Basic Information | |
---|---|
Family ID | F021741 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 217 |
Average Sequence Length | 44 residues |
Representative Sequence | LKAALQGGDRLLIDATERAYHRSQDDAKQREHYSGKKNSIR |
Number of Associated Samples | 187 |
Number of Associated Scaffolds | 217 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 15.21 % |
% of genes near scaffold ends (potentially truncated) | 81.11 % |
% of genes from short scaffolds (< 2000 bps) | 98.16 % |
Associated GOLD sequencing projects | 172 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (45.161 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.346 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.562 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.788 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 217 Family Scaffolds |
---|---|---|
PF13359 | DDE_Tnp_4 | 69.59 |
PF13613 | HTH_Tnp_4 | 7.37 |
PF01609 | DDE_Tnp_1 | 2.30 |
PF13340 | DUF4096 | 0.92 |
PF10551 | MULE | 0.46 |
PF13586 | DDE_Tnp_1_2 | 0.46 |
PF13374 | TPR_10 | 0.46 |
PF07660 | STN | 0.46 |
PF01169 | UPF0016 | 0.46 |
PF13546 | DDE_5 | 0.46 |
PF13701 | DDE_Tnp_1_4 | 0.46 |
PF03400 | DDE_Tnp_IS1 | 0.46 |
PF00665 | rve | 0.46 |
PF14104 | DUF4277 | 0.46 |
PF05598 | DUF772 | 0.46 |
PF12762 | DDE_Tnp_IS1595 | 0.46 |
PF01850 | PIN | 0.46 |
PF04140 | ICMT | 0.46 |
COG ID | Name | Functional Category | % Frequency in 217 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.30 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.30 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.30 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.30 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.30 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.30 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.46 |
COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.46 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.46 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.46 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.46 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.10 % |
Unclassified | root | N/A | 12.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000564|RepKanNP_BrdU_F12BDRAFT_1016075 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300000754|JGI11851J11668_1004921 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300001752|JGI2173J19968_10195902 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300002908|JGI25382J43887_10398710 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300002912|JGI25386J43895_10152135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales | 577 | Open in IMG/M |
3300004148|Ga0055521_10088385 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300005171|Ga0066677_10527132 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005176|Ga0066679_10186437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1317 | Open in IMG/M |
3300005178|Ga0066688_10153462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1444 | Open in IMG/M |
3300005289|Ga0065704_10483584 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300005332|Ga0066388_107948434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 530 | Open in IMG/M |
3300005447|Ga0066689_10082528 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300005447|Ga0066689_10596976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales | 696 | Open in IMG/M |
3300005553|Ga0066695_10659488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 619 | Open in IMG/M |
3300005554|Ga0066661_10807771 | Not Available | 549 | Open in IMG/M |
3300005555|Ga0066692_10920182 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005558|Ga0066698_11048371 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 517 | Open in IMG/M |
3300005586|Ga0066691_10274215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae | 993 | Open in IMG/M |
3300005764|Ga0066903_103208722 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300005764|Ga0066903_103539291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
3300005764|Ga0066903_103941658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
3300005764|Ga0066903_107747781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales | 552 | Open in IMG/M |
3300005843|Ga0068860_102387073 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 549 | Open in IMG/M |
3300005981|Ga0081538_10125985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
3300005983|Ga0081540_1182694 | Not Available | 783 | Open in IMG/M |
3300006046|Ga0066652_101180619 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 725 | Open in IMG/M |
3300006796|Ga0066665_11023207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 632 | Open in IMG/M |
3300006797|Ga0066659_11397897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 584 | Open in IMG/M |
3300006844|Ga0075428_102244707 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 562 | Open in IMG/M |
3300006845|Ga0075421_102372938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 556 | Open in IMG/M |
3300006853|Ga0075420_100846338 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300006871|Ga0075434_101686188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 642 | Open in IMG/M |
3300006880|Ga0075429_100605940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 960 | Open in IMG/M |
3300007076|Ga0075435_101144131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. 'Orange Guaymas' | 681 | Open in IMG/M |
3300007076|Ga0075435_101865719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 528 | Open in IMG/M |
3300007258|Ga0099793_10129126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
3300009012|Ga0066710_100658634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1593 | Open in IMG/M |
3300009012|Ga0066710_103980007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300009038|Ga0099829_11413545 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 575 | Open in IMG/M |
3300009089|Ga0099828_10302705 | Not Available | 1438 | Open in IMG/M |
3300009089|Ga0099828_11938436 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 516 | Open in IMG/M |
3300009090|Ga0099827_10226466 | Not Available | 1564 | Open in IMG/M |
3300009090|Ga0099827_10375728 | Not Available | 1212 | Open in IMG/M |
3300009090|Ga0099827_11793274 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 535 | Open in IMG/M |
3300009093|Ga0105240_11634656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → unclassified Thermoflexia → Thermoflexia bacterium | 673 | Open in IMG/M |
3300009094|Ga0111539_10416131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1565 | Open in IMG/M |
3300009100|Ga0075418_12724725 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 540 | Open in IMG/M |
3300009137|Ga0066709_101668178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
3300009137|Ga0066709_104103225 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 530 | Open in IMG/M |
3300009147|Ga0114129_11655218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
3300009147|Ga0114129_13100550 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 543 | Open in IMG/M |
3300009156|Ga0111538_12144878 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 702 | Open in IMG/M |
3300009162|Ga0075423_10603865 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1156 | Open in IMG/M |
3300009610|Ga0105340_1383491 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 625 | Open in IMG/M |
3300009799|Ga0105075_1033655 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 599 | Open in IMG/M |
3300009801|Ga0105056_1038724 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 640 | Open in IMG/M |
3300009802|Ga0105073_1006917 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 939 | Open in IMG/M |
3300009807|Ga0105061_1070713 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 567 | Open in IMG/M |
3300009810|Ga0105088_1041380 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300009810|Ga0105088_1043437 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 749 | Open in IMG/M |
3300009811|Ga0105084_1070811 | Not Available | 634 | Open in IMG/M |
3300009813|Ga0105057_1047253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 702 | Open in IMG/M |
3300009815|Ga0105070_1062869 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 699 | Open in IMG/M |
3300009816|Ga0105076_1085767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
3300009817|Ga0105062_1093292 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 590 | Open in IMG/M |
3300009818|Ga0105072_1068862 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 687 | Open in IMG/M |
3300009819|Ga0105087_1020887 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300009822|Ga0105066_1068973 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 757 | Open in IMG/M |
3300009836|Ga0105068_1021302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1104 | Open in IMG/M |
3300009836|Ga0105068_1030523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 942 | Open in IMG/M |
3300010047|Ga0126382_10205406 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300010336|Ga0134071_10580865 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 584 | Open in IMG/M |
3300010359|Ga0126376_12479828 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 566 | Open in IMG/M |
3300010366|Ga0126379_10057234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3249 | Open in IMG/M |
3300010398|Ga0126383_11940169 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 677 | Open in IMG/M |
3300011119|Ga0105246_12388387 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 518 | Open in IMG/M |
3300011269|Ga0137392_11433667 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 550 | Open in IMG/M |
3300011271|Ga0137393_11288556 | Not Available | 619 | Open in IMG/M |
3300011271|Ga0137393_11413236 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 585 | Open in IMG/M |
3300011406|Ga0137454_1101160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300011423|Ga0137436_1129448 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 673 | Open in IMG/M |
3300011424|Ga0137439_1145775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 548 | Open in IMG/M |
3300012096|Ga0137389_10911490 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300012096|Ga0137389_11792868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300012168|Ga0137357_1022499 | Not Available | 1242 | Open in IMG/M |
3300012189|Ga0137388_10708838 | Not Available | 934 | Open in IMG/M |
3300012202|Ga0137363_11132400 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 665 | Open in IMG/M |
3300012204|Ga0137374_11020280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300012205|Ga0137362_11681886 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 521 | Open in IMG/M |
3300012207|Ga0137381_10319780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
3300012207|Ga0137381_10672592 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 901 | Open in IMG/M |
3300012207|Ga0137381_10689522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 888 | Open in IMG/M |
3300012209|Ga0137379_11750503 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300012210|Ga0137378_11672746 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 543 | Open in IMG/M |
3300012210|Ga0137378_11853866 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012211|Ga0137377_11743168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300012349|Ga0137387_10704557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
3300012353|Ga0137367_11010527 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 567 | Open in IMG/M |
3300012355|Ga0137369_10636957 | Not Available | 738 | Open in IMG/M |
3300012356|Ga0137371_10534620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 903 | Open in IMG/M |
3300012358|Ga0137368_10882082 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 547 | Open in IMG/M |
3300012359|Ga0137385_11260234 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 601 | Open in IMG/M |
3300012359|Ga0137385_11407913 | Not Available | 561 | Open in IMG/M |
3300012361|Ga0137360_10721614 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 856 | Open in IMG/M |
3300012362|Ga0137361_10506337 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300012362|Ga0137361_11503296 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 595 | Open in IMG/M |
3300012391|Ga0134035_1115244 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 645 | Open in IMG/M |
3300012410|Ga0134060_1516848 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 575 | Open in IMG/M |
3300012683|Ga0137398_10641379 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 736 | Open in IMG/M |
3300012917|Ga0137395_10017772 | All Organisms → cellular organisms → Bacteria | 4070 | Open in IMG/M |
3300012918|Ga0137396_11096841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
3300012922|Ga0137394_10613758 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 919 | Open in IMG/M |
3300012922|Ga0137394_11172241 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 632 | Open in IMG/M |
3300012922|Ga0137394_11523491 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012927|Ga0137416_11145022 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 699 | Open in IMG/M |
3300012929|Ga0137404_11398054 | Not Available | 646 | Open in IMG/M |
3300012929|Ga0137404_11423799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. | 640 | Open in IMG/M |
3300012930|Ga0137407_11726878 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 596 | Open in IMG/M |
3300012944|Ga0137410_10380689 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1134 | Open in IMG/M |
3300012948|Ga0126375_11515679 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 574 | Open in IMG/M |
3300013233|Ga0172420_10269585 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300014154|Ga0134075_10464453 | Not Available | 564 | Open in IMG/M |
3300014255|Ga0075320_1109878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 553 | Open in IMG/M |
3300014263|Ga0075324_1061689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
3300014267|Ga0075313_1024438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
3300014316|Ga0075339_1238773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300014864|Ga0180068_1060297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300015052|Ga0137411_1086518 | Not Available | 562 | Open in IMG/M |
3300015241|Ga0137418_10890210 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 656 | Open in IMG/M |
3300015264|Ga0137403_10255629 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1661 | Open in IMG/M |
3300015358|Ga0134089_10371411 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 606 | Open in IMG/M |
3300015373|Ga0132257_101407098 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 888 | Open in IMG/M |
3300015373|Ga0132257_101822507 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300016270|Ga0182036_11430271 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 579 | Open in IMG/M |
3300016387|Ga0182040_11503851 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 572 | Open in IMG/M |
3300016445|Ga0182038_10474194 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 1063 | Open in IMG/M |
3300017654|Ga0134069_1265845 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 600 | Open in IMG/M |
3300018031|Ga0184634_10462986 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 570 | Open in IMG/M |
3300018052|Ga0184638_1089596 | Not Available | 1128 | Open in IMG/M |
3300018053|Ga0184626_10432628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
3300018063|Ga0184637_10203391 | Not Available | 1214 | Open in IMG/M |
3300018071|Ga0184618_10285958 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300018074|Ga0184640_10410263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
3300018076|Ga0184609_10197827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
3300018078|Ga0184612_10201512 | Not Available | 1034 | Open in IMG/M |
3300018078|Ga0184612_10311556 | Not Available | 805 | Open in IMG/M |
3300018079|Ga0184627_10281041 | Not Available | 874 | Open in IMG/M |
3300018082|Ga0184639_10330917 | Not Available | 797 | Open in IMG/M |
3300018431|Ga0066655_10716834 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 678 | Open in IMG/M |
3300018466|Ga0190268_12362803 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 503 | Open in IMG/M |
3300018482|Ga0066669_12458354 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 500 | Open in IMG/M |
3300019789|Ga0137408_1034428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 855 | Open in IMG/M |
3300020003|Ga0193739_1147110 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 566 | Open in IMG/M |
3300021476|Ga0187846_10386132 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 576 | Open in IMG/M |
3300022534|Ga0224452_1233319 | Not Available | 564 | Open in IMG/M |
3300025149|Ga0209827_10098030 | Not Available | 577 | Open in IMG/M |
3300025904|Ga0207647_10419980 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 752 | Open in IMG/M |
3300025972|Ga0207668_11742076 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 562 | Open in IMG/M |
3300025984|Ga0210082_1041622 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300026297|Ga0209237_1238904 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 559 | Open in IMG/M |
3300026315|Ga0209686_1222688 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 512 | Open in IMG/M |
3300026325|Ga0209152_10446227 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 520 | Open in IMG/M |
3300026326|Ga0209801_1174173 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 889 | Open in IMG/M |
3300026335|Ga0209804_1243684 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 686 | Open in IMG/M |
3300026351|Ga0257170_1066029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300026446|Ga0257178_1050485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300026536|Ga0209058_1292744 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 560 | Open in IMG/M |
3300026552|Ga0209577_10582842 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 686 | Open in IMG/M |
3300027056|Ga0209879_1067362 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 569 | Open in IMG/M |
3300027163|Ga0209878_1046405 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 552 | Open in IMG/M |
3300027384|Ga0209854_1067346 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 628 | Open in IMG/M |
3300027502|Ga0209622_1096298 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 542 | Open in IMG/M |
3300027548|Ga0209523_1128582 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 522 | Open in IMG/M |
3300027561|Ga0209887_1003231 | All Organisms → cellular organisms → Bacteria | 4802 | Open in IMG/M |
3300027562|Ga0209735_1077329 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 721 | Open in IMG/M |
3300027655|Ga0209388_1169264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. 'Orange Guaymas' | 613 | Open in IMG/M |
3300027846|Ga0209180_10435865 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 740 | Open in IMG/M |
3300027846|Ga0209180_10789072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300027875|Ga0209283_10613731 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 688 | Open in IMG/M |
3300027875|Ga0209283_10948358 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 517 | Open in IMG/M |
3300027880|Ga0209481_10357299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
3300027882|Ga0209590_10661258 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 670 | Open in IMG/M |
3300027882|Ga0209590_10832688 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 585 | Open in IMG/M |
3300027909|Ga0209382_12322075 | Not Available | 503 | Open in IMG/M |
3300027961|Ga0209853_1035406 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300027961|Ga0209853_1088750 | Not Available | 798 | Open in IMG/M |
3300028380|Ga0268265_11897903 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 602 | Open in IMG/M |
3300028792|Ga0307504_10169416 | Not Available | 754 | Open in IMG/M |
3300030619|Ga0268386_10825801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300030903|Ga0308206_1146150 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 566 | Open in IMG/M |
3300031058|Ga0308189_10007615 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
3300031081|Ga0308185_1057282 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 511 | Open in IMG/M |
3300031094|Ga0308199_1105276 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031114|Ga0308187_10412279 | Not Available | 536 | Open in IMG/M |
3300031199|Ga0307495_10152664 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 599 | Open in IMG/M |
3300031226|Ga0307497_10100719 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300031543|Ga0318516_10568028 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 649 | Open in IMG/M |
3300031573|Ga0310915_10911730 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 615 | Open in IMG/M |
3300031763|Ga0318537_10327903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
3300031820|Ga0307473_11236136 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 556 | Open in IMG/M |
3300031910|Ga0306923_11933491 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 601 | Open in IMG/M |
3300031913|Ga0310891_10033653 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300031940|Ga0310901_10429406 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 580 | Open in IMG/M |
3300031945|Ga0310913_11051881 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 569 | Open in IMG/M |
3300031946|Ga0310910_10149112 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300031959|Ga0318530_10412586 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 560 | Open in IMG/M |
3300032001|Ga0306922_10975541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 876 | Open in IMG/M |
3300032012|Ga0310902_11303122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → unclassified Thermoflexia → Thermoflexia bacterium | 514 | Open in IMG/M |
3300032174|Ga0307470_10300109 | Not Available | 1089 | Open in IMG/M |
3300032174|Ga0307470_11104469 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 638 | Open in IMG/M |
3300032180|Ga0307471_103142435 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 585 | Open in IMG/M |
3300032205|Ga0307472_102721138 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 505 | Open in IMG/M |
3300033811|Ga0364924_171369 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 518 | Open in IMG/M |
3300033815|Ga0364946_138255 | Not Available | 559 | Open in IMG/M |
3300034149|Ga0364929_0281867 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 565 | Open in IMG/M |
3300034643|Ga0370545_039004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
3300034819|Ga0373958_0150841 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 582 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.35% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 10.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.53% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.30% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.30% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.30% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.77% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.38% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.38% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.38% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.46% |
Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 0.46% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.46% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.46% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.46% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.46% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000564 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B | Environmental | Open in IMG/M |
3300000754 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TB | Environmental | Open in IMG/M |
3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013233 | Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025984 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
RepKanNP_BrdU_F12BDRAFT_10160752 | 3300000564 | Soil | EAMKAALQGIDQVMIDATERAYRRSQDDAKQREHYSGKKNDIR* |
JGI11851J11668_10049212 | 3300000754 | Soil | PEAMKAALQGIDQVMIDATERAYRRSQDDAKQREHYSGKKNDIR* |
JGI2173J19968_101959021 | 3300001752 | Marine Sediment | QGIDRLLIDVTERLYRRPQDDQVQRAHYSGKKNATR* |
JGI25382J43887_103987103 | 3300002908 | Grasslands Soil | ALQAALQGIDHVIIDATERAYRRSQDDTKQREHYSGKKNGIC* |
JGI25386J43895_101521351 | 3300002912 | Grasslands Soil | PEDVKAALQGVDRLLIDATERAYHRSTDDATQREHDSGKKNSIR* |
Ga0055521_100883851 | 3300004148 | Natural And Restored Wetlands | MKAAFQGVDRILIDVTERLYRRSQDDDTQREHYSGKKSTTPSKTL* |
Ga0066677_105271322 | 3300005171 | Soil | LMPYRELATPEELQAALQGADRLLIDATERAYHRSQDDAKQREHDRGKKNGIR* |
Ga0066679_101864371 | 3300005176 | Soil | MSTPNALKAALKGVDQVIVDATERAYRRSQDDAKQREYYSGKKK |
Ga0066688_101534622 | 3300005178 | Soil | MSTPNALKAALKGVDQVIVDATERAYRRSQDDAKQREYYSGKKKITC* |
Ga0065704_104835842 | 3300005289 | Switchgrass Rhizosphere | MPYREFSTPDDCKAALQGIDQLIIDATARAYRRSQDEAKQREHDSGKKLGWQNQLE* |
Ga0066388_1079484342 | 3300005332 | Tropical Forest Soil | PEELKAALHGMDRVLIDVTERAYHRSTDDAKQREHYSGKKLGWQN* |
Ga0066689_100825283 | 3300005447 | Soil | DDFKAALQGIDQLIIDATERAYRRSQDEAKQREHYSGKKN* |
Ga0066689_105969762 | 3300005447 | Soil | DDFKAALQGIDQLIIDATERAYRRSQDEAKQREHYSGKKKSIR* |
Ga0066695_106594883 | 3300005553 | Soil | LQGVDRLLIDATERAYHRSTDDAKQREHYSGKKNSIR* |
Ga0066661_108077712 | 3300005554 | Soil | QGVDRLLIDATERAYHRSTDATKPRAHDSGKKHSIC* |
Ga0066692_109201822 | 3300005555 | Soil | IDQLIIDATERAYRRSKEDAKQREHYSGKKKSIR* |
Ga0066698_110483711 | 3300005558 | Soil | QGGDRLLIDATERAYHRSHDEAKQREHDSGKKNSIR* |
Ga0066691_102742153 | 3300005586 | Soil | TPEDVKAALHGVDRLLIDATERAYHRSTEHAKQREHYSGKKNSIR* |
Ga0066903_1032087223 | 3300005764 | Tropical Forest Soil | LQGGDRLLIDATERAYHRSQDEAKQREHYSGKKNSTR* |
Ga0066903_1035392911 | 3300005764 | Tropical Forest Soil | VHLDLMPYRELTTPEEWKAVLQGGDRLLIDATERADHRSQDDAKQREHDSGKKNSIR* |
Ga0066903_1039416583 | 3300005764 | Tropical Forest Soil | DDLKAALHGVDRLIIDATERAYHRSQEASKQREHYSGKKNDIR* |
Ga0066903_1077477812 | 3300005764 | Tropical Forest Soil | DFKAALHGIDQLIIDATERAYRRSQDEAKQREHYSGKKKSIR* |
Ga0068860_1023870732 | 3300005843 | Switchgrass Rhizosphere | LQAALQGGDRLLIDATERAYHRSQEEAKQCDHDSGKKNGIR* |
Ga0081538_101259851 | 3300005981 | Tabebuia Heterophylla Rhizosphere | ETPKALRKALAGGDQLIIDATERAYRRSQDAATQREYYSGKKRDIC* |
Ga0081540_11826942 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MPYRELGTPDEVKAALQGVDRLRIDATDRAYRRAQEAAKQQE* |
Ga0066652_1011806194 | 3300006046 | Soil | VDRLLIDATERAYHRSTDDATQREHYSGKKNSIR* |
Ga0066665_110232073 | 3300006796 | Soil | AALHGVDRLLIDATERAYHRSTAHAKQREHYSGKKNSIR* |
Ga0066659_113978972 | 3300006797 | Soil | KTALQCEDRLLIDATERAYHRSQDDATQREHYSGKKNSIR* |
Ga0075428_1022447071 | 3300006844 | Populus Rhizosphere | QLDLMPYRELRTPEELKAALQGEGRLLIDATERAYHRSQADAKQREHSSGKKNSIR* |
Ga0075421_1023729382 | 3300006845 | Populus Rhizosphere | LQAALQGVDRLMIDATARAYRRSQEEAKQREHYSGKKSGLG* |
Ga0075420_1008463381 | 3300006853 | Populus Rhizosphere | AALQGVDHLLIDATERAYHRSQDDAKQREHYSGEKNSIR* |
Ga0075434_1016861882 | 3300006871 | Populus Rhizosphere | LTTPEELKAALQGGDRLLIDATERAYHRSQDDAKQREHYSGKKNSTR* |
Ga0075429_1006059404 | 3300006880 | Populus Rhizosphere | ALQGVDRLIIDATERAYRRSQEDAKQREHYSGKKSGIC* |
Ga0075435_1011441311 | 3300007076 | Populus Rhizosphere | MMPYREFSTPDDCKAALHGIDQLIIDATARAYRRSQDEAKQREQYSGEKKSIR* |
Ga0075435_1018657191 | 3300007076 | Populus Rhizosphere | HGVDRLLIDATERAYHRSADDAKQREHYSGKKNSIR* |
Ga0099793_101291263 | 3300007258 | Vadose Zone Soil | ALHGVDRLIIDATERAYHRSQDEAKQREHDSGKKNSIR* |
Ga0066710_1006586343 | 3300009012 | Grasslands Soil | MAKLGSVCPPENSQPAQLKAALQGEDRLLIDATERAYHRSQDDATQREHYSGKKNSI |
Ga0066710_1039800071 | 3300009012 | Grasslands Soil | LTTPADLQGTLQGMDQVIIDATERAYRRSQGDAKQREHYSGKKNGIR |
Ga0099829_114135451 | 3300009038 | Vadose Zone Soil | TPEELKAALHGRDRLLIDATERAYHRSTDSATQREHYSGKKNSIH* |
Ga0099828_103027053 | 3300009089 | Vadose Zone Soil | MPYRELGTPDDLKAALHGVDRLIIDATERAYHRSQDDAKQREHYSG |
Ga0099828_119384362 | 3300009089 | Vadose Zone Soil | GGDRLLIDATERAYHRSQDEAKQREHYSGKKNSIR* |
Ga0099827_102264663 | 3300009090 | Vadose Zone Soil | MPPREFATPAALQAALQGVDRLLIDATERAYHRSTDDVKQREHDSGKKNGIR* |
Ga0099827_103757283 | 3300009090 | Vadose Zone Soil | AALQGVDRLLIDATERAYHRLTDDVKQREHYSGKKNSIR* |
Ga0099827_117932741 | 3300009090 | Vadose Zone Soil | DLKAALQGVDRLLIDATERAYHRSTDNATQREHYSGKKNSIR* |
Ga0105240_116346561 | 3300009093 | Corn Rhizosphere | KAALQGIDQVIIDATERAYRRSQDDAKQREHYSGKKNDIR* |
Ga0111539_104161311 | 3300009094 | Populus Rhizosphere | STPDDFKAALQGIDQLIIDATERAYRRSQDEAKQREHYSGEKKSIR* |
Ga0075418_127247251 | 3300009100 | Populus Rhizosphere | KAALQGVDRLIIDATERAYRRSQEDAKQREHYSGKKSGIC* |
Ga0066709_1016681781 | 3300009137 | Grasslands Soil | PDDFKAALQGIDQLIIDATERAYRRSQDEAKQREHYSGKKKSIR* |
Ga0066709_1041032251 | 3300009137 | Grasslands Soil | MAKLGSVCPPENSQPAQLKAALQGEDRLLIDATERAYHRSQDDATQREHYSGKKNSIR* |
Ga0114129_116552181 | 3300009147 | Populus Rhizosphere | FKAALQGIDQLIIDATERAYRRSQDEAKQREHYSGKKKSIR* |
Ga0114129_131005501 | 3300009147 | Populus Rhizosphere | VDHLLIDATERAYHRSQDDAKQREHDSGKKNGIH* |
Ga0111538_121448783 | 3300009156 | Populus Rhizosphere | DLKAALQGVDRLIIDATERAYRRSQEDAKQQEYYSGKKSGIR* |
Ga0075423_106038651 | 3300009162 | Populus Rhizosphere | MKAALQGIDQVIIDATERAYRRSQDAAKQREHYSGKKNDIR* |
Ga0105340_13834911 | 3300009610 | Soil | PDDLQAALNGLDRLIIDATERAYHRSQDDAKQREHYSGKKNSTR* |
Ga0105075_10336552 | 3300009799 | Groundwater Sand | HGVDRLIIDATERAYHRSQDDAKQREHYSGKKNSIR* |
Ga0105056_10387241 | 3300009801 | Groundwater Sand | RELGTPDDLKAALHGVDRLIIDATERAYHRSQEDAKQREHYSGKKNDIR* |
Ga0105073_10069171 | 3300009802 | Groundwater Sand | TPEELKAALRGGDRLLIDATERAYHRSQDDAKQREHDSGKKNSIR* |
Ga0105061_10707132 | 3300009807 | Groundwater Sand | EDRLLIEATERAYHRSQDDAKQREHYSGKKNSMR* |
Ga0105088_10413802 | 3300009810 | Groundwater Sand | MPYRELGTPDDVKVALNGVDRLIIDATERAYHRSQEDAKQREHSSGKKNSIR* |
Ga0105088_10434372 | 3300009810 | Groundwater Sand | VKAALKGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0105084_10708112 | 3300009811 | Groundwater Sand | GDVQAALKGVDRLLIDATERAYQRSQEDAKQREHDSGKKNSRR* |
Ga0105057_10472533 | 3300009813 | Groundwater Sand | ELKSALKGADRLIIDATERAYRRSQDDAKQREHYSGKKKSIR* |
Ga0105070_10628693 | 3300009815 | Groundwater Sand | PDDLKAALHGVDRLIIDATERAYHRSQEDAKQREHYSGKKNDIR* |
Ga0105076_10857671 | 3300009816 | Groundwater Sand | ELKSALKGADRLIIDATERAYRRSQDEAKQREHYSGKKKSIR* |
Ga0105062_10932922 | 3300009817 | Groundwater Sand | RELTTPEELKAALQGGDRLLIDATERAYHRSAEDAKQREHYSGKKNSIR* |
Ga0105072_10688621 | 3300009818 | Groundwater Sand | KAALHGVDRLIIDATERAYHRSQEDAKQREHYSGKKNDIR* |
Ga0105087_10208872 | 3300009819 | Groundwater Sand | MPYRELGTPDDVKVALNGVDRLIIDATERAYHRSQEDAKQREHDSGKKNSIR* |
Ga0105066_10689731 | 3300009822 | Groundwater Sand | PEELKAALQGGERLLIDATERAYHRSAEDAKQREHDRGKKNSIR* |
Ga0105068_10213023 | 3300009836 | Groundwater Sand | QAALQGMDRLLIDATERAYHRSTDDTKQREHYSGKKNSIR* |
Ga0105068_10305233 | 3300009836 | Groundwater Sand | EDRLLIDATERAYHRSQDDAKQREHYSGKKNSIR* |
Ga0126382_102054061 | 3300010047 | Tropical Forest Soil | LQAALQGVDRLMIDATERAYRRSQEEAKQREHYRGKKSGIC* |
Ga0134071_105808651 | 3300010336 | Grasslands Soil | EDRLLIDATERAYHRSQDDATQREHYSGKKNSRR* |
Ga0126376_124798282 | 3300010359 | Tropical Forest Soil | LKAALQGVDRLLIDATERAYHRSADAAKQREHYSGKKNGIR* |
Ga0126379_100572342 | 3300010366 | Tropical Forest Soil | LVHLELLPSRELATPEALQAALQGGDRLLIDATERAYHRAQDHAKQRAHDSGKKNSLR* |
Ga0126383_119401692 | 3300010398 | Tropical Forest Soil | GGLQGVDRLLIDATERGYHRSQAEVKQREHYSGKKNSIH* |
Ga0105246_123883872 | 3300011119 | Miscanthus Rhizosphere | ALQGGDRLLIDATERAYHRSQDDAKQREHDSGKKNSIR* |
Ga0137392_114336672 | 3300011269 | Vadose Zone Soil | QGIDHVIIDATERAYRRSQDDTKQREHYSGKKNGIC* |
Ga0137393_112885561 | 3300011271 | Vadose Zone Soil | EFATPAALQAALQGVDRLLIDATERAYHRSTDDVKQREHDSGKKNGIR* |
Ga0137393_114132362 | 3300011271 | Vadose Zone Soil | EALQAALQGVDQVIIDATERAYRRSQDDAKQREYYSGKKKTTC* |
Ga0137454_11011601 | 3300011406 | Soil | LKGVDRVIIDATERAYRRSQDDATQREYYSGKKKSIP* |
Ga0137436_11294481 | 3300011423 | Soil | KAALNGLDRLIIDATERAYHRSQDDAKQREHYSGKKNSTR* |
Ga0137439_11457751 | 3300011424 | Soil | KAALKGVDKVIIDATERAYRRSQDDATQRDYYSGKKKSIH* |
Ga0137389_109114901 | 3300012096 | Vadose Zone Soil | ELGTPDDLKAALNGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0137389_117928681 | 3300012096 | Vadose Zone Soil | GVDQVIIDATERAYRRSQDDAKQREYYSGKKKTTC* |
Ga0137357_10224991 | 3300012168 | Soil | LGTPDDLKAALKGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0137388_107088381 | 3300012189 | Vadose Zone Soil | MPSRELRIPDALKAALKGVDQVIIDATERAYRRSQDDAKQREHDRGKKKDTC* |
Ga0137363_111324001 | 3300012202 | Vadose Zone Soil | ALQGGDRLLIDATERAYHRSQDAAKQREHYSGKKNSIR* |
Ga0137374_110202802 | 3300012204 | Vadose Zone Soil | GADRLIIDATARAYRRSQDDAKQREHYSGKKKSIH* |
Ga0137362_116818862 | 3300012205 | Vadose Zone Soil | GEGRLLIDATEGAYHRSQDDAKQLEHYSGKKNSIR* |
Ga0137381_103197801 | 3300012207 | Vadose Zone Soil | ALQGEDRLLIDATERAYHRSQDDATQREHYSGKKNSRR* |
Ga0137381_106725921 | 3300012207 | Vadose Zone Soil | ALHGVDRLLIDATERAYHRSTEHAKQREHYSGKKNSIR* |
Ga0137381_106895221 | 3300012207 | Vadose Zone Soil | AALQGGDRLLIDATERAYHRSHDDAKQREHSSGKKNSIR* |
Ga0137379_117505032 | 3300012209 | Vadose Zone Soil | ATPEELKAALQGVDRLLIDATERAYHRSQDDAKQREHYS* |
Ga0137378_116727462 | 3300012210 | Vadose Zone Soil | WATPEELQAVWQGGDRLLMDATERADHRSHDDAKQREHDSGKKNSRR* |
Ga0137378_118538663 | 3300012210 | Vadose Zone Soil | LALMPHRECNTPDELQAALQGADRWSIDATERAYHRAQDEAKQREH* |
Ga0137377_117431682 | 3300012211 | Vadose Zone Soil | TTPDEFKSALKGADRLIIDATERAYRRSQDDAKQREHYSGKKKSIR* |
Ga0137387_107045572 | 3300012349 | Vadose Zone Soil | MAKLGSVCPPENSQPAQLKAALQGEDRLLIDATERAYHRSHDDATQREHYSGKKNSRR* |
Ga0137367_110105271 | 3300012353 | Vadose Zone Soil | LGPPDDLKAVLNGLDRLIIDATERAYHRSQDDAKQREHDSGKKNSIR* |
Ga0137369_106369573 | 3300012355 | Vadose Zone Soil | MPSRELGTPDDVKAALHGVDRLSIDATERASHRSQEDAKQREHSSGKKNDRR* |
Ga0137371_105346203 | 3300012356 | Vadose Zone Soil | ELTTPEELKAALRGEDRLLIEATERAYHRSQDDAKQCAHYSGKKNSIR* |
Ga0137368_108820821 | 3300012358 | Vadose Zone Soil | ALHGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0137385_112602342 | 3300012359 | Vadose Zone Soil | AKLGSVCPPENSQPAQLKAALQGEDRLRIDATERAYHRSHDDATQREHYSGKKNSRR* |
Ga0137385_114079131 | 3300012359 | Vadose Zone Soil | AALHGVDRLLIDATERAYHRLTDDVKQREHYSGKKNSIR* |
Ga0137360_107216142 | 3300012361 | Vadose Zone Soil | MPYRELGTPEDLKAALHGVDRLIIDATERAYHRSQDEAKQREHDSGKKNSIR* |
Ga0137361_105063374 | 3300012362 | Vadose Zone Soil | KAALQGGDRLLIDATERAYHRSQDEAKQREHDSGKKNRIR* |
Ga0137361_115032962 | 3300012362 | Vadose Zone Soil | EALKAALQGGDRLLIDATERAYHRSQDAAKQREHYSGKKNSIR* |
Ga0134035_11152443 | 3300012391 | Grasslands Soil | QGVDRLLIDATERAYHRSTDEAKQREHYSGKKNSIR* |
Ga0134060_15168482 | 3300012410 | Grasslands Soil | EELKASLQGGDRLLIDATERAYHRSQDDAKQREHYSGKKNSIR* |
Ga0137398_106413792 | 3300012683 | Vadose Zone Soil | LSTPEALKAALQGGDRLLIDATERAYHRSQDDAKQREHYSGKKNSIR* |
Ga0137395_100177723 | 3300012917 | Vadose Zone Soil | MPYRELGTPEDLKAALKGVDRLILDAIERAYHRSQDDVKQREHSSGKKNSIR* |
Ga0137396_110968412 | 3300012918 | Vadose Zone Soil | DLKAALHGVDRLIIDATERAYHRSQDEAKQREHDSGKKNSIR* |
Ga0137394_106137581 | 3300012922 | Vadose Zone Soil | DLKAALKGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0137394_111722411 | 3300012922 | Vadose Zone Soil | KAALKGVDRLIIDATERAYHRSQDDAKQREHYSGKKNSIR* |
Ga0137394_115234911 | 3300012922 | Vadose Zone Soil | AALHVGDRSIINATARAYHRSQDDATPRENYSGKKNSIR* |
Ga0137416_111450222 | 3300012927 | Vadose Zone Soil | RELGTPDDWKAALHGLDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0137404_113980541 | 3300012929 | Vadose Zone Soil | MPSRELGTPEDVKAALQGVDRLIIDATERAYHRSQEDAKQREHD |
Ga0137404_114237991 | 3300012929 | Vadose Zone Soil | HLDLMPYRELTTPEALKAALQGGDRLLIDATERAYHRSQDDAKQREHDSGKKNSIR* |
Ga0137407_117268782 | 3300012930 | Vadose Zone Soil | YRELATPEDLQAALQGGDHLLIDATERAYHRSTDDGKQREHYSGKKNSIR* |
Ga0137410_103806892 | 3300012944 | Vadose Zone Soil | MPYRELGTPDDLKAALHGVDRLIMDATERAYHRSQDETKQREHDSGKKNSIRCKTPSCPCLTS* |
Ga0126375_115156792 | 3300012948 | Tropical Forest Soil | PEELKAVLQGGDRLLIDATERAYHRSQDDAKQREHDSGKKNSIR* |
Ga0172420_102695851 | 3300013233 | Marine | GIDQIIIDATERLYRRSKDDAKQQEHYSGKKNDIR* |
Ga0134075_104644531 | 3300014154 | Grasslands Soil | QAALHGGDRLRIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0075320_11098781 | 3300014255 | Natural And Restored Wetlands | TAFQGVDRLLIDVTERLYRRSEDDATQREHYSGKKSVTPSKTR* |
Ga0075324_10616892 | 3300014263 | Natural And Restored Wetlands | LKAALQGGDHLLIDATERAYHRSTDDAKQRDHYSGKKNSIR* |
Ga0075313_10244381 | 3300014267 | Natural And Restored Wetlands | TGAVGGDRLLIDATERAYHRSTDDATQRDHYSGKKNGIC* |
Ga0075339_12387731 | 3300014316 | Natural And Restored Wetlands | KTPDELKAVLDGIDQIIIDTTERQILLSKDDATQREHYSGKKNGTR* |
Ga0180068_10602973 | 3300014864 | Soil | AALKGVDRVIIDATERAYRRSQDDATQRDYYSGKKKSIP* |
Ga0137411_10865181 | 3300015052 | Vadose Zone Soil | MPYRELGTPDDLKAALHGVDRLIMDATERAYHRSQDETKQREHESGKKNSIR |
Ga0137418_108902101 | 3300015241 | Vadose Zone Soil | GVDHLLIDATERAYHRSQDDAKQREHYSGKKNSIR* |
Ga0137403_102556293 | 3300015264 | Vadose Zone Soil | LGTPEDVKAALQGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR* |
Ga0134089_103714111 | 3300015358 | Grasslands Soil | LTTPEALKAALQGEERLLIDATERAYHRSHDDATQREHYSGKKNSIR* |
Ga0132257_1014070981 | 3300015373 | Arabidopsis Rhizosphere | LKAALQGVDRLLIDAPERAYHRSADDAKQREHYSGKKNSIR* |
Ga0132257_1018225071 | 3300015373 | Arabidopsis Rhizosphere | EFTPPEELKAALQGVDRLLIDATERAYHRSTDDAKQREHYS* |
Ga0182036_114302711 | 3300016270 | Soil | LKAALQGGDRLIIDATERAYHRSKDEAKQREHYSGKKNGTP |
Ga0182040_115038511 | 3300016387 | Soil | PEDLKAALQGVDRLLIDATERAYHRSADDAKQREHYSGKKNSIR |
Ga0182038_104741943 | 3300016445 | Soil | KAALQGVDRLLIDATERAYHRSADDAKQREHYSGKKNSIR |
Ga0134069_12658452 | 3300017654 | Grasslands Soil | LKAAVNGLDRLIIDATERAYHRSQDDAKQREHYSGKKNSIR |
Ga0184634_104629861 | 3300018031 | Groundwater Sediment | KTALKGADRLSIEATERAYRRTQDETKQREHYSGKKKSIR |
Ga0184638_10895962 | 3300018052 | Groundwater Sediment | MPYRELGTPDDVKAALHGVDRLIIDATERAYHRSQEDAKQREHSSGKKNSIR |
Ga0184626_104326282 | 3300018053 | Groundwater Sediment | MPYRELGTPDDVKAALHGVDRLIIDATERAEPRSQEDAKQREHDSGKKHSIR |
Ga0184637_102033912 | 3300018063 | Groundwater Sediment | LKAALQGVDHVIIDATERAYRRSQADAKQREHSSGKKNSIR |
Ga0184618_102859583 | 3300018071 | Groundwater Sediment | MPYRELGTPDDLKAALNGVDRLSIDATERAYHRSQDDAKQREHS |
Ga0184640_104102631 | 3300018074 | Groundwater Sediment | LKGADRLIIDATERAYRRSQDDAKQREHYSGKKKRIR |
Ga0184609_101978272 | 3300018076 | Groundwater Sediment | MPYRELGTPEDVKAALHGVDRLIIDATERAYHRSQEDAKQREHSSGKKNSIR |
Ga0184612_102015123 | 3300018078 | Groundwater Sediment | MPYRELGTPDDVKAALNGVDRLISDATERAYHRSQDDATQREHSSGKKNSIR |
Ga0184612_103115561 | 3300018078 | Groundwater Sediment | MPYRELGTPEDVKAALHGVDRLIIDATERAEPRSQEDAKQREHDSGKKHSIR |
Ga0184627_102810412 | 3300018079 | Groundwater Sediment | LKAALQGVDHVIIDATERAYRRSQDDAKQREHSSGKKNSIR |
Ga0184639_103309173 | 3300018082 | Groundwater Sediment | QGVDHVIIDATERAYRRSQDEAKQREHSSGKKNSIR |
Ga0066655_107168343 | 3300018431 | Grasslands Soil | PDDFKAALQGIDQLIIDATERAYRRSQDEAKQREHYSGKKKSIR |
Ga0190268_123628031 | 3300018466 | Soil | GIDQRIMDATERAYRRARDDAQQREHDSGTKKSRR |
Ga0066669_124583542 | 3300018482 | Grasslands Soil | TPEALKAALQGIVQVIIDATERAYRRSKDDTKQRDDYSGKKNGIC |
Ga0137408_10344281 | 3300019789 | Vadose Zone Soil | MPSRELGTPEDVKAALQGVDRLIIDATERAYHRSQEDAKQREHDSGKKNSIR |
Ga0193739_11471102 | 3300020003 | Soil | TPEELKAALRGGDRLLIDATERAYHRSQDEAKQREHYSGKKNSIR |
Ga0187846_103861322 | 3300021476 | Biofilm | EALKAALQGVDRLLIDATERAYHRSADDAKQREHYSGKKNSLR |
Ga0224452_12333191 | 3300022534 | Groundwater Sediment | ALKGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR |
Ga0209827_100980301 | 3300025149 | Thermal Springs | MPSRELATPEDLKAALQGADRLSIAATERAYHRSKEDAKQREHY |
Ga0207647_104199802 | 3300025904 | Corn Rhizosphere | RELTTPEALKAVWQGGDRLLIDATERAYHRSQDDAKQREHDSGKKNSIR |
Ga0207668_117420761 | 3300025972 | Switchgrass Rhizosphere | QGGDRLLIDATERAYHRSHDEAKQREHYSGKKNSIR |
Ga0210082_10416223 | 3300025984 | Natural And Restored Wetlands | MKAAFQGVDRILIDVTERLYRRSQDDDTQREHYSGKKSTTPSKTL |
Ga0209237_12389042 | 3300026297 | Grasslands Soil | PEDVKAALQGVDRLLIDATERAYHRSTDDATQREHYSGKKNSIR |
Ga0209686_12226881 | 3300026315 | Soil | LQGIDQVIIDATERAYRRSQDDTKQREHYSGKKNGIC |
Ga0209152_104462271 | 3300026325 | Soil | EDLKAALQGVDRLLIDATERAYHRSTDAVKQRAHYSGKKNSIR |
Ga0209801_11741731 | 3300026326 | Soil | DVKAALQGVDRLLIDATERAYHRSTDDATQREHYSGKKNSIP |
Ga0209804_12436843 | 3300026335 | Soil | ELSTPEALKAALQGRDRLLIDATERAYHRSQDDAQQREHYSGKKNSIR |
Ga0257170_10660291 | 3300026351 | Soil | ALKGADRLIIDATERAYRRSQDDAKQREHYSGKKKSIR |
Ga0257178_10504851 | 3300026446 | Soil | EEFKSALKGADRLIIDATERAYRRSQDDAKQREHYSGKKKSIR |
Ga0209058_12927441 | 3300026536 | Soil | RELTTPEALKAALQGEERLLIDATERAYHRSHDDATQREHDSGKKNSIR |
Ga0209577_105828423 | 3300026552 | Soil | EELKAALQGVDHLLIDATERAYHRLQDDAKQREHDSGKKNGIR |
Ga0209879_10673622 | 3300027056 | Groundwater Sand | LQGGDRLLIDATERAYHRSQDEAKQREHYSGKKHSIR |
Ga0209878_10464051 | 3300027163 | Groundwater Sand | ELGTPDDLKAALHGVDRLIIDATERAYHRSQEDAKQREHYSGKKNDIR |
Ga0209854_10673461 | 3300027384 | Groundwater Sand | EELKAALQGGDRLLIDATERAYHRSQDETKQREHYSGKKNSIR |
Ga0209622_10962982 | 3300027502 | Forest Soil | ELSTPEELKAALHGGDRLLIDATERAYHRSQDDATQREHYSGKKNSIR |
Ga0209523_11285821 | 3300027548 | Forest Soil | RGGDRLLIDATERAYHRSQDEAKQREHYSGKKNSIR |
Ga0209887_10032315 | 3300027561 | Groundwater Sand | MPYRELGTPDDVKVALNGVDRLIIDATERAYHRSQEDAKQREHSSGKKNSIR |
Ga0209735_10773293 | 3300027562 | Forest Soil | GGDRLLIDATERAYHRSQEDAKQREHYSGKKNSIR |
Ga0209388_11692643 | 3300027655 | Vadose Zone Soil | ALQGIDQLIIDATERTYRRAQDDAKQRAHDSGNKKSIR |
Ga0209180_104358653 | 3300027846 | Vadose Zone Soil | TPEDLKTALQGVDRLLIDATERAYHRSTDDAKQREHYSGKKNSIR |
Ga0209180_107890721 | 3300027846 | Vadose Zone Soil | NLYYSVLKSALKGADRLIIDATERAYRRSQDEAKQREHYSGKKKSIR |
Ga0209283_106137313 | 3300027875 | Vadose Zone Soil | LKAALHGDDRLLIDATERAYHRSQDDATQREHYSGKKNSIR |
Ga0209283_109483581 | 3300027875 | Vadose Zone Soil | SVDRLLIDATERAYHRSTDDTKQREHYSGKKNSIR |
Ga0209481_103572993 | 3300027880 | Populus Rhizosphere | TPEALKTALQGVDQLIIDATERAYRRLQDDAKQREHYSGKKKSIR |
Ga0209590_106612581 | 3300027882 | Vadose Zone Soil | PDDLKAALHGVDRLIIDATERAYHRSQEDAKQREHYSGKKNDIR |
Ga0209590_108326882 | 3300027882 | Vadose Zone Soil | LKAALQGVDRLLIDATERAYHRSTDDATQREHYSGKKNSIP |
Ga0209382_123220751 | 3300027909 | Populus Rhizosphere | MPERACGAPADWQAALQGGDRLLIDATDRAYRRSQEDATQRAHDS |
Ga0209853_10354063 | 3300027961 | Groundwater Sand | GVDRLIIDATERAYHRSQEDAKQREHSSGKKNSIR |
Ga0209853_10887503 | 3300027961 | Groundwater Sand | MPYRELGTPDDVKVALNGVDRLIIDATERAYHRSQEDAKQREHSSGKKNS |
Ga0268265_118979031 | 3300028380 | Switchgrass Rhizosphere | TTPEALKAVLQGGDRLLIDATERAYHRSQDDATQREHYSGKKNSIR |
Ga0307504_101694162 | 3300028792 | Soil | MPYRELGTPDDLKAALHGVDRLIIDATERAYHRSQDDAKQREHDSGKKNGIR |
Ga0268386_108258011 | 3300030619 | Soil | PKALRKALEGVDQLIIDATERLCRRSQDDATQREHYSGKKKTIR |
Ga0308206_11461501 | 3300030903 | Soil | ALKAALQGGDRLLIDATERAYHRSQDEAKQREHYSGKKNSTR |
Ga0308189_100076156 | 3300031058 | Soil | LKAALQGGDRLLIDATERAYHRSQDDAKQREHYSGKKNSIR |
Ga0308185_10572822 | 3300031081 | Soil | LKAVLQGGDRLLIDATERAYHRSQDDAKQREHYSGKKNSIR |
Ga0308199_11052761 | 3300031094 | Soil | MPSRELGTPEALKAALHGVDQLIIDATERAYRRSQDEVKQREYESGKKNGIG |
Ga0308187_104122792 | 3300031114 | Soil | LSTPEELKAALQGGDRLLIDATERAYHRSQDDAKQREHYSGKK |
Ga0307495_101526642 | 3300031199 | Soil | ELSTPEELKAALQGGDRLLIDATERAYHRSQDEAKQREHYSGKKNGIR |
Ga0307497_101007192 | 3300031226 | Soil | MPYREWGTPDDLKAALQGVDRLIIDATDRAYRRSQEDAKQQEYDSGKKSGIC |
Ga0318516_105680282 | 3300031543 | Soil | QGGERLLIDATERAYHRSQDEATQREHYSGKKNSTR |
Ga0310915_109117301 | 3300031573 | Soil | QGVDRLLIDATERAYHRSADDAKQREHYSGKKNSIR |
Ga0318537_103279031 | 3300031763 | Soil | KAALQGIDHVIIDATERAYRRSQEDAKQREHYSGKKNGIR |
Ga0307473_112361361 | 3300031820 | Hardwood Forest Soil | GVDRLLIDATERAYHRSQDDAKQREHYSGKKNSIR |
Ga0306923_119334912 | 3300031910 | Soil | EALKAALQGVDRLLIDATERAYHRSHDDAKQREHDSGKKNSIR |
Ga0310891_100336532 | 3300031913 | Soil | MPYRELGAPDDLKAALQGVDRLIIDATERAYRRSQEDAKQQEYYSGKKSGIC |
Ga0310901_104294062 | 3300031940 | Soil | YRELGAPDDLKAALQGVDRLIIDATERAYRRSQEDAKQQEYYSGKKSGIC |
Ga0310913_110518812 | 3300031945 | Soil | LQGVDRLLIDATERAYHRSADNAKQREHYSGKKNSIR |
Ga0310910_101491124 | 3300031946 | Soil | MPYRELATPEALKAALQGVDRLLIDATERAYHRSHDDAKQREHDSGKKNSIR |
Ga0318530_104125861 | 3300031959 | Soil | GEGRLLIDATERAYHRSQDDAKQREHYSGKKNSIR |
Ga0306922_109755411 | 3300032001 | Soil | TTPEALKAALQGGDRLLIDATERAYHRSQDEAKQREHYSGKKNSTR |
Ga0310902_113031223 | 3300032012 | Soil | EDLKAALQGVDRLLIDATERAYRRSQEDAKQREHYSGKKSGIC |
Ga0307470_103001092 | 3300032174 | Hardwood Forest Soil | MPYRELGTPDDLKVALHGLDRLIIDATERAYHRSQDDAKQREHDSGKKNSIR |
Ga0307470_111044691 | 3300032174 | Hardwood Forest Soil | PYRELTTPEALKAALQGGDRLLIDATERAYHRSQDDAKQREHDSGKKNSIR |
Ga0307471_1031424352 | 3300032180 | Hardwood Forest Soil | ELTTPEELKAALQGGDRLLIDATERAYHRSQEDAKQREHYSGKKNSIR |
Ga0307472_1027211382 | 3300032205 | Hardwood Forest Soil | ALQGVDRLLIDATERAYHRSTDDTKQREHYSGKKNSIR |
Ga0364924_171369_365_508 | 3300033811 | Sediment | LGTPDDLKAALHGLDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR |
Ga0364946_138255_3_122 | 3300033815 | Sediment | AALHGVDRLIIDATERAYHRSQEDAKQREHYSGKKNSIR |
Ga0364929_0281867_17_142 | 3300034149 | Sediment | LKAALQGGDRLLIDATERAYHRSQDAAKQREHYSGKKNSIR |
Ga0370545_039004_690_848 | 3300034643 | Soil | MPYRELATPEDVKIALQGGDRLIIDATERAYHRSQDDAKQREHDSGKKNGIR |
Ga0373958_0150841_429_572 | 3300034819 | Rhizosphere Soil | LGAPDDLKAALQGVDRLIIDATERAYRRSQEDAKQREHYSGKKSGIC |
⦗Top⦘ |