVVMFAIYAAGYAGGRDQTVQAYHNHPACNTNLKP |
| Ga0194118_100099667 | 3300020190 | Freshwater Lake | VTQPVITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0194124_100249011 | 3300020196 | Freshwater Lake | VITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYN |
| Ga0194128_102099101 | 3300020197 | Freshwater Lake | RITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0194116_100180181 | 3300020204 | Freshwater Lake | ITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0194116_103758612 | 3300020204 | Freshwater Lake | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYHNHPACNTNLKP |
| Ga0211731_1094778514 | 3300020205 | Freshwater | MITNPFVNRITALVVLLAVYAAGYAGGRDQATLAHNQHPACHSNLKP |
| Ga0211731_115935224 | 3300020205 | Freshwater | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAHHNHPACNTNLKP |
| Ga0194125_103077061 | 3300020222 | Freshwater Lake | RITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACHTNLKP |
| Ga0194129_101715251 | 3300020578 | Freshwater Lake | QPVITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0194122_102261591 | 3300021092 | Freshwater Lake | VITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLK |
| Ga0213866_1000235418 | 3300021425 | Seawater | MTNRILVLVLLAATYAIGYSSGRDNAVQAFNNHPACNTNLKP |
| Ga0213866_100078122 | 3300021425 | Seawater | MIANPWINRITVLVVMVAIYAAGYAGGRDQAVQAFNNLSACNTK |
| Ga0222714_106663643 | 3300021961 | Estuarine Water | MINNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACHTNLKP |
| Ga0222712_101780563 | 3300021963 | Estuarine Water | MISNPWVNRITALVTLLAIYAAGYAGGRDQATLAHHQHPACHTNLKP |
| Ga0222719_102605745 | 3300021964 | Estuarine Water | MVINPWINRITVLVVMIAIYAAGYAGGRDQAILAQQQQLTCVK |
| Ga0222719_104551443 | 3300021964 | Estuarine Water | MIANPWINRITVLVVMVAIYAAGYAGGRDQAILAQQQQLTCNTK |
| Ga0212020_10710221 | 3300022167 | Aqueous | MIANPWINRITVLVVMVAIYAAGYAGGRDNAVQSFNNHPACNTNLKP |
| Ga0181351_10175634 | 3300022407 | Freshwater Lake | MITNPWINRITVLVVMFAIYAAGYAGGRDAATMAHHQHPDCNTNLKP |
| Ga0214921_101715764 | 3300023174 | Freshwater | MVTNPWINRIAVLAMMFAIYAVGYVDGRDNAVQAYHNHPACNTNLKP |
| Ga0210003_10125305 | 3300024262 | Deep Subsurface | MTNRILVLVLLVATYAIGYAGGREQAVQAFTQQSTCVK |
| Ga0210003_11162501 | 3300024262 | Deep Subsurface | MTTNPWVNRISALLLLCVIYAAGYAGGRDQAILAQQQQLTCNTK |
| Ga0244777_100216779 | 3300024343 | Estuarine | MISNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACHTNLKP |
| Ga0244777_105585162 | 3300024343 | Estuarine | MITNPWVNRITALVTLLAIYAAGYAGGRDQATLAHQNHPACHSNLKP |
| Ga0244775_1000079233 | 3300024346 | Estuarine | MVTNPWVNRITALVVLAAIYAAGYAGGKDAAIQAHQNHPACHSNLKP |
| Ga0244775_1000080812 | 3300024346 | Estuarine | MITNPWVNRITALVVLAAIYAAGYAGGKEAAIQAHQNHPACHGNLKP |
| Ga0209498_10249194 | 3300025135 | Sediment | MVINPWINRAAVLVTLLMVYAAGYAGGRDQAVQAHHQQQHACNTK |
| Ga0209498_10653545 | 3300025135 | Sediment | MITNPWVNRAAVLVTLLMVYAAGYAGGRDQAVQAHYQQQHACNTK |
| Ga0208303_10298903 | 3300025543 | Aqueous | MIANPWINRITVLVVMVAIYAAGYAGGRDQAILAHQQQLTCVK |
| Ga0208161_100085717 | 3300025646 | Aqueous | MIANPWINRITVLVVMVAIYAAGYAGGRDQAILAQQQQLTCVK |
| Ga0208162_10665593 | 3300025674 | Aqueous | MISNPWINRITVLVVMVAIYAAGYAGGRDQAILAQQQQLTCVK |
| Ga0208162_10827812 | 3300025674 | Aqueous | MINNPWLNRAAVLATLLMVYAAGYAGGKDQAIQAHHNHPACHANLKP |
| Ga0208019_10314998 | 3300025687 | Aqueous | ILVLVLLVATYAIGYASGRDNAVQAFNNHPACNTNLKP |
| Ga0208767_12563273 | 3300025769 | Aqueous | MIANPWINRITVLVVMVAIYAAGYAGGRDQAILAQQQQLTC |
| Ga0208644_100364521 | 3300025889 | Aqueous | MIGNPWINRITVLVVMFAIYAAGYAGGRDQATLAHHQHPACNTNLKP |
| Ga0208644_11136664 | 3300025889 | Aqueous | MTHSPWLSRAAALVTLLCVYAAGYAGGKDQAIQAHHNHPACHTNLKP |
| Ga0209850_10008904 | 3300026931 | Sand | MISNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACNTNLKP |
| Ga0208926_10002593 | 3300027205 | Estuarine | MITNPWVNRITALVVLAAIYAAGYAGGRDQATLAHHNHPACNTNLKP |
| Ga0208926_10253642 | 3300027205 | Estuarine | MISNLWVNRITALVVLAAIYAAGYAGGRDQSILAHHQHPACNTNLKP |
| Ga0208926_10424041 | 3300027205 | Estuarine | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAHYNHPACNTNLKP |
| Ga0208802_10161863 | 3300027210 | Estuarine | MITNPWVNRITALVTLLAIYAGGYAGGRDATVQAHHNYPACNTNLKP |
| Ga0208555_10049172 | 3300027213 | Estuarine | MITNPWINRITVLVVMFAVYAAGYAGGRDQATLAHHQHPACHTNLKP |
| Ga0209867_10318573 | 3300027393 | Sand | MISNPWVNRITALVTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP |
| Ga0255086_10473932 | 3300027486 | Freshwater | MINNPWINRITVLVVMFAVYAAGYAGGRDQATLAHHQHPACHTNLKP |
| Ga0208897_10434421 | 3300027571 | Estuarine | LHRFTFMVTNPWVNRITALVVLAAIYAAGYAGGKDAAIQAHQNHPACHSNLKP |
| Ga0208974_100047721 | 3300027608 | Freshwater Lentic | MISNPWVNRITALVTLLAIYAAGYAGGRDQAVQAHHQHPACNTNLKP |
| Ga0209392_10911493 | 3300027683 | Freshwater Sediment | MISNPWVNRITALVVLLMIYAAGHAGGRDQAVQAHHSHPACHTNLKP |
| Ga0209704_10413973 | 3300027693 | Freshwater Sediment | MISNPWVNRITALVVLLMIYAAGHAGGRDQAVQAHHNHPACHTNLKP |
| Ga0209617_100036977 | 3300027720 | Freshwater And Sediment | MISNPWVNRITALVTLLAIYAAGYAGGRDATVQAHHSHPACHTNLKP |
| Ga0209107_1000653621 | 3300027797 | Freshwater And Sediment | MITNPWVNRITALVTLLAIYAAGYAGGKEAAIQAHQNHPACHNNLKP |
| Ga0209107_101328112 | 3300027797 | Freshwater And Sediment | MITNPWVNRITALVTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP |
| Ga0209229_100176636 | 3300027805 | Freshwater And Sediment | MITNPWINRISSLVLLAAVYAAGYAGGRDQAVQAHHNHPACHQNLKP |
| Ga0307380_108099962 | 3300031539 | Soil | MVTNPWVNRITVLVVMFAIYAAGYAGGRDNAVQAHHNHPACNTNLKP |
| Ga0307380_109924862 | 3300031539 | Soil | MVTNPWINRITVVVVMFAIYAAGYAGGRDQATLRFNHSACNTNLKP |
| Ga0307380_110238992 | 3300031539 | Soil | MTNRILVLVLLAATYAIGYASGRDNAVQAQLNHPACNANLKP |
| Ga0307380_110550982 | 3300031539 | Soil | MITNPWINRITVLVVMFAIYAAGYAGGRDNAVQAHHNHPACNTNLKP |
| Ga0307380_110698022 | 3300031539 | Soil | MVTNPWINRITALVVLLAIYAAGYAGGRDAATMARLNHPACHGNLKP |
| Ga0307380_111373892 | 3300031539 | Soil | MVTNPWINRITVLVVMFAIYAAGYAGGRDQATLRFNHPACN |
| Ga0307380_113019542 | 3300031539 | Soil | MTNRICVLVLLVATYAIGYAGGRDQAVQAFTQQSTCVK |
| Ga0307380_113051221 | 3300031539 | Soil | NPRTMITNPWINRITVLVVMFAIYAAGYAGGRDQATLRFNHSACNTNLKP |
| Ga0307379_101641573 | 3300031565 | Soil | MITNPWVNRITVLVVMFAIYAAGSASGRDAAVQAHHNHPACNTNLKP |
| Ga0307379_108283361 | 3300031565 | Soil | MVTNPWVNRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACN |
| Ga0307379_109333113 | 3300031565 | Soil | MVTNPWINRITVLVVMFAIYAAGYAGGRDQATLRFNHSACNTNLKP |
| Ga0307379_112134231 | 3300031565 | Soil | MITNPWINRITVLVVMFAIYAAGSASGRDAAVQAHHNHPACNTNLKP |
| Ga0307379_112549663 | 3300031565 | Soil | TVLVVMFVIYAAGYAGGRDNAIQAHHNHPACNTNLKP |
| Ga0307378_107301613 | 3300031566 | Soil | MITNPWINRITAVVVLLAVYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0307376_104306673 | 3300031578 | Soil | MINNPWVNRVTAVVVLLAVYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0307376_105126031 | 3300031578 | Soil | GMHSMDNPWINRITVLVVMFAIYAAGHAGGRDAAVQAHHNHPACNTNLKP |
| Ga0307375_107275011 | 3300031669 | Soil | MTNRILVLVLLAATYAIGYASGRDNAAQAQLNHPACNANLKP |
| Ga0307375_107597973 | 3300031669 | Soil | MITNPWINRITVLVVMFAIYVAGSASGRDAAVQAYNNHPACNTNLKP |
| Ga0307377_101731041 | 3300031673 | Soil | MVTNPWVNRITALVVLLAIYAAGYAGGRDQAVQAYNNHPACNTNLKP |
| Ga0307377_102197701 | 3300031673 | Soil | MVTNPWVNRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPACNTNLK |
| Ga0307377_105047964 | 3300031673 | Soil | GHFLIMVTNPWVNRITVLVVMFAIYAAGYAGGRDQAVQAYNNHPTCNTNLKP |
| Ga0307377_108319452 | 3300031673 | Soil | MDNPWINRITVLVVMFAIYAAGHAGGRDAAVQAHHNHPACNTNLKP |
| Ga0315291_105506741 | 3300031707 | Sediment | MITNPWVNRITALVTLLAIYAAGYAGGRDAATMARLNHPACHGNLKP |
| Ga0315291_105987144 | 3300031707 | Sediment | MITNPWVNRITALVVLAAIYAAGYAGGRDATVQAHHNHPACNTNLKP |
| Ga0315291_107017331 | 3300031707 | Sediment | MISNPWVNRITALVTLLAIYAAGYAGGRDATVQARLNHPACNTNLKP |
| Ga0315907_100010234 | 3300031758 | Freshwater | MITHPIVNRITVLVVMFAIYAAGYAGGRDQATLAHNQHPACNVNLKP |
| Ga0315900_105572093 | 3300031787 | Freshwater | LVVMFAIYAAGYAGGRDQATLAHHQHPACHTNLKP |
| Ga0315909_104474184 | 3300031857 | Freshwater | MITTPWINRITILVVMFAIYAAGYAGGRDQAVQAHHQHPACHTNLKP |
| Ga0315909_108065053 | 3300031857 | Freshwater | MINNPWINRITVLVVMFAIYAAGYAGGRDQATLAHQQHPACHTNLK |
| Ga0315297_106864763 | 3300031873 | Sediment | MISNPWVNRITALVVLAAIYAAGYAGGRDATVQARLNHPACNTNLKP |
| Ga0315285_105434923 | 3300031885 | Sediment | MISNPWVNRITVLVVMFAIHAAGYVGGRDATVQARLNHPACNTNLKP |
| Ga0315904_100141759 | 3300031951 | Freshwater | MINNPWINRITVLVVMFAIYAAGYAGGRDQATLAHQQHPACHTNLKP |
| Ga0315904_102553504 | 3300031951 | Freshwater | MINNPWINRITVLVVMFAIYAAGYAGGRDQATLAHHQHPACHTNLKP |
| Ga0315294_112943683 | 3300031952 | Sediment | MITSPWVNRITALVTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP |
| Ga0315274_110865212 | 3300031999 | Sediment | MISNPWVNRITVLVVMFAIHAAGYVGGRDATVQARLNHPACHTNLKP |
| Ga0315906_103396637 | 3300032050 | Freshwater | TMINNPWINRITVLVVMFAIYAAGYAGGRDQATLAHQQHPACHTNLKP |
| Ga0315284_100897612 | 3300032053 | Sediment | MVTNPWVNRITVLVVMFAIYAAGYAGGRDNAILAHHNHPACNTNLKP |
| Ga0315284_110762892 | 3300032053 | Sediment | MITNPWVNRITALVTLLAIYAAGYAGGRDAATMARLNHPACHAPLKP |
| Ga0315292_1000026136 | 3300032143 | Sediment | MGEVQPRLSPPGLSPLPLTTMITNPWVNRITALVVLAAIYAAGYAGGRDAAVQAHNDHPACHAPLKP |
| Ga0315295_109658012 | 3300032156 | Sediment | MITNPWVNRITALVTLLAIYAAGYAGGRDATVQARLNHPACNTNLKP |
| Ga0315283_116006033 | 3300032164 | Sediment | MITNPWVNRITALVVLAAIYAAGYAGGRDAAVQAHNDHPACHAPLKP |
| Ga0315286_114847631 | 3300032342 | Sediment | MITNPWVNRITALVVLAAIYAAGYAGGRDATVQARLNHPACHTNLKP |
| Ga0334722_100718348 | 3300033233 | Sediment | MVTNPWINRITALVVLLAVYAAGYAGGRDAATMARLNHPACNTNLKP |
| Ga0334722_110609003 | 3300033233 | Sediment | LSRLSGTRMITNPWVNRITALVTLLAIYAAGYAGGRDATVQAHHNHPACHTNLKP |
| Ga0334980_0000106_11829_11966 | 3300033816 | Freshwater | MVTNPWVNRITALVTLAAIYAAGYAGGRDAATMAHQQQQHACQIK |
| Ga0334977_0137023_549_692 | 3300033978 | Freshwater | MVTNPWINRVTVLVVMFAIYAAGYSGGRDQATLAHHNHPACNTNLKP |
| Ga0334981_0305862_460_603 | 3300033980 | Freshwater | MVNNPWVNRITALVLLAVIYAAGYAGGRDNAILAHHNHPACHTNLKP |
| Ga0334979_0074656_372_509 | 3300033996 | Freshwater | MVTNPWVNRITALVTLAAIYAAGYAGGRDQATMAHQQQQHACQIK |
| Ga0334979_0373480_590_718 | 3300033996 | Freshwater | MTNRICVLVLLAAMYAIGYSGGRDQAVQAYNNHPACNTNVRP |
| Ga0334998_0046266_2668_2811 | 3300034019 | Freshwater | MITNPWINRITVLVVMFAIYAAGYAGGRDQAVQAHHQHPACHTNLKP |
| Ga0335019_0036066_1_126 | 3300034066 | Freshwater | MINNPWINRITVLVVMFAVYAAGYAGGRDQATLAHHQHPACH |
| Ga0335028_0167650_582_725 | 3300034071 | Freshwater | MITNPWINRITALVTLAAIYAAGYAGGREAAVQAHNDHPACHAPLRP |
| Ga0335030_0432475_499_642 | 3300034103 | Freshwater | MITNPWINRITALVTLVAIYAIGYAGGREAAVQAHNDHPACHAPLRP |
| Ga0335053_0238874_1050_1172 | 3300034118 | Freshwater | MITNPWINRISALLLLCVIYAAGYSGGRDAAVQAHHDHPAC |
| Ga0335007_0414037_613_756 | 3300034283 | Freshwater | MITNPWINRITALVTLAAIYAAGYAGGRDAAVQAHNDHPACHAPLRP |
| Ga0348335_085386_124_267 | 3300034374 | Aqueous | MITNHWINRITALVTLAAIYAAGYAGGRDAAVQAHHDHPACHAPLKP |
| ⦗Top⦘ |