NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F020785

Metagenome Family F020785

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020785
Family Type Metagenome
Number of Sequences 222
Average Sequence Length 44 residues
Representative Sequence MNANANGWHGAPIKALDEAKTGRLREESNAEWRPRPPVPFGLLPK
Number of Associated Samples 169
Number of Associated Scaffolds 222

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.59 %
% of genes near scaffold ends (potentially truncated) 96.85 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.270 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(8.108 % of family members)
Environment Ontology (ENVO) Unclassified
(39.640 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.901 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.81%    β-sheet: 0.00%    Coil/Unstructured: 82.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 222 Family Scaffolds
PF03441FAD_binding_7 4.05
PF00528BPD_transp_1 3.15
PF13561adh_short_C2 2.25
PF03480DctP 1.80
PF13416SBP_bac_8 1.80
PF02518HATPase_c 1.80
PF13302Acetyltransf_3 1.35
PF01578Cytochrom_C_asm 1.35
PF00482T2SSF 1.35
PF04039MnhB 1.35
PF01979Amidohydro_1 0.90
PF04995CcmD 0.90
PF01634HisG 0.90
PF00005ABC_tran 0.90
PF07719TPR_2 0.90
PF13417GST_N_3 0.90
PF00497SBP_bac_3 0.90
PF00571CBS 0.90
PF02530Porin_2 0.90
PF02653BPD_transp_2 0.90
PF08546ApbA_C 0.90
PF05977MFS_3 0.90
PF08770SoxZ 0.90
PF00899ThiF 0.90
PF00925GTP_cyclohydro2 0.90
PF00237Ribosomal_L22 0.90
PF00662Proton_antipo_N 0.90
PF07650KH_2 0.90
PF028262-Hacid_dh_C 0.90
PF00701DHDPS 0.90
PF12680SnoaL_2 0.45
PF00107ADH_zinc_N 0.45
PF05258DciA 0.45
PF04364DNA_pol3_chi 0.45
PF13545HTH_Crp_2 0.45
PF00970FAD_binding_6 0.45
PF13385Laminin_G_3 0.45
PF01315Ald_Xan_dh_C 0.45
PF03448MgtE_N 0.45
PF06808DctM 0.45
PF01026TatD_DNase 0.45
PF03486HI0933_like 0.45
PF00436SSB 0.45
PF02955GSH-S_ATP 0.45
PF00916Sulfate_transp 0.45
PF01053Cys_Met_Meta_PP 0.45
PF01872RibD_C 0.45
PF09339HTH_IclR 0.45
PF01648ACPS 0.45
PF01266DAO 0.45
PF03591AzlC 0.45
PF00171Aldedh 0.45
PF03462PCRF 0.45
PF04055Radical_SAM 0.45
PF12399BCA_ABC_TP_C 0.45
PF04379DUF525 0.45
PF05035DGOK 0.45
PF09976TPR_21 0.45
PF03737RraA-like 0.45
PF03472Autoind_bind 0.45
PF13393tRNA-synt_His 0.45
PF00288GHMP_kinases_N 0.45
PF04174CP_ATPgrasp_1 0.45
PF13384HTH_23 0.45
PF03741TerC 0.45
PF04828GFA 0.45
PF02875Mur_ligase_C 0.45
PF01799Fer2_2 0.45
PF04679DNA_ligase_A_C 0.45
PF13380CoA_binding_2 0.45
PF14602Hexapep_2 0.45
PF02786CPSase_L_D2 0.45
PF00834Ribul_P_3_epim 0.45
PF12838Fer4_7 0.45
PF01259SAICAR_synt 0.45
PF01207Dus 0.45
PF00083Sugar_tr 0.45
PF08530PepX_C 0.45
PF02515CoA_transf_3 0.45
PF04011LemA 0.45
PF03976PPK2 0.45
PF00719Pyrophosphatase 0.45
PF04365BrnT_toxin 0.45
PF08666SAF 0.45
PF14403CP_ATPgrasp_2 0.45
PF00275EPSP_synthase 0.45
PF02922CBM_48 0.45
PF16576HlyD_D23 0.45
PF01738DLH 0.45
PF06831H2TH 0.45
PF132794HBT_2 0.45
PF04972BON 0.45
PF01842ACT 0.45
PF07219HemY_N 0.45
PF12146Hydrolase_4 0.45
PF13181TPR_8 0.45
PF02016Peptidase_S66 0.45
PF13649Methyltransf_25 0.45
PF13577SnoaL_4 0.45
PF01380SIS 0.45
PF02381MraZ 0.45
PF13481AAA_25 0.45
PF00294PfkB 0.45
PF00106adh_short 0.45
PF01321Creatinase_N 0.45
PF04358DsrC 0.45
PF00534Glycos_transf_1 0.45
PF01734Patatin 0.45
PF09864MliC 0.45
PF00383dCMP_cyt_deam_1 0.45
PF06707DUF1194 0.45
PF08379Bact_transglu_N 0.45
PF00908dTDP_sugar_isom 0.45
PF003892-Hacid_dh 0.45
PF14681UPRTase 0.45
PF00160Pro_isomerase 0.45
PF13414TPR_11 0.45
PF13686DrsE_2 0.45
PF01066CDP-OH_P_transf 0.45
PF00146NADHdh 0.45
PF01613Flavin_Reduct 0.45
PF00069Pkinase 0.45
PF02738MoCoBD_1 0.45
PF00329Complex1_30kDa 0.45
PF02684LpxB 0.45
PF01039Carboxyl_trans 0.45
PF00702Hydrolase 0.45
PF02322Cyt_bd_oxida_II 0.45
PF03401TctC 0.45
PF00873ACR_tran 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 222 Family Scaffolds
COG0415Deoxyribodipyrimidine photolyaseReplication, recombination and repair [L] 4.05
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.80
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.80
COG1009Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunitEnergy production and conversion [C] 1.80
COG2111Multisubunit Na+/H+ antiporter, MnhB subunitInorganic ion transport and metabolism [P] 1.35
COG3114Heme exporter protein DIntracellular trafficking, secretion, and vesicular transport [U] 0.90
COG3637Opacity protein LomR and related surface antigensCell wall/membrane/envelope biogenesis [M] 0.90
COG0040ATP phosphoribosyltransferaseAmino acid transport and metabolism [E] 0.90
COG0091Ribosomal protein L22Translation, ribosomal structure and biogenesis [J] 0.90
COG0189Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamilyTranslation, ribosomal structure and biogenesis [J] 0.90
COG0493NADPH-dependent glutamate synthase beta chain or related oxidoreductaseAmino acid transport and metabolism [E] 0.90
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.90
COG0807GTP cyclohydrolase IICoenzyme transport and metabolism [H] 0.90
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.90
COG2197DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domainsTranscription [K] 0.90
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.90
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.45
COG3262Ni,Fe-hydrogenase III component GEnergy production and conversion [C] 0.45
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.45
COG3634Alkyl hydroperoxide reductase subunit AhpFDefense mechanisms [V] 0.45
COG37342-keto-3-deoxy-galactonokinaseCarbohydrate transport and metabolism [G] 0.45
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.45
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.45
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.45
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.45
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.45
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.45
COG5512Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives)General function prediction only [R] 0.45
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.45
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.45
COG0029Aspartate oxidaseCoenzyme transport and metabolism [H] 0.45
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 0.45
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.45
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.45
COG0152Phosphoribosylaminoimidazole-succinocarboxamide synthaseNucleotide transport and metabolism [F] 0.45
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.45
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.45
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.45
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.45
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.45
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.45
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.45
COG0446NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductaseLipid transport and metabolism [I] 0.45
COG0492Thioredoxin reductasePosttranslational modification, protein turnover, chaperones [O] 0.45
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.45
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.45
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.45
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 0.45
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.45
COG0650Formate hydrogenlyase subunit HyfCEnergy production and conversion [C] 0.45
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.45
COG0659Sulfate permease or related transporter, MFS superfamilyInorganic ion transport and metabolism [P] 0.45
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.45
COG0763Lipid A disaccharide synthetaseCell wall/membrane/envelope biogenesis [M] 0.45
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.45
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.45
COG0852NADH:ubiquinone oxidoreductase 27 kD subunit (chain C)Energy production and conversion [C] 0.45
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.45
COG1005NADH:ubiquinone oxidoreductase subunit 1 (chain H)Energy production and conversion [C] 0.45
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.45
COG1053Succinate dehydrogenase/fumarate reductase, flavoprotein subunitEnergy production and conversion [C] 0.45
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.45
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.45
COG1249Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductaseEnergy production and conversion [C] 0.45
COG1294Cytochrome bd-type quinol oxidase, subunit 2Energy production and conversion [C] 0.45
COG1296Predicted branched-chain amino acid permease (azaleucine resistance)Amino acid transport and metabolism [E] 0.45
COG1305Transglutaminase-like enzyme, putative cysteine proteasePosttranslational modification, protein turnover, chaperones [O] 0.45
COG1619Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling)Cell wall/membrane/envelope biogenesis [M] 0.45
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.45
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.45
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.45
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.45
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.45
COG1898dTDP-4-dehydrorhamnose 3,5-epimerase or related enzymeCell wall/membrane/envelope biogenesis [M] 0.45
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.45
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.45
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.45
COG2001MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activityTranslation, ribosomal structure and biogenesis [J] 0.45
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.45
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.45
COG2081Predicted flavoprotein YhiNGeneral function prediction only [R] 0.45
COG2233Xanthine/uracil permeaseNucleotide transport and metabolism [F] 0.45
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 0.45
COG2252Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) familyNucleotide transport and metabolism [F] 0.45
COG2308Circularly permuted ATP-grasp proteinGeneral function prediction only [R] 0.45
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.45
COG2509FAD-dependent dehydrogenaseGeneral function prediction only [R] 0.45
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.45
COG2920Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C)Translation, ribosomal structure and biogenesis [J] 0.45
COG2927DNA polymerase III, chi subunitReplication, recombination and repair [L] 0.45
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.45
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.45
COG2965Primosomal replication protein NReplication, recombination and repair [L] 0.45
COG2967Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transportInorganic ion transport and metabolism [P] 0.45

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.07 %
UnclassifiedrootN/A27.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS401DXCRGAll Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium526Open in IMG/M
3300003541|JGI20214J51650_10837018Not Available643Open in IMG/M
3300004047|Ga0055499_10093085Not Available548Open in IMG/M
3300004157|Ga0062590_100489741All Organisms → cellular organisms → Bacteria → Proteobacteria1044Open in IMG/M
3300005186|Ga0066676_10559671All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300005187|Ga0066675_10967408Not Available641Open in IMG/M
3300005218|Ga0068996_10066151Not Available746Open in IMG/M
3300005328|Ga0070676_10113860All Organisms → cellular organisms → Bacteria → Proteobacteria1688Open in IMG/M
3300005329|Ga0070683_100618530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1037Open in IMG/M
3300005332|Ga0066388_104003559All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005332|Ga0066388_108330414All Organisms → cellular organisms → Bacteria → Proteobacteria517Open in IMG/M
3300005334|Ga0068869_101012347All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005334|Ga0068869_101833098Not Available543Open in IMG/M
3300005338|Ga0068868_100750568Not Available877Open in IMG/M
3300005347|Ga0070668_100023340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4679Open in IMG/M
3300005347|Ga0070668_100065980All Organisms → cellular organisms → Bacteria → Proteobacteria2807Open in IMG/M
3300005354|Ga0070675_100050381All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3419Open in IMG/M
3300005354|Ga0070675_101923728Not Available545Open in IMG/M
3300005355|Ga0070671_100755136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium845Open in IMG/M
3300005356|Ga0070674_101570787All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium593Open in IMG/M
3300005364|Ga0070673_100022716All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales4570Open in IMG/M
3300005364|Ga0070673_100250856All Organisms → cellular organisms → Bacteria → Proteobacteria1542Open in IMG/M
3300005364|Ga0070673_100734127All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium908Open in IMG/M
3300005366|Ga0070659_101009915All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria730Open in IMG/M
3300005366|Ga0070659_101334270Not Available637Open in IMG/M
3300005367|Ga0070667_100154647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2016Open in IMG/M
3300005406|Ga0070703_10210819All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium768Open in IMG/M
3300005438|Ga0070701_10550518Not Available757Open in IMG/M
3300005440|Ga0070705_100872405All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium722Open in IMG/M
3300005445|Ga0070708_100878635All Organisms → cellular organisms → Bacteria → Proteobacteria842Open in IMG/M
3300005451|Ga0066681_10773113All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium581Open in IMG/M
3300005459|Ga0068867_100029945All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3925Open in IMG/M
3300005471|Ga0070698_100187086All Organisms → cellular organisms → Bacteria → Proteobacteria2008Open in IMG/M
3300005471|Ga0070698_100370254All Organisms → cellular organisms → Bacteria → Proteobacteria1365Open in IMG/M
3300005530|Ga0070679_101271030Not Available681Open in IMG/M
3300005543|Ga0070672_100244398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium1510Open in IMG/M
3300005554|Ga0066661_10889997All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria521Open in IMG/M
3300005556|Ga0066707_10034748All Organisms → cellular organisms → Bacteria → Proteobacteria2826Open in IMG/M
3300005577|Ga0068857_101981515Not Available571Open in IMG/M
3300005598|Ga0066706_10144002All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300005616|Ga0068852_100027955All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4607Open in IMG/M
3300005618|Ga0068864_100151858All Organisms → cellular organisms → Bacteria2098Open in IMG/M
3300005764|Ga0066903_106191414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp.625Open in IMG/M
3300005764|Ga0066903_107412972All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium566Open in IMG/M
3300005841|Ga0068863_100971861Not Available851Open in IMG/M
3300005940|Ga0073913_10019159All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria978Open in IMG/M
3300006050|Ga0075028_100908637All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria543Open in IMG/M
3300006050|Ga0075028_100984502Not Available524Open in IMG/M
3300006057|Ga0075026_100052600All Organisms → cellular organisms → Bacteria → Proteobacteria1924Open in IMG/M
3300006169|Ga0082029_1420989Not Available625Open in IMG/M
3300006358|Ga0068871_101570920All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. A 288622Open in IMG/M
3300006358|Ga0068871_102307906All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300006755|Ga0079222_10023787All Organisms → cellular organisms → Bacteria → Proteobacteria2506Open in IMG/M
3300006796|Ga0066665_10188309All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300006806|Ga0079220_11046311All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300006854|Ga0075425_100911840Not Available1004Open in IMG/M
3300006880|Ga0075429_101861036Not Available522Open in IMG/M
3300006881|Ga0068865_100301935All Organisms → cellular organisms → Bacteria → Proteobacteria1282Open in IMG/M
3300006903|Ga0075426_10385580Not Available1033Open in IMG/M
3300006904|Ga0075424_100301415All Organisms → cellular organisms → Bacteria → Proteobacteria1706Open in IMG/M
3300006904|Ga0075424_101135243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium832Open in IMG/M
3300006954|Ga0079219_11946884All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300007076|Ga0075435_100192894All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas communis1725Open in IMG/M
3300007076|Ga0075435_100947726All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium751Open in IMG/M
3300009092|Ga0105250_10543970All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009093|Ga0105240_11680362Not Available663Open in IMG/M
3300009094|Ga0111539_10385525All Organisms → cellular organisms → Bacteria → Proteobacteria1632Open in IMG/M
3300009094|Ga0111539_13137238All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium533Open in IMG/M
3300009100|Ga0075418_11828752All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria661Open in IMG/M
3300009101|Ga0105247_10070231All Organisms → cellular organisms → Bacteria → Proteobacteria2187Open in IMG/M
3300009177|Ga0105248_10687219All Organisms → cellular organisms → Bacteria → Proteobacteria1154Open in IMG/M
3300009792|Ga0126374_10446756All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium917Open in IMG/M
3300010335|Ga0134063_10242879Not Available855Open in IMG/M
3300010360|Ga0126372_10788610All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M
3300010360|Ga0126372_12101811All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium613Open in IMG/M
3300010366|Ga0126379_10950457Not Available963Open in IMG/M
3300010400|Ga0134122_11299746All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300010401|Ga0134121_10277405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → Aestuariivita boseongensis1476Open in IMG/M
3300010403|Ga0134123_10782076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → Aestuariivita boseongensis945Open in IMG/M
3300010429|Ga0116241_10945724Not Available656Open in IMG/M
3300012198|Ga0137364_11070174Not Available608Open in IMG/M
3300012203|Ga0137399_11151558All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300012285|Ga0137370_10545078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria713Open in IMG/M
3300012360|Ga0137375_10701783All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium826Open in IMG/M
3300012474|Ga0157356_1004601All Organisms → cellular organisms → Bacteria → Proteobacteria762Open in IMG/M
3300012529|Ga0136630_1289994All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300012903|Ga0157289_10411750All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012951|Ga0164300_10748018Not Available599Open in IMG/M
3300012957|Ga0164303_10162417All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1196Open in IMG/M
3300012957|Ga0164303_10893481All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300012958|Ga0164299_10331771All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300012986|Ga0164304_11384551Not Available577Open in IMG/M
3300012987|Ga0164307_11476558Not Available574Open in IMG/M
3300012988|Ga0164306_10662497All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300012989|Ga0164305_10352876All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300013100|Ga0157373_11301129Not Available550Open in IMG/M
3300013296|Ga0157374_10031145All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4846Open in IMG/M
3300013307|Ga0157372_11231760Not Available864Open in IMG/M
3300013308|Ga0157375_10024617All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae5575Open in IMG/M
3300013308|Ga0157375_10152891All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2444Open in IMG/M
3300014312|Ga0075345_1068840All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria758Open in IMG/M
3300014325|Ga0163163_10910609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium943Open in IMG/M
3300014326|Ga0157380_10030713All Organisms → cellular organisms → Bacteria4117Open in IMG/M
3300014745|Ga0157377_10816289Not Available689Open in IMG/M
3300014969|Ga0157376_11494675Not Available708Open in IMG/M
3300015371|Ga0132258_10023689All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria13488Open in IMG/M
3300015371|Ga0132258_10382006All Organisms → cellular organisms → Bacteria → Proteobacteria3493Open in IMG/M
3300015371|Ga0132258_10863007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2284Open in IMG/M
3300015371|Ga0132258_11379267All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1781Open in IMG/M
3300015371|Ga0132258_13930041Not Available1010Open in IMG/M
3300015373|Ga0132257_101704715Not Available808Open in IMG/M
3300015374|Ga0132255_101461633All Organisms → cellular organisms → Bacteria → Proteobacteria1034Open in IMG/M
3300015374|Ga0132255_102806720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium745Open in IMG/M
3300015374|Ga0132255_103328382All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria685Open in IMG/M
3300017789|Ga0136617_10075559All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2944Open in IMG/M
3300017792|Ga0163161_10400615All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300017792|Ga0163161_11020435All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300017959|Ga0187779_10022692All Organisms → cellular organisms → Bacteria → Proteobacteria3583Open in IMG/M
3300017959|Ga0187779_10027975All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3235Open in IMG/M
3300017959|Ga0187779_10565128Not Available758Open in IMG/M
3300017961|Ga0187778_10008113All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6645Open in IMG/M
3300017961|Ga0187778_10270652All Organisms → cellular organisms → Bacteria → Proteobacteria1094Open in IMG/M
3300017966|Ga0187776_10001824All Organisms → cellular organisms → Bacteria → Proteobacteria10806Open in IMG/M
3300017973|Ga0187780_10245713All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1253Open in IMG/M
3300017999|Ga0187767_10099876Not Available805Open in IMG/M
3300018054|Ga0184621_10340018All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium528Open in IMG/M
3300018056|Ga0184623_10181047All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300018060|Ga0187765_10321520All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300018064|Ga0187773_10018169All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2989Open in IMG/M
3300018064|Ga0187773_10290340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria909Open in IMG/M
3300018078|Ga0184612_10347361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia753Open in IMG/M
3300018081|Ga0184625_10565730Not Available563Open in IMG/M
3300025290|Ga0207673_1021101Not Available881Open in IMG/M
3300025315|Ga0207697_10103992Not Available1212Open in IMG/M
3300025461|Ga0208851_1035669All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300025893|Ga0207682_10462211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium601Open in IMG/M
3300025906|Ga0207699_10587056All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria810Open in IMG/M
3300025909|Ga0207705_11210626Not Available579Open in IMG/M
3300025917|Ga0207660_11094119All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300025920|Ga0207649_11468351All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium540Open in IMG/M
3300025923|Ga0207681_10085091All Organisms → cellular organisms → Bacteria2243Open in IMG/M
3300025926|Ga0207659_10021599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4276Open in IMG/M
3300025931|Ga0207644_10618213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium900Open in IMG/M
3300025935|Ga0207709_11251874Not Available612Open in IMG/M
3300025936|Ga0207670_11320854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hwanghaeella → Hwanghaeella grinnelliae612Open in IMG/M
3300025937|Ga0207669_10368272Not Available1116Open in IMG/M
3300025937|Ga0207669_11046103All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300025938|Ga0207704_10050607All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2507Open in IMG/M
3300025938|Ga0207704_11787871All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300025940|Ga0207691_10007603All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria10430Open in IMG/M
3300025940|Ga0207691_10253353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium1519Open in IMG/M
3300025940|Ga0207691_11504286Not Available550Open in IMG/M
3300025941|Ga0207711_10745084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria913Open in IMG/M
3300025945|Ga0207679_11482439Not Available622Open in IMG/M
3300025945|Ga0207679_11714070All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300025960|Ga0207651_10690791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria898Open in IMG/M
3300025960|Ga0207651_11057862All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria726Open in IMG/M
3300025960|Ga0207651_11533120All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025961|Ga0207712_10838579Not Available810Open in IMG/M
3300025972|Ga0207668_10060685All Organisms → cellular organisms → Bacteria2655Open in IMG/M
3300025972|Ga0207668_10777587All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300025981|Ga0207640_10658294Not Available893Open in IMG/M
3300025986|Ga0207658_10852926All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium828Open in IMG/M
3300025986|Ga0207658_11824700Not Available555Open in IMG/M
3300026078|Ga0207702_10172800All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1983Open in IMG/M
3300026078|Ga0207702_10925137All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium864Open in IMG/M
3300026089|Ga0207648_11511052All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria631Open in IMG/M
3300026095|Ga0207676_11615868All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300026121|Ga0207683_11864258All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae550Open in IMG/M
3300026142|Ga0207698_12129692All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300026550|Ga0209474_10563604Not Available580Open in IMG/M
3300027765|Ga0209073_10038080All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1527Open in IMG/M
3300027765|Ga0209073_10468934Not Available526Open in IMG/M
3300027841|Ga0209262_10594398Not Available537Open in IMG/M
3300027890|Ga0209496_10026361All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1948Open in IMG/M
3300027902|Ga0209048_10009887All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria8604Open in IMG/M
3300028380|Ga0268265_10916408All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300028380|Ga0268265_11395596All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria702Open in IMG/M
3300028381|Ga0268264_11254357Not Available751Open in IMG/M
3300028381|Ga0268264_12284107All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium548Open in IMG/M
3300028679|Ga0302169_10055082All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila927Open in IMG/M
3300028739|Ga0302205_10120634Not Available670Open in IMG/M
3300028743|Ga0302262_10288002Not Available558Open in IMG/M
3300028869|Ga0302263_10149678All Organisms → cellular organisms → Bacteria → Proteobacteria931Open in IMG/M
3300029984|Ga0311332_10078132All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2366Open in IMG/M
3300029984|Ga0311332_10341126All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1154Open in IMG/M
3300029987|Ga0311334_10259139Not Available1347Open in IMG/M
3300029987|Ga0311334_11275017All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria618Open in IMG/M
3300030000|Ga0311337_11265535All Organisms → cellular organisms → Bacteria → Proteobacteria645Open in IMG/M
3300030002|Ga0311350_10447723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin1001159Open in IMG/M
3300030294|Ga0311349_10118735All Organisms → cellular organisms → Bacteria → Proteobacteria2467Open in IMG/M
3300030943|Ga0311366_10094848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2561Open in IMG/M
3300030943|Ga0311366_10663370All Organisms → cellular organisms → Bacteria → Proteobacteria907Open in IMG/M
3300031232|Ga0302323_102911794All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031521|Ga0311364_10445527Not Available1312Open in IMG/M
3300031521|Ga0311364_11193143All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium756Open in IMG/M
3300031544|Ga0318534_10420433Not Available767Open in IMG/M
3300031548|Ga0307408_100030096All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3768Open in IMG/M
3300031562|Ga0310886_10709955All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria627Open in IMG/M
3300031740|Ga0307468_101667938Not Available598Open in IMG/M
3300031740|Ga0307468_102218676Not Available532Open in IMG/M
3300031795|Ga0318557_10088014All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300031908|Ga0310900_11047144Not Available673Open in IMG/M
3300031918|Ga0311367_11131511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria779Open in IMG/M
3300031918|Ga0311367_11589818All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300032180|Ga0307471_100608794All Organisms → cellular organisms → Bacteria → Proteobacteria1252Open in IMG/M
3300032180|Ga0307471_101372559All Organisms → cellular organisms → Bacteria → Proteobacteria868Open in IMG/M
3300032180|Ga0307471_101709053All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria783Open in IMG/M
3300032180|Ga0307471_102819685All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria617Open in IMG/M
3300032205|Ga0307472_100515304Not Available1035Open in IMG/M
3300032205|Ga0307472_100571894All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria991Open in IMG/M
3300032205|Ga0307472_100620997Not Available958Open in IMG/M
3300032211|Ga0310896_10151206Not Available1100Open in IMG/M
3300032342|Ga0315286_12120639Not Available519Open in IMG/M
3300033004|Ga0335084_11424517All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria687Open in IMG/M
3300033412|Ga0310810_10018980All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales8255Open in IMG/M
3300033418|Ga0316625_100249753All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1216Open in IMG/M
3300033433|Ga0326726_11662926All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria622Open in IMG/M
3300033433|Ga0326726_12380950All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300033487|Ga0316630_10630535Not Available899Open in IMG/M
3300033803|Ga0314862_0004966All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2147Open in IMG/M
3300034176|Ga0364931_0284624Not Available547Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere7.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere5.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.15%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.25%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.35%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.35%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.35%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.90%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.90%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.90%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.90%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.45%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.45%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.45%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.45%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.45%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.45%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.45%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.45%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.45%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.45%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.45%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.45%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.45%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.45%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010429AD_USRAcaEngineeredOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014312Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FG2_020037902189573004Grass SoilMGANANGWHGPTVKADDEAKTGCLREEDNAEGRPRTPVPFGLLQRA
JGI20214J51650_1083701813300003541WetlandMDANANGWLGAPIKAPDEAKTGRLREEGNDEWRPKPPVPFGL
Ga0055499_1009308523300004047Natural And Restored WetlandsMSACANGWHGAPIEAPDEAQTGRLREERNEEWRPRAPVPFGLLPK
Ga0062590_10048974113300004157SoilMGANANGWPEAPIATADDAKTRSLGEESNKEWRLGAPVPF
Ga0066676_1055967113300005186SoilMDANANGRHGASIKAHDEAKTGRLREEGNAEWRPMMPVPFGLLPKTPIA
Ga0066675_1096740813300005187SoilMGANANGCAGAPIAAADEIKIGGLDEESNKEWRPRAAVRFGLLPQRVRVHSVQAL
Ga0068996_1006615113300005218Natural And Restored WetlandsMGANANGWHGAPIEAPDEVQTGRLREESNEEWRLRAPVPFGLLPKTLIAV
Ga0070676_1011386023300005328Miscanthus RhizosphereMDASANGRYGLPIKADDEAKTGRLGKEDNAEWRPRSPVPFGLLPK
Ga0070683_10061853013300005329Corn RhizosphereMFTDANGRHGQPIKALDEAKTGCLCEESNAEWGPMPPVPCGL
Ga0066388_10400355923300005332Tropical Forest SoilMGAYANERPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPFGLLPKTP
Ga0066388_10833041423300005332Tropical Forest SoilMDANANGWHGAPIEALHLPTAAVQTGRLHKEGNEEWRPRAPVPFGLL
Ga0068869_10101234723300005334Miscanthus RhizosphereMSANANGWHGAPIKALDAAKTGCLRKECNAEWRPRAPVPFGLLPK
Ga0068869_10183309813300005334Miscanthus RhizosphereSRAAVHTMPTDADGWHEAPSRLDDAKTGRLREESNAERRARAPVPFRLPPK*
Ga0068868_10075056813300005338Miscanthus RhizosphereMFTNANGRHGPPIKALDEAKTGRLCEESNAEWRPMPPVPFGLL
Ga0070668_10002334063300005347Switchgrass RhizosphereMDANANGVPWGDNRGADEAKTGSLGEERNKEWRPTASVPFGLLPKTP
Ga0070668_10006598043300005347Switchgrass RhizosphereMSANANGWHGAPIEADDEAKTRCLREEDNAEWRPRAPVPFGLLPKTP
Ga0070675_10005038163300005354Miscanthus RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPF
Ga0070675_10192372813300005354Miscanthus RhizosphereMFANANGWHEAPIEARDEAQTGCLREECNEEWRFRAPVPFGLLPKWPFASLQSLARRPT*
Ga0070671_10075513613300005355Switchgrass RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLP
Ga0070674_10157078713300005356Miscanthus RhizosphereMGANANGWRGAPIEALDEAKTRCLGEECNEEWRPRPPVPFGLL
Ga0070673_10002271673300005364Switchgrass RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGL
Ga0070673_10025085633300005364Switchgrass RhizosphereMFTNANGRQGPPIKALDEAKTGRLCEESNAEWRPMPPVPFGLLRKRRCASLRK
Ga0070673_10073412723300005364Switchgrass RhizosphereMDANANGWHGAPIEAADEAKTERLREENNAEWSPMPPVPSGLLPKTPIAA
Ga0070659_10100991533300005366Corn RhizosphereANGWHEAPIEARDEAQTGCLREECNEEWRFRAPVPFGLLPKWPFASLQSLARRPA*
Ga0070659_10133427023300005366Corn RhizosphereMFTNANGRHAPPIQALDEEKTGRLCEDSNAEWRRMPPAPFGLLRK
Ga0070667_10015464713300005367Switchgrass RhizosphereMGANANGWHGAPIEADDEAKTRCLREEDNAEWRPRAPVPFGLL
Ga0070703_1021081913300005406Corn, Switchgrass And Miscanthus RhizosphereMGANANGRHGAPIAAADEAKTRSLGEESNKEWRPMPPVPFGLLPKTPSAAL
Ga0070701_1055051813300005438Corn, Switchgrass And Miscanthus RhizosphereMDANANGWHGAPIAAADEAKTRSLGEESNKEWRPMPPVPFGLLPKTP
Ga0070705_10087240523300005440Corn, Switchgrass And Miscanthus RhizosphereMGANANGWRGAPIEALDEAKTRCLGEECNEEWRPRPPVPFGL
Ga0070708_10087863513300005445Corn, Switchgrass And Miscanthus RhizosphereMDANANRWHGAPIKAADEAKTGRLREENNAEWRPMPPVPFGLLPKTPIAALQ
Ga0066681_1077311323300005451SoilMPANANGWHGAPIKALDEAKTARLSEECNAEWRPMPPVPFGLPCNAFVDIV*
Ga0068867_10002994513300005459Miscanthus RhizosphereMDTNANGWDGAPIKATQLPNEEAETWRLREEGNAEWRPMPPVPFGLLPKTPSAAL
Ga0070698_10018708643300005471Corn, Switchgrass And Miscanthus RhizosphereMDANANGRHGAPIKTHDEAKTGRLREEGNAEWRPMMSVPFGLLPKTPITALRSL
Ga0070698_10037025433300005471Corn, Switchgrass And Miscanthus RhizosphereMDANANGRHGAPIKAHDDAKTGRLREEGNAEWRPMMPVPFGLLP
Ga0070679_10127103023300005530Corn RhizosphereMDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFRLPPK*
Ga0070672_10024439823300005543Miscanthus RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFG
Ga0066661_1088999713300005554SoilMDANANWRHGAPIKAPHLPNEEAKTGRLREEGNAEWRHMMPVPFGLLPKTPIAALR
Ga0066707_1003474813300005556SoilMGANANGWHGAPIAAAYLPNTEAKTSGLGKESNKEWRP
Ga0068857_10198151523300005577Corn RhizosphereMAAKANGGRGAPIKAPDEAKTVRLSEDGNDEWRPRGPVPFGLLRKWSCALLR
Ga0066706_1014400213300005598SoilMDANANGWHGAPIAAADEAKTSGLGEESNKEWRPMPPVPFG
Ga0068852_10002795563300005616Corn RhizosphereMATNANGRHGVPIKAPDEAKTARLSEDGNDEWHPMPPVPAGLQRKWHF
Ga0068864_10015185833300005618Switchgrass RhizosphereMGANANGWHGPPVKADDEAKTGRLREEDNAEGRPMPPVPFGLLP
Ga0066903_10619141423300005764Tropical Forest SoilMGAYAKGCPRAPIKAQDEAKTRRLGEDGNTEWRPKAPVPFGLP
Ga0066903_10741297223300005764Tropical Forest SoilMGAYANGCPGAPIKAPDEAKTSGLGEDGNTEWRPRTPVPFGLLPKTPIA
Ga0068863_10097186113300005841Switchgrass RhizosphereMDANANGWLQVPIKAADGETGRLRNENNAEWRLKLPAPV
Ga0073913_1001915913300005940SandMDANANGWLGAPIKAPDEAKTGRLREEGNAEWRPKPPVPFGLLP
Ga0075028_10090863733300006050WatershedsMGANANGWLGAPIKALDDAQTGCLREESNEEWRPKAPVPFGLLPKTPIAASR
Ga0075028_10098450213300006050WatershedsMDANANGWHGAPIKAPHLPNEDAKTGCLREEGNAEWRP
Ga0075026_10005260013300006057WatershedsMGANANGWLGAPIKALDEAQTGRLREESNEEWRPKAPVPFGLLPKTP
Ga0082029_142098913300006169Termite NestMFTNANGWHGPPIKADDEAKTGRLREEDNAEWRPRAPVPLGFL
Ga0068871_10157092023300006358Miscanthus RhizosphereMFANANGWRGAPIAAPDAVQTGRLHKEGNKEWRPRAPVPFGLLPK
Ga0068871_10230790613300006358Miscanthus RhizosphereMDANANGRLGVPIKALDEAKTGCLGEESNEEWDRKAPVPFGLLP
Ga0079222_1002378733300006755Agricultural SoilMDANANGQHGVPIKALDEAKTGCLCEESNAEWRVM
Ga0066665_1018830913300006796SoilMGANANGWHGAPIAAADEAKTSGLGEESNKEWRPR
Ga0079220_1104631113300006806Agricultural SoilMAANANGWHEAPIKADDEAKTARLRKEDNAEWRFRAAVPFGL
Ga0075425_10091184023300006854Populus RhizosphereGPVHAMGANANGWHGAPIAAADEAKTGGLGEEGNKEWRPRTPVPFGLLPSGATRLCP*
Ga0075429_10186103613300006880Populus RhizosphereMSANANAWHEAPIEARDEAQTGCLREECNEEWRFRAPVPFGLLPKWP
Ga0068865_10030193513300006881Miscanthus RhizosphereMDANANGWHGAPIKADDEAKTGRLREEDNAEWRPRPPVPSGLL
Ga0075426_1038558023300006903Populus RhizosphereMDTNANRWHGPRIKADDEAKTGCLREEDNTEWWPRAPVPF
Ga0075424_10030141513300006904Populus RhizosphereMGANANGWHGAPIAAADDAKTGGLGEEGNKEWRPRAP
Ga0075424_10113524313300006904Populus RhizosphereMDANANGQHGVPIKALDEAKTGCLCEESNAEWRVMMPVPSGLRPKW
Ga0079219_1194688433300006954Agricultural SoilMGANANEWHGAPIKADDEAKTGRLGEEDNVEWRTMPLVPFGLLP
Ga0075435_10019289433300007076Populus RhizosphereMGANANGWHGAPIAAADEAKTGGLGEESNKEWRPR
Ga0075435_10094772623300007076Populus RhizosphereMDANANGWHGVPIKTADEAKTERLREENNAEWRAMPPVP
Ga0105250_1054397013300009092Switchgrass RhizosphereMNANANGWHGAPIAAADEAKTRSLGEDSNKEWRPMPPVPFGL
Ga0105240_1168036223300009093Corn RhizosphereMPASANGCHGAPIEALDEAKTGCLCEESNEEWRVKPPVPFGLLPKGPCASLRSLGGL
Ga0111539_1038552533300009094Populus RhizosphereMDANANGWHGAPIEADDEAKTRCLREEDNAEWRPRAPVPFGLLPKTPIAALQ
Ga0111539_1313723823300009094Populus RhizosphereMGANANGWRGAPIEALDEAKTRCLGEECNEEWRPRPPVPFGLLPKTPIAAL
Ga0075418_1182875213300009100Populus RhizosphereMDANANGWHAAPIKADDEVKTRCLHEEDNAEWGRRVPVP
Ga0105247_1007023143300009101Switchgrass RhizosphereMDANANGWHGAPIKADDEAKTRCLREEDNAEWRPRA
Ga0105248_1068721913300009177Switchgrass RhizosphereMDANANGRHGPPIKADDEAKTGRLREENNAEWHRRAPVPFGL
Ga0126374_1044675613300009792Tropical Forest SoilMGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPR
Ga0134063_1024287923300010335Grasslands SoilMGANANGCAGAPIAAADEIKTGGLDEESNKEWRPRAAVRFGLLPQ
Ga0126372_1078861013300010360Tropical Forest SoilMGAYANGCPGAPIKAPDEAKTSGLGEDGNTEWRPRTPV
Ga0126372_1210181123300010360Tropical Forest SoilMGAYANGCPGAPIKAQDEAKTCGLGEDGNTEWRPRTPVPFGLLP
Ga0126379_1095045713300010366Tropical Forest SoilMGAYANERPGAPIKAQDEAKTSGLGEDGNTEWRPR
Ga0134122_1129974623300010400Terrestrial SoilMGANANGRPGAPIATADDAKTRGLGEESNKEWRPR
Ga0134121_1027740533300010401Terrestrial SoilMSANANGWHGAPIKALDEVQTGRLHKESNAEWRPRAPVPFGLLPKKPC
Ga0134123_1078207633300010403Terrestrial SoilMSANANGWHGPPIKADDEAKTGRLREEDNAEWRPRAPVPFGLLPK
Ga0116241_1094572423300010429Anaerobic Digestor SludgeMDANANGWFGAPIKAPDEAKTGRLREEGNAEWRPKPPVPFGLLPKTPGAALRSL
Ga0137364_1107017423300012198Vadose Zone SoilMDANANGWHGAPIAAAHLTNKEAETSGQGEESNKEWRPKP
Ga0137399_1115155813300012203Vadose Zone SoilMSASANEWHGAPIEALDEAKTGRLCEESNEEWHPRTPVPFGLLPCNARVDI
Ga0137370_1054507813300012285Vadose Zone SoilMGAPIKTPILKKSEAKTGRLGEERNAEWRPMPPVPFGLLRKWLCA
Ga0137375_1070178323300012360Vadose Zone SoilMNANANGWHGAPIKALDEAKTGRLREESNAEWRPRPPVPFGLLPK
Ga0157356_100460123300012474Unplanted SoilMDANASGRQGAPIKAPDDAKTGRLGEEGNEEWRSMPPVPFGLPP
Ga0136630_128999413300012529Polar Desert SandMDANANGWPGAPIAAADEAKTCALGEESNKEWRPRAPVPFGLLPKTLIA
Ga0157289_1041175013300012903SoilMDANANGWDGAPIKATDEAKTGRLREEGNAEWRPIPPVPFG
Ga0164300_1074801813300012951SoilMSANANAWHEAPIEARDEAQTGCLREECNEEWRFRAAVPFGLLPKWPFASLQS
Ga0164303_1016241713300012957SoilMDANANGWHGAPIKAADKAKTERLREENNAEWRPMPPVPSGLLPETHIAA
Ga0164303_1089348113300012957SoilMDASANGWHGAQIKALDEAKTGCLCKESDAEGRAKAPVPFGLLPKWPCALLQSLA
Ga0164299_1033177123300012958SoilMDANANGWHGAPIKAADEAKTERLREENNAEWRPMPA
Ga0164304_1138455113300012986SoilMDANANGQHGVPVKALDEAKTGCLCEESNAEWRVMMPVPSG
Ga0164307_1147655813300012987SoilMDANANVWDGAPIKAADEAKTGRLRAENNAEWRPMPHVPSGL
Ga0164306_1066249713300012988SoilMDANANVWDGAPIKAADEAKTGCLRDENNAEWCAMPHVPSGLLPKTPITAL
Ga0164305_1035287633300012989SoilMDVNANVWDGAPIKAADEAKTGRLREENNAEWRPMPHVPSGLLPK
Ga0157373_1130112923300013100Corn RhizosphereMDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFGLLPK*
Ga0157374_1003114543300013296Miscanthus RhizosphereMDANANGWHGAPIKAADEAKTERLREENNAEWRPTAHVPFGLLP
Ga0157372_1123176013300013307Corn RhizosphereMAAKANGRHEAPIKAPDEAKTWRRSEGGNDEWRSR
Ga0157375_1002461793300013308Miscanthus RhizosphereMGANANGWHGPPVKADDEAKTGRLREEDNAEGRPMPPVPF
Ga0157375_1015289133300013308Miscanthus RhizosphereMDANANGWHGVPIKTADEAKTERLRKENNAEWRAMPPVPSGLLPK
Ga0075345_106884023300014312Natural And Restored WetlandsMNTIANERHRAPIAAADDAKAGSLCEERNKEWRPMPLVPFGL
Ga0163163_1091060913300014325Switchgrass RhizosphereMDAIANGWPGAPIATADEAKTGGLGEESNKEWRPRAPVPFG
Ga0157380_1003071343300014326Switchgrass RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPSVPFGLLPK
Ga0157377_1081628913300014745Miscanthus RhizosphereMDANANGRHGAPIKATDEAKTGCLREEGNAEWRPMPPIPFGLLPKTPSAAL
Ga0157376_1149467513300014969Miscanthus RhizosphereMDANANGRIGVPIKTLDEAKTGRLSEESNEEWHPKAPVPFGLQPRN
Ga0132258_10023689143300015371Arabidopsis RhizosphereMDANANGWHGPPIKADDEAKTGRLRKEDNAEWRPRTPVPFGLLPKTPIAALQ
Ga0132258_1038200653300015371Arabidopsis RhizosphereMGVNANGWHGAPIAAADDAKTRGLGEESNKEWRPRTPVPF
Ga0132258_1086300733300015371Arabidopsis RhizosphereMDANANGQHGVPIKALDESKTGYLCEESYAEWRVRMPVPFGLLPKWPC
Ga0132258_1137926713300015371Arabidopsis RhizosphereMGAYANERLGVPIATADEAKTSGLGEESNKEWRPRPRVPFGLLPKTPIAA
Ga0132258_1393004123300015371Arabidopsis RhizosphereMGANANERPGAPIAAADEAKTGGLGEESNKEWRPR
Ga0132257_10170471523300015373Arabidopsis RhizosphereMDANANGWHGPPIKADDEAKTGRLRKEDNEEWRPRTPVPFGLLPKTPIAALQ
Ga0132255_10146163313300015374Arabidopsis RhizosphereMDANANRWHGPPIKADDEAKTERLREKDNTEWRPRSPVPFGLLLKTPI
Ga0132255_10280672013300015374Arabidopsis RhizosphereMGAYANEWHGAPIATADDTKTSSLGEESNKEWRPRAPVPFGLLPKTP
Ga0132255_10332838213300015374Arabidopsis RhizosphereMDANANEWHGAPIVAADDAKTGGLGEESNKEWRPRALVPFGLLPKTPI
Ga0136617_1007555913300017789Polar Desert SandMDANANGCPGAPIAAADEAKTSGLGEESNKEWRPRAPVPF
Ga0163161_1040061513300017792Switchgrass RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLL
Ga0163161_1102043523300017792Switchgrass RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLL
Ga0187779_1002269213300017959Tropical PeatlandMGAYANGRPGAPIKAQDEAKTSGLGEDGNTEWRPRT
Ga0187779_1002797513300017959Tropical PeatlandMGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPFGLLPKTPI
Ga0187779_1056512823300017959Tropical PeatlandMGAYANGCPGAPIKAQDEAKTRGLGEDGNTEWRPRTPVPFGLLP
Ga0187778_1000811313300017961Tropical PeatlandMRANANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPFGLLP
Ga0187778_1027065213300017961Tropical PeatlandMGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPVPF
Ga0187776_1000182413300017966Tropical PeatlandMGADANGRRWVPIKAADEAKTGGLGEESNKEWRPTAPVPS
Ga0187780_1024571313300017973Tropical PeatlandMGAYANGCPGAPIKAQDEAKTSGLGEDGNTEWRPRTPV
Ga0187767_1009987623300017999Tropical PeatlandMGAYANGCPGAPIKAQDEAKTGGLGEDGNTEWRPRTPV
Ga0184621_1034001813300018054Groundwater SedimentMDANANGWHGAPIAAADAAKTSSLGEESNKEWRPMPPVPFGLL
Ga0184623_1018104713300018056Groundwater SedimentMDANANGWHGAPIAAAQLANPEAKTESLGEESNKEWRPRPPVPFGLLPKTPIA
Ga0187765_1032152013300018060Tropical PeatlandMDAYANGWHGPPIEADDEAKTGRLREEDNAEWRPKAPVPF
Ga0187773_1001816913300018064Tropical PeatlandMGADANGRRWVPIKAADEAKTGGLGEESNKEWRPTAP
Ga0187773_1029034013300018064Tropical PeatlandMGADANGRRWVPIKAADEAKTGGLGEESNKEWRPTAPVPFGLLPKTPIAA
Ga0184612_1034736123300018078Groundwater SedimentMNANANGWHGAPIKAPDEAKTGRLREESNAEWRSMMPVPFGLLPK
Ga0184625_1056573023300018081Groundwater SedimentMDTNANGWHGVPIAAADEAKTRSLGKESNKEWHPRAPVPFGLLPKTPV
Ga0207673_102110113300025290Corn, Switchgrass And Miscanthus RhizosphereMDANANGWHGAPIEAADEAKTERLREENNAEWSPMPPVPSGLLPKTPIAALQ
Ga0207697_1010399213300025315Corn, Switchgrass And Miscanthus RhizosphereMGANANGWHGPPGKADDVAKTGRLREEDNAEGRPMPTVPFGLLA
Ga0208851_103566923300025461Arctic Peat SoilMNAIANGWHGAPIAAAQLANEDAKTGGLGEKSNKEW
Ga0207682_1046221113300025893Miscanthus RhizosphereMGAIANGRPGAPIATADEAKTGGLGEESNNEWRPRAPVPFGL
Ga0207699_1058705623300025906Corn, Switchgrass And Miscanthus RhizosphereMDANANGQHGVPIKALDEAKTGCLCEESNAEWRVMM
Ga0207705_1121062623300025909Corn RhizosphereMAAKANGRHEAPIKAPDEAKTVRLSEDGNDEWRSRGPVPSGLLR
Ga0207660_1109411913300025917Corn RhizosphereMGANANQWHGPPIKADDEAKTGRFREEDNAKWRPRTLVPSGLPPKTLG
Ga0207649_1146835123300025920Corn RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLPKTLSAALQSL
Ga0207681_1008509113300025923Switchgrass RhizosphereMGANANGWHGPPGKADDVAKTGRLRKEDNAEGRPMPTVPFGLLPKTLSAP
Ga0207659_1002159913300025926Miscanthus RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGL
Ga0207644_1061821313300025931Switchgrass RhizosphereMGTNAKGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLP
Ga0207709_1125187423300025935Miscanthus RhizosphereMDANANGWHGAPIAAADEAKARSLCEESNKEWRPMPPVPFGLLPKTP
Ga0207670_1132085433300025936Switchgrass RhizosphereMSANANGWHGPPIKADDEAKTGRLREEDNAEWRTRAP
Ga0207669_1036827213300025937Miscanthus RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPM
Ga0207669_1104610313300025937Miscanthus RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPPVPFGLLPKTLSA
Ga0207704_1005060713300025938Miscanthus RhizosphereMDTNANGWDGAPIKATQLPNEEAETWRLREEGNAEWRPMPPGPFGLLPKTPS
Ga0207704_1178787123300025938Miscanthus RhizosphereMDASANGRYGLPIKADDEAKTGRLGKEDNAEWRPRS
Ga0207691_1000760313300025940Miscanthus RhizosphereMGANANGWHGPPGKADDVAKTGRLRKEDNAEGRPMPTVPFGLLPKTLSA
Ga0207691_1025335323300025940Miscanthus RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPM
Ga0207691_1150428623300025940Miscanthus RhizosphereMAAKANGRHEAPIKAPDEAKTVRLSEDGNDEWRSRG
Ga0207711_1074508413300025941Switchgrass RhizosphereMDANANGWHGAPIKADDEAKTRCLREEDNAEWRPR
Ga0207679_1148243913300025945Corn RhizosphereMDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFGLLPKW
Ga0207679_1171407023300025945Corn RhizosphereMGTNANGWHGPPGKADDEAKTGRLREEDNAEGRPMPR
Ga0207651_1069079133300025960Switchgrass RhizosphereMDANANGWHGAPIKADDEAKTRCLREEDNAEWRPRAPVPFGLL
Ga0207651_1105786223300025960Switchgrass RhizosphereMGANANGWHGPPGKADDVAKTGRLRTEDNAEGRPMPPVPFGLLPKTLS
Ga0207651_1153312023300025960Switchgrass RhizosphereMDTNANEWHGAAIAAADDAKTGGLGEECNKEWCPRAIVPFGLL
Ga0207712_1083857913300025961Switchgrass RhizosphereMDANANGWDGAPIKATDEAKTGRLREEGNAEWRPIP
Ga0207668_1006068513300025972Switchgrass RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPP
Ga0207668_1077758713300025972Switchgrass RhizosphereMGANANRWSEAPIKAADEAKTERLREENNAGWRLRPPVPSGLLPKTPSA
Ga0207640_1065829413300025981Corn RhizosphereMDANANGWHGAPIKAADEAKTARLREENNAEWRPMP
Ga0207658_1085292613300025986Switchgrass RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMP
Ga0207658_1182470013300025986Switchgrass RhizosphereMDANANGWHGAPIKALDEAKTGRLCKESNAEWCAKTPVPF
Ga0207702_1017280013300026078Corn RhizosphereMDANANGWHGAPIKALDEAKTGRLGEESNAERRARAPVPFRLPPK
Ga0207702_1092513713300026078Corn RhizosphereMDANANGQHGVPIKALDEAKTGCLCEESNAEWRVMMPVPSGLRPKWPFAS
Ga0207648_1151105223300026089Miscanthus RhizosphereMGANANGRGGVPIAAADDAKTGGLGEESNKEWHAARPVPLGLLPKT
Ga0207676_1161586823300026095Switchgrass RhizosphereMGANANRWSEAPIKAADEAKTERLSEENNAGWRLRP
Ga0207683_1186425813300026121Miscanthus RhizosphereMGANANRWPEAPIKAADEAKTERLREEDNAEWRLRPPVPSGLLP
Ga0207698_1212969223300026142Corn RhizosphereMGTNANGWRGAPIKAADEAKTERLREENNAEWRPM
Ga0209474_1056360423300026550SoilMPANANGWHGAPIKALDEAKTARLSEECNAEWRPMPPVPFGLP
Ga0209073_1003808013300027765Agricultural SoilMDANANGQHGVPIKALDEAKTGCLCEERNAEWRVML
Ga0209073_1046893413300027765Agricultural SoilMSIDANGWHGAPIEALDEAQTGRLREESNEEWRARAPVPFGLLPKWPCASLQSLARRP
Ga0209262_1059439823300027841FreshwaterMDANANGWLGAPIKAPDEAKTGHLREEGNDEWRPKPP
Ga0209496_1002636113300027890WetlandMDANANGWIGAPIKAPDEAKTGRLREEGNDEWRPKPP
Ga0209048_1000988713300027902Freshwater Lake SedimentMDANANGQHGTPIKAPDEAKTGCLREEGNAEWRPRMPVPFGLLP
Ga0268265_1091640813300028380Switchgrass RhizosphereMGANANRWSEAPIKAADEAKTERLSEENNAGWRLRPPVPS
Ga0268265_1139559613300028380Switchgrass RhizosphereMGANANGWHGPPGKADDVAKTGRLRKEDNAEGRPMPTVPFGLL
Ga0268264_1125435723300028381Switchgrass RhizosphereMAANANGRNEAAIKAHDEAKTGRLGEECNEEWRLSAPVPFGLLPKTRIAALQR
Ga0268264_1228410723300028381Switchgrass RhizosphereMGANANGWHGPPGKADDEAKTGRLREEDNAEGRPMPSVPFGL
Ga0302169_1005508213300028679FenMGANANGWHGAPIAAAQLANEEAKTGGLSEDSNKEWRPRTPVPF
Ga0302205_1012063413300028739FenMNAIANGWHGAPIAAADEAKTGSLCEESNKEWRPMPPVPFAQLGQ
Ga0302262_1028800213300028743FenMGAYANGRHGAPIAAADEAKTGGLGEESNKEWRPMASVPFGLLPKTPI
Ga0302263_1014967813300028869FenMGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRASVPFAQLGQLRPKT
Ga0311332_1007813213300029984FenMGANANGWHGAPIAAAQLANEEAKTSGLGEDSNKEWRPRTPV
Ga0311332_1034112613300029984FenMNAIANGWHGAPIAAADEAKTGSLCEESNKEWRPMPPVPFGLL
Ga0311334_1025913913300029987FenMDADANGWPVVPIATADEAKTSGLGEESNKEWRPWPPVP
Ga0311334_1127501723300029987FenMSACANGCHGVPIKALDEAQTGRLREECNAEWRPRAPVPFGLLPKGSCA
Ga0311337_1126553513300030000FenMGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRTP
Ga0311350_1044772313300030002FenMGANANGWHGAAIAAAQLANDEAKTGGLGEKSNKEWRPRTPVPFGLL
Ga0311349_1011873513300030294FenMGANANGWHGAPIAAADEAKTGGLGEDRNKEWRPRTPVPFGLLPK
Ga0311366_1009484813300030943FenMGANANGWHGAPIAAAQLANEEAKTSGLGEDSNKEWRPRTP
Ga0311366_1066337013300030943FenMGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRTPVPFGLLPKTPIAALR
Ga0302323_10291179413300031232FenMGANANGWHGAPIAAADEAKTGGLGEESNKEWRPRT
Ga0311364_1044552723300031521FenMNAIANGWHGAPIAAADEAKTGGLCEESNKEWRPMPPVPFGL
Ga0311364_1119314323300031521FenMNAIANGWHGAPIAAADEAKIGGLGEESNKEWRPMPPVPFGLLPKTPIATLRR
Ga0318534_1042043323300031544SoilMGANANGHNEAPIKVQDEAKTGRLGDECNEEWRLIASVPFGLLPKTPI
Ga0307408_10003009663300031548RhizosphereMDANANGWHGAPIKELDEAKTGRLCEESNDEWRAGTPVPFGLLP
Ga0310886_1070995513300031562SoilMSAYANGCLGPPIKAADEAKTGCLREENNAEWRPKAPVPFGLLPKMPIA
Ga0307468_10166793823300031740Hardwood Forest SoilMGANANGWPEAPIATADEAKTRGLGEESNKEWRLGAPVPFGLLPKAPIA
Ga0307468_10221867613300031740Hardwood Forest SoilMAANASGWLGMPIEAPDEAKTGRLGEKGNEEWRPKQAAPFGLL
Ga0318557_1008801433300031795SoilMGASANGRNEAPIKAHDEAKTGRLGEECNEEWRLSAPIPFGLLPKTRIAALR
Ga0310900_1104714423300031908SoilMDANANGRDGAPIKATQLPNEEAKTGRLREEGNAEWRPMPSVPF
Ga0311367_1113151123300031918FenMDADANGWPVVPIATADEAKTSGLGEESNKEWRPW
Ga0311367_1158981823300031918FenMGANANGWHGAPIAAADEAKTGGLGEESTKEWRPRTPVPFG
Ga0307471_10060879413300032180Hardwood Forest SoilMGTYANGCPGAPIKAQDEAKTGGLGEDGNAEWRPRTPVPFGLLSKTPIA
Ga0307471_10137255923300032180Hardwood Forest SoilMDASANVRHGAPIKALDDAKTGRLGKESNAEWRPMMPVP
Ga0307471_10170905323300032180Hardwood Forest SoilMGANANGWPGAPIAAADEAKTSGLGEERNKEWRPRAPVPFGL
Ga0307471_10281968523300032180Hardwood Forest SoilMGANANGRRGPPIKANDEAKTGRLREEDNAEWRPKAPVPFG
Ga0307472_10051530413300032205Hardwood Forest SoilRLGAPIKAQDEAKTGGLGEGGNAEWRPRTPVPFGLRLCP
Ga0307472_10057189423300032205Hardwood Forest SoilMGAYANGRPGAPIKAQDEAKTRGLGEDGNAEWRPKTPVPFGLLP
Ga0307472_10062099713300032205Hardwood Forest SoilMGANANGRHGPTVKADDDAKTGRLREQDNAEGRPMPPVPFGLLPKTLLCP
Ga0310896_1015120633300032211SoilMFTNANRRYGPPIKALDEAKTGRLCEESNAEWRPMLPV
Ga0315286_1212063913300032342SedimentMSTSANGWHGAPIKALDEAETGCLGEESNAEWRPRAPVPFGL
Ga0335084_1142451713300033004SoilMDANANAWHGPPDKAHDEAKTGRLREEDNAVGRPMPPVPFGLLPKTLSTVL
Ga0310810_1001898083300033412SoilMDANANGWHGAPIKALDEAKTGRLGEESNAEWRFRAPVPFRLPPK
Ga0316625_10024975313300033418SoilMDTNANGWLGAPIKAPDEAKTGRLREEGNAEWRPKPPVPFGLLPKTPG
Ga0326726_1166292613300033433Peat SoilMDASANGRHGAPIKADDEAKTGRLREEDNTEWRPRAPVPFGLLPKTPIAAL
Ga0326726_1238095023300033433Peat SoilMGTNANGWHGPSLKADDKAKTGRLREEDNAEGGLMSPFPFGLLPKT
Ga0316630_1063053513300033487SoilMPTNANGWAGAPIKARDEAKTGRLGEERNAEWRPGAPV
Ga0314862_0004966_1_1233300033803PeatlandMDAYANVRPGAPIKAQDEAKTSGLGEDGNTEWRPRTHVPYG
Ga0364931_0284624_2_1423300034176SedimentMDANANGWAGAPTAAADDAKTGGLGEESNKEWRPRAPVPFAQLCQLR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.