Basic Information | |
---|---|
Family ID | F020775 |
Family Type | Metagenome |
Number of Sequences | 222 |
Average Sequence Length | 45 residues |
Representative Sequence | MSNFLSQLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVA |
Number of Associated Samples | 164 |
Number of Associated Scaffolds | 222 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 67.27 % |
% of genes near scaffold ends (potentially truncated) | 95.95 % |
% of genes from short scaffolds (< 2000 bps) | 94.14 % |
Associated GOLD sequencing projects | 152 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.793 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.261 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.234 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.450 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 222 Family Scaffolds |
---|---|---|
PF06826 | Asp-Al_Ex | 3.15 |
PF12833 | HTH_18 | 3.15 |
PF00465 | Fe-ADH | 2.70 |
PF09720 | Unstab_antitox | 2.25 |
PF07883 | Cupin_2 | 2.25 |
PF00583 | Acetyltransf_1 | 1.80 |
PF01145 | Band_7 | 1.35 |
PF13602 | ADH_zinc_N_2 | 1.35 |
PF01243 | Putative_PNPOx | 1.35 |
PF01850 | PIN | 1.35 |
PF00069 | Pkinase | 1.35 |
PF04255 | DUF433 | 0.90 |
PF14907 | NTP_transf_5 | 0.90 |
PF00903 | Glyoxalase | 0.90 |
PF12796 | Ank_2 | 0.90 |
PF08818 | DUF1801 | 0.90 |
PF07676 | PD40 | 0.90 |
PF08241 | Methyltransf_11 | 0.90 |
PF02518 | HATPase_c | 0.90 |
PF13577 | SnoaL_4 | 0.90 |
PF00561 | Abhydrolase_1 | 0.90 |
PF00756 | Esterase | 0.45 |
PF04960 | Glutaminase | 0.45 |
PF05193 | Peptidase_M16_C | 0.45 |
PF00497 | SBP_bac_3 | 0.45 |
PF00149 | Metallophos | 0.45 |
PF04273 | BLH_phosphatase | 0.45 |
PF11700 | ATG22 | 0.45 |
PF03060 | NMO | 0.45 |
PF00535 | Glycos_transf_2 | 0.45 |
PF16277 | DUF4926 | 0.45 |
PF00486 | Trans_reg_C | 0.45 |
PF00665 | rve | 0.45 |
PF06078 | DUF937 | 0.45 |
PF01435 | Peptidase_M48 | 0.45 |
PF00392 | GntR | 0.45 |
PF07724 | AAA_2 | 0.45 |
PF00182 | Glyco_hydro_19 | 0.45 |
PF08450 | SGL | 0.45 |
PF12146 | Hydrolase_4 | 0.45 |
PF13581 | HATPase_c_2 | 0.45 |
PF11075 | DUF2780 | 0.45 |
PF12098 | DUF3574 | 0.45 |
PF13185 | GAF_2 | 0.45 |
PF00239 | Resolvase | 0.45 |
PF13204 | DUF4038 | 0.45 |
PF01381 | HTH_3 | 0.45 |
PF14535 | AMP-binding_C_2 | 0.45 |
PF07627 | PSCyt3 | 0.45 |
PF02517 | Rce1-like | 0.45 |
PF07819 | PGAP1 | 0.45 |
PF13229 | Beta_helix | 0.45 |
PF07719 | TPR_2 | 0.45 |
PF11376 | DUF3179 | 0.45 |
PF02687 | FtsX | 0.45 |
PF00940 | RNA_pol | 0.45 |
PF07244 | POTRA | 0.45 |
PF13531 | SBP_bac_11 | 0.45 |
PF13544 | Obsolete Pfam Family | 0.45 |
PF02126 | PTE | 0.45 |
PF09948 | DUF2182 | 0.45 |
PF12034 | DUF3520 | 0.45 |
PF15902 | Sortilin-Vps10 | 0.45 |
PF12412 | DUF3667 | 0.45 |
PF07586 | HXXSHH | 0.45 |
COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.41 |
COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 3.15 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 2.70 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 2.70 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 2.70 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 2.70 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.90 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.90 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.90 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.45 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.45 |
COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.45 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.45 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.45 |
COG2066 | Glutaminase | Amino acid transport and metabolism [E] | 0.45 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.45 |
COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.45 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.45 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.45 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.45 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.45 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.45 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.45 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.45 |
COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.45 |
COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.45 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.45 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.45 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
COG5108 | Mitochondrial DNA-directed RNA polymerase | Transcription [K] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.79 % |
Unclassified | root | N/A | 7.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908009|FWIRA_GRAM18401D24AE | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_10602909 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101154456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1061339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300002568|C688J35102_119188066 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300004156|Ga0062589_102677633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300004480|Ga0062592_100112326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1724 | Open in IMG/M |
3300004480|Ga0062592_100489571 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300004480|Ga0062592_101286057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300004643|Ga0062591_100407460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1127 | Open in IMG/M |
3300004643|Ga0062591_100813559 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300005171|Ga0066677_10154294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
3300005176|Ga0066679_10538424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
3300005180|Ga0066685_10517546 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300005289|Ga0065704_10496052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300005290|Ga0065712_10102555 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
3300005290|Ga0065712_10801909 | Not Available | 506 | Open in IMG/M |
3300005294|Ga0065705_10495714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 783 | Open in IMG/M |
3300005295|Ga0065707_10404680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300005295|Ga0065707_10828403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300005328|Ga0070676_11554370 | Not Available | 510 | Open in IMG/M |
3300005332|Ga0066388_103638793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
3300005335|Ga0070666_10290467 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300005354|Ga0070675_100201217 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300005365|Ga0070688_100562116 | Not Available | 869 | Open in IMG/M |
3300005439|Ga0070711_100778896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
3300005456|Ga0070678_100697139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
3300005456|Ga0070678_101852407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 569 | Open in IMG/M |
3300005471|Ga0070698_101235449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300005537|Ga0070730_10438428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → unclassified Desulfovibrio → Desulfovibrio sp. | 842 | Open in IMG/M |
3300005549|Ga0070704_100714738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300005549|Ga0070704_101194138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300005549|Ga0070704_101589855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300005549|Ga0070704_101756505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300005561|Ga0066699_10183888 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300005615|Ga0070702_100244801 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300005764|Ga0066903_107343142 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300005840|Ga0068870_11305704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 529 | Open in IMG/M |
3300005842|Ga0068858_100201174 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
3300005843|Ga0068860_101615072 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300005843|Ga0068860_102449082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300005844|Ga0068862_102553414 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005937|Ga0081455_10490889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300006046|Ga0066652_100093094 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
3300006049|Ga0075417_10743486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300006059|Ga0075017_101245735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300006172|Ga0075018_10589713 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300006796|Ga0066665_10980825 | Not Available | 650 | Open in IMG/M |
3300006797|Ga0066659_11232288 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300006846|Ga0075430_100005884 | All Organisms → cellular organisms → Bacteria | 10354 | Open in IMG/M |
3300006847|Ga0075431_100395529 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300006852|Ga0075433_11607341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300006852|Ga0075433_11612792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300006854|Ga0075425_101253163 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300006854|Ga0075425_101862253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300006854|Ga0075425_103101529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300006871|Ga0075434_100015620 | All Organisms → cellular organisms → Bacteria | 7287 | Open in IMG/M |
3300006876|Ga0079217_10466145 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300006903|Ga0075426_10210444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
3300006903|Ga0075426_10368295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
3300006904|Ga0075424_100261956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 1838 | Open in IMG/M |
3300006904|Ga0075424_100939342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
3300006904|Ga0075424_101333865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300006904|Ga0075424_101543478 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300006904|Ga0075424_102336846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300006969|Ga0075419_11492648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300007004|Ga0079218_10825023 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300007004|Ga0079218_11584782 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300007076|Ga0075435_100081120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2664 | Open in IMG/M |
3300007076|Ga0075435_100321987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1323 | Open in IMG/M |
3300007076|Ga0075435_101116061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300009012|Ga0066710_104087642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300009089|Ga0099828_11700208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300009093|Ga0105240_11717461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 655 | Open in IMG/M |
3300009098|Ga0105245_10384783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1398 | Open in IMG/M |
3300009137|Ga0066709_101798897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 860 | Open in IMG/M |
3300009143|Ga0099792_11135217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300009147|Ga0114129_13207540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300009148|Ga0105243_11160601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300009162|Ga0075423_10499928 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300009176|Ga0105242_13042269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300009177|Ga0105248_11947308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300009177|Ga0105248_12368011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300009177|Ga0105248_12405826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300009177|Ga0105248_13146486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300010360|Ga0126372_10103286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2150 | Open in IMG/M |
3300010361|Ga0126378_12158222 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300010362|Ga0126377_11032537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
3300010366|Ga0126379_10821898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
3300010400|Ga0134122_11351558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
3300010400|Ga0134122_11407444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
3300010401|Ga0134121_11771163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300010401|Ga0134121_12305834 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300010403|Ga0134123_10056625 | All Organisms → cellular organisms → Bacteria | 2972 | Open in IMG/M |
3300010403|Ga0134123_10359735 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300011423|Ga0137436_1090230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300011429|Ga0137455_1189659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300011430|Ga0137423_1056000 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300012159|Ga0137344_1094695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300012189|Ga0137388_10319848 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300012203|Ga0137399_11663936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300012349|Ga0137387_10879508 | Not Available | 648 | Open in IMG/M |
3300012354|Ga0137366_10393175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1010 | Open in IMG/M |
3300012355|Ga0137369_11136099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300012361|Ga0137360_11771872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300012905|Ga0157296_10209658 | Not Available | 628 | Open in IMG/M |
3300012925|Ga0137419_10070036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2333 | Open in IMG/M |
3300012960|Ga0164301_11609424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300012971|Ga0126369_10335813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1527 | Open in IMG/M |
3300012988|Ga0164306_11218302 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012989|Ga0164305_10370238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
3300012989|Ga0164305_11235109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300013306|Ga0163162_10655939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
3300013308|Ga0157375_12058311 | Not Available | 679 | Open in IMG/M |
3300014325|Ga0163163_10260305 | Not Available | 1786 | Open in IMG/M |
3300014325|Ga0163163_10955430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
3300014325|Ga0163163_12108995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300014326|Ga0157380_10330987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1416 | Open in IMG/M |
3300014326|Ga0157380_11434889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300014326|Ga0157380_11863998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300014745|Ga0157377_10429747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
3300015200|Ga0173480_10465194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300015200|Ga0173480_10582440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300015241|Ga0137418_11039658 | Not Available | 588 | Open in IMG/M |
3300015245|Ga0137409_10184158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1890 | Open in IMG/M |
3300015245|Ga0137409_10292263 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
3300015249|Ga0180071_1083556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300015259|Ga0180085_1246673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300015371|Ga0132258_13834216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
3300015371|Ga0132258_13868556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
3300015372|Ga0132256_101753288 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300015372|Ga0132256_102134260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300015372|Ga0132256_103430270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300015373|Ga0132257_103201368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300015373|Ga0132257_104300762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 518 | Open in IMG/M |
3300017997|Ga0184610_1307243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300018027|Ga0184605_10396648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300018067|Ga0184611_1022196 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
3300018084|Ga0184629_10269064 | Not Available | 893 | Open in IMG/M |
3300018084|Ga0184629_10467198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300018468|Ga0066662_12130086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300018482|Ga0066669_10498997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
3300019356|Ga0173481_10368131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300019361|Ga0173482_10094002 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300021363|Ga0193699_10398261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300021559|Ga0210409_11360825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300022756|Ga0222622_10117377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1666 | Open in IMG/M |
3300022756|Ga0222622_10949530 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300024177|Ga0247686_1036987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300025903|Ga0207680_10514997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 853 | Open in IMG/M |
3300025903|Ga0207680_11373149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300025907|Ga0207645_10264161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1140 | Open in IMG/M |
3300025916|Ga0207663_10471514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
3300025922|Ga0207646_10158588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2041 | Open in IMG/M |
3300025922|Ga0207646_10180542 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
3300025922|Ga0207646_11472864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300025925|Ga0207650_11557266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300025930|Ga0207701_10739627 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300025935|Ga0207709_11304337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 600 | Open in IMG/M |
3300025936|Ga0207670_10886109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300025937|Ga0207669_11590161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300025941|Ga0207711_10006236 | All Organisms → cellular organisms → Bacteria | 10061 | Open in IMG/M |
3300025945|Ga0207679_10146888 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
3300025960|Ga0207651_11558880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 595 | Open in IMG/M |
3300026023|Ga0207677_12018078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300026035|Ga0207703_10379998 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300026075|Ga0207708_10377304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
3300026089|Ga0207648_10023914 | All Organisms → cellular organisms → Bacteria | 5461 | Open in IMG/M |
3300026118|Ga0207675_101239628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300026118|Ga0207675_102530023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300026121|Ga0207683_11176974 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300026298|Ga0209236_1163251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
3300027637|Ga0209818_1064404 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300027873|Ga0209814_10390136 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300027873|Ga0209814_10405280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora lupini → Micromonospora lupini str. Lupac 08 | 600 | Open in IMG/M |
3300027873|Ga0209814_10419354 | Not Available | 589 | Open in IMG/M |
3300027882|Ga0209590_10251481 | Not Available | 1128 | Open in IMG/M |
3300027886|Ga0209486_10066681 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
3300028381|Ga0268264_11747690 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300028381|Ga0268264_11808010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300028587|Ga0247828_11034304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300028587|Ga0247828_11154901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300028807|Ga0307305_10305343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300028885|Ga0307304_10582914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300031538|Ga0310888_10381478 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300031547|Ga0310887_10136189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1269 | Open in IMG/M |
3300031547|Ga0310887_10207924 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300031547|Ga0310887_10383998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
3300031547|Ga0310887_10467055 | Not Available | 755 | Open in IMG/M |
3300031547|Ga0310887_10793272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300031682|Ga0318560_10728362 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300031716|Ga0310813_10952447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
3300031720|Ga0307469_11045786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300031731|Ga0307405_11091989 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031740|Ga0307468_101426167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300031744|Ga0306918_10982020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300031820|Ga0307473_10468440 | Not Available | 843 | Open in IMG/M |
3300031824|Ga0307413_10148949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
3300031852|Ga0307410_11986078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300031854|Ga0310904_10737444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
3300031854|Ga0310904_11334486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300031854|Ga0310904_11349053 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300031858|Ga0310892_10293528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
3300031858|Ga0310892_10821487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300031908|Ga0310900_11056600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300031911|Ga0307412_11570888 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300031943|Ga0310885_10248139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
3300032000|Ga0310903_10550168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300032002|Ga0307416_100263083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 1687 | Open in IMG/M |
3300032013|Ga0310906_10890358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300032017|Ga0310899_10145263 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300032075|Ga0310890_11380250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300032126|Ga0307415_101562733 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300032157|Ga0315912_10375921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1124 | Open in IMG/M |
3300032180|Ga0307471_101287131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella | 894 | Open in IMG/M |
3300032180|Ga0307471_102459594 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300032180|Ga0307471_104200938 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300033551|Ga0247830_10315259 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300034150|Ga0364933_016931 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
3300034690|Ga0364923_0070211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.31% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.70% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.70% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.70% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.70% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.25% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.25% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.80% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.35% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.35% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.90% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.90% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015249 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10D | Environmental | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRA_01664360 | 2124908009 | Soil | MPNFLSQLSKSEQARLLEELNYMNLEEIRGFCSARRI |
ICChiseqgaiiFebDRAFT_106029091 | 3300000363 | Soil | MPNPLSKLTKGERTRLLEEMNYLNLAEIRGFCSARGIPYKI |
INPhiseqgaiiFebDRAFT_1011544561 | 3300000364 | Soil | MSNFLSQLTKSERVRLFEELNYMNLQEIRGFCSDRGIPYRIVAEYSNG |
AP72_2010_repI_A100DRAFT_10613392 | 3300000837 | Forest Soil | VTNFLSQLTKSERARLLEELNYLNLEEIRGFCSERGIPFRIVAE |
C688J35102_1191880661 | 3300002568 | Soil | MSNFLSALTNVERTRLLKELNYMNLEEIRGFCAERGIPYRIVGEYPN |
Ga0062589_1026776332 | 3300004156 | Soil | MSNFLSQLTASERARLLEELNYMNLEEIRGFCSVRGIPYRIMAES |
Ga0062592_1001123261 | 3300004480 | Soil | MSNFLAQLTASKRARLLEELNYVNLEEIRGFCSERGIPYRILAESADGK |
Ga0062592_1004895712 | 3300004480 | Soil | MSNFLSQLTKSERARLLEEMNYMNLEEIRGFCSERAIPYRIVAEYSN |
Ga0062592_1012860571 | 3300004480 | Soil | MPDFLARLTKAVQSQLFEEMNYMNLEEIRGFCSERGIPYRIVIADPDG |
Ga0062591_1004074601 | 3300004643 | Soil | MSNFLSQLTASERARLLEELNYMNLEEIRGFCSVRGIPYRI |
Ga0062591_1008135591 | 3300004643 | Soil | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCSERAIPYRIVAE |
Ga0066677_101542943 | 3300005171 | Soil | MANLLSQLTKDTQARFLEELNYLNLEEIRGFCSDRGIPYKILAEYPN |
Ga0066679_105384241 | 3300005176 | Soil | MSNFLSQLTASERARLLKELNYMNLEEIRGFCSERGIPYRIMAESADG |
Ga0066685_105175463 | 3300005180 | Soil | MSNFLSQLTKSEQARLLEDLNYMNLEESRGFCSERGIPYRIVAEY |
Ga0065704_104960521 | 3300005289 | Switchgrass Rhizosphere | MSNLLAQLTKTEQARFLEELNYMNLQEIRGFCSARGIPYRIVAEYPDG |
Ga0065712_101025554 | 3300005290 | Miscanthus Rhizosphere | MANYLSQLTASERARLLEELNYMNLEEIRGFCLTRAIPYRIV |
Ga0065712_108019091 | 3300005290 | Miscanthus Rhizosphere | VKRRNPLSQLTKTEQARLLEELNYMNLEEIRGFCSARGIPFR |
Ga0065705_104957141 | 3300005294 | Switchgrass Rhizosphere | MSNFLAQLTTSERARFLEELNYMNLEEIRGFCSARAIPYRIVAESS |
Ga0065707_104046801 | 3300005295 | Switchgrass Rhizosphere | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCSERAIPYRIVAEY |
Ga0065707_108284032 | 3300005295 | Switchgrass Rhizosphere | MSNFLSQLTASARARLLEELNYMNLEEIRGFCSARGIPYRI |
Ga0070676_115543702 | 3300005328 | Miscanthus Rhizosphere | VKRRNPLSQLTKTEQARLLEELNYMNLEEIRGFCSARGIPFRI |
Ga0066388_1036387932 | 3300005332 | Tropical Forest Soil | MPNFLSKLTKGEQARLLEELNYMNLDEIRGFCVPRGIPYKIV |
Ga0066388_1058137652 | 3300005332 | Tropical Forest Soil | VPNLLSQLTKDEQAQLLEELNYMNLEEIRGFCSDRGIPYKIMARYP |
Ga0070666_102904673 | 3300005335 | Switchgrass Rhizosphere | MTRNSTLLSRIPKGEQARLFEKLNYMNLEEIRGFCAAHGIPYRIL |
Ga0070675_1002012173 | 3300005354 | Miscanthus Rhizosphere | MSNPLSKLTKGERTRLLEELNYLNLAEIRGFCSARGIPYKIL |
Ga0070688_1005621162 | 3300005365 | Switchgrass Rhizosphere | VKRRNPLSQLTKTEQARLLEELNYMNLEEIRGFCSARGIPFRIVADYPN |
Ga0070711_1007788962 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNFLSQLAASERARLLEELNYMNLEEIRGFCSARAIPYR |
Ga0070678_1006971391 | 3300005456 | Miscanthus Rhizosphere | MANMLSQLTRAEQARLLEELNYMNLEEIRAFCAARAIPFR |
Ga0070678_1018524072 | 3300005456 | Miscanthus Rhizosphere | MTNFLSKLTKGEQSRLLEELNCMNLEEIRGFCFPRGIPYKIVAEYSNGKIKTT |
Ga0070698_1012354491 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLLSQLNKEKQARLLEDLNYMNMEEIRGFCSARGIPYKILAEYPNGKVKATKDTD |
Ga0070730_104384282 | 3300005537 | Surface Soil | MPNFLSQLTKSKQARLLEELNYMNLEEIHGFCSARGIPYRVVAE |
Ga0070704_1007147384 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNFLAQLTTSERARLLEELNYMNLEEIRGFCSARGIPYRIVAESSNGT* |
Ga0070704_1011941381 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLLSQLTKSERARLLEELNYMNLEEIRGFCSARAIPYRIVAESSNGK |
Ga0070704_1015898552 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKFLSQLTKSGKHEELNYMNLEEIRGFCSARGIPYRIVAESSNGT |
Ga0070704_1017565052 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSARAIPYRIVAESSNGKVKATKD |
Ga0066699_101838881 | 3300005561 | Soil | MSNFLSQLTASERARLLKELNYMNLEEIRGFCSERGIPYRIMAESADGKVKATKD |
Ga0070702_1002448013 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVLSRLTRAERTRLLEEMNYMNLEEIRGFCSARGIPYRIVAERPNGKVTATKDTD |
Ga0066903_1073431422 | 3300005764 | Tropical Forest Soil | MPNFLSQLANSEQARFLEELNYMNLEEIRGFCSERGIPYRIVAEYSNGKVKA |
Ga0068870_113057041 | 3300005840 | Miscanthus Rhizosphere | MPNLLARLSRSEQARLLEELNYMNLDEIHGFCSARGIPFKVMAESPNGKVRATK |
Ga0068858_1002011744 | 3300005842 | Switchgrass Rhizosphere | MSNFLSQLTASARARLLEELNYMNLEEIRGFCSERGIPYRIMAES |
Ga0068860_1016150721 | 3300005843 | Switchgrass Rhizosphere | MPNLLSQLNKDERARLLDELNYMNMEEIRGFCTARGISYRILAE |
Ga0068860_1024490821 | 3300005843 | Switchgrass Rhizosphere | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCSER |
Ga0068862_1025534142 | 3300005844 | Switchgrass Rhizosphere | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCSERGI |
Ga0081455_104908891 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPNFLSKLTTSERARFLEELNYMNLEEIRGFCAPRGIPYKIVAEYSNGRVR |
Ga0070717_116435642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLLSQLTRDAKAQFFEELNYMNLEEIRGFCSNRGIPYKILAE |
Ga0066652_1000930943 | 3300006046 | Soil | MSNFLSQLTKGEQTRLLEDLNYMNLEEIRGFCAQRGIPYRIVAEYPNGKVKATKD |
Ga0075417_107434862 | 3300006049 | Populus Rhizosphere | MPNFLSQLTKGEQARLFEELNYMNLEEIRGFCSAR |
Ga0075017_1012457353 | 3300006059 | Watersheds | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCSERGIPYRIVAESSNGKVKAT |
Ga0075018_105897132 | 3300006172 | Watersheds | MSNFLAQLTASERARLLEELNYMNLEEIRGFCSERG |
Ga0066665_109808251 | 3300006796 | Soil | MSNFLSQLTTSERPRLLEEVNYMNLEEIRGFCSKHGIP |
Ga0066659_112322881 | 3300006797 | Soil | MSLLSQLSKDEQLLLFTELNYLNLGEIRGFCSERGI |
Ga0075430_1000058841 | 3300006846 | Populus Rhizosphere | MSNFLSQLTASERTRLLEELNYMNLEEIRGFCSERGI |
Ga0075431_1003955293 | 3300006847 | Populus Rhizosphere | MSNFLSQLTASERARLLEELNYMNLEEIRGFCSERGI |
Ga0075433_116073412 | 3300006852 | Populus Rhizosphere | MSNFLLRLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAAYA |
Ga0075433_116127922 | 3300006852 | Populus Rhizosphere | MSNFLSQLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAAYA |
Ga0075425_1012531632 | 3300006854 | Populus Rhizosphere | MANFLSQLTKSERARLLEELNYMNLEEIRGFCSERA |
Ga0075425_1018622531 | 3300006854 | Populus Rhizosphere | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSARAIPYR |
Ga0075425_1031015292 | 3300006854 | Populus Rhizosphere | MPNLLSQLTKDAQARFLEELNYLNLEEIRGFCSDR |
Ga0075434_1000156201 | 3300006871 | Populus Rhizosphere | MPNFLSKLTKGEQTRLLEELNYMNLEEIRGFCVPRGIPYKIVAEYSNGKIRATKDTD |
Ga0079217_104661452 | 3300006876 | Agricultural Soil | MSNVLAQLTANERARLLEELNYMNLEEIRGFCLARVIPYRI |
Ga0075426_102104441 | 3300006903 | Populus Rhizosphere | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSARAI |
Ga0075426_103682952 | 3300006903 | Populus Rhizosphere | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSAR |
Ga0075424_1002619563 | 3300006904 | Populus Rhizosphere | MSNFLLRLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAAYANGKVKAT |
Ga0075424_1009393422 | 3300006904 | Populus Rhizosphere | MSNFLSQLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVA |
Ga0075424_1013338652 | 3300006904 | Populus Rhizosphere | MSNFLSQLTKIERARLLEELNYMNLEEIRGFCSARAIPYRI |
Ga0075424_1015434781 | 3300006904 | Populus Rhizosphere | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSARAIPYRIVAESSN |
Ga0075424_1023368461 | 3300006904 | Populus Rhizosphere | MSNFLSQLTKSEHARLLEELNYMNLEEIRGFCSERGIPYRIVAAYANGKVKAT |
Ga0075419_114926481 | 3300006969 | Populus Rhizosphere | MSNRLSRLTKSERARLLEELNYMNLEEIRGLCSARAIPYRIVAEYSNGK |
Ga0079218_108250231 | 3300007004 | Agricultural Soil | MSNLLSQITKNEQALLLEGLNYMNLEEIRGFCSERGIPYRIVAEYP |
Ga0079218_115847821 | 3300007004 | Agricultural Soil | MVNFLSQLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAEYANGK |
Ga0075435_1000811201 | 3300007076 | Populus Rhizosphere | MSNFLSQLTTRERARLLEELNYMNLEEIRGFCSARAIPYRIVAESSNGKV |
Ga0075435_1003219871 | 3300007076 | Populus Rhizosphere | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSARAIPYRIVAESSNGKV |
Ga0075435_1011160611 | 3300007076 | Populus Rhizosphere | MSNFLSQLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAAY |
Ga0066710_1040876422 | 3300009012 | Grasslands Soil | MLNFLSQLTKAGQARLLEELNYMNLEEIRDFCAARRIPYKILAGSPNGKVT |
Ga0099828_117002081 | 3300009089 | Vadose Zone Soil | MTNLLSQLTKDAQARFLEELNYMNLEEIHGFCSDRG |
Ga0105240_117174611 | 3300009093 | Corn Rhizosphere | MSMSNFLSQLTTSERARLLEELNYMNLEEIRAFCSARAIPYRI |
Ga0105245_103847831 | 3300009098 | Miscanthus Rhizosphere | MSMSNFLSQLTTSERARLLEELNYMNVEEIRGFCSARAIPYRIVAESSNGKVKATKD |
Ga0066709_1017988971 | 3300009137 | Grasslands Soil | MPNFLSQLTKGEQARLLEELNYMNLEEIRGFCSARGIPYKIMAEYPN |
Ga0099792_111352172 | 3300009143 | Vadose Zone Soil | MSNFLSRLTKSECARLLEELNYMNLEEIRLLCSERAIPYRIVAEYSNGKVKAT |
Ga0114129_132075402 | 3300009147 | Populus Rhizosphere | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSARAIPYRIVAESSNGKVK |
Ga0105243_111606012 | 3300009148 | Miscanthus Rhizosphere | MPNVLSQLTNSEQARLLDELNYMNLEEIRGFCSARGIPYRIVAESSNGT* |
Ga0075423_104999283 | 3300009162 | Populus Rhizosphere | MTNFLSKLTKGEQSRLLEELNYMNLEEIRGFCFPRGIPYKIVAEYSNGKIKTTKDTDR |
Ga0105242_130422693 | 3300009176 | Miscanthus Rhizosphere | LSNFLSQLTASERARLLDELNYMNLEEIRGFCSERGIPYRIMAESADGKVKA |
Ga0105248_119473083 | 3300009177 | Switchgrass Rhizosphere | MPNFLSQLTKGEQARLLEELNYTNLEEIRGFCSARGIPYRVMVEYPNGKVKAT |
Ga0105248_123680111 | 3300009177 | Switchgrass Rhizosphere | MPNFLPQLAARERARLLEELNYMNLAEIRSFCSVRGIPYRI |
Ga0105248_124058262 | 3300009177 | Switchgrass Rhizosphere | MSNFLSQLTVSERARLFEELNYMNLEEIRGFCSVRGIPYRIMAESLDG |
Ga0105248_131464861 | 3300009177 | Switchgrass Rhizosphere | MSNFLSQLTTSERARLLEALNYMNLEEIRGFCSARAIPYRIVAES |
Ga0126372_101032861 | 3300010360 | Tropical Forest Soil | MPNFLSKLNRGERARLLEELNYMNLDEIRGFCVPWGIP |
Ga0126378_121582221 | 3300010361 | Tropical Forest Soil | MPDLLSKLSKVERARLLEEMNYLNLEELRGFCSERGIPYKIM |
Ga0126377_110325371 | 3300010362 | Tropical Forest Soil | MANFLSQLVKSEQERLLEELNYTNLEEIRSFCSARGIPYRIVAQYADGKV |
Ga0126379_108218982 | 3300010366 | Tropical Forest Soil | MSNFLSQLTTSERARLLEELNYMNLEEIRGFCSARAIPY |
Ga0134122_113515581 | 3300010400 | Terrestrial Soil | MSNFLSQLTPSARARLLEELNYMNLEEIRGFCSERGIPY |
Ga0134122_114074441 | 3300010400 | Terrestrial Soil | MSNFLSRLTKSERARLLEELNYMNLEEIRGFCSERAIP |
Ga0134121_117711632 | 3300010401 | Terrestrial Soil | MSNFLSQLTSGEQGRLLEEMNYMNLEEIRAFCAARGIPYK |
Ga0134121_123058342 | 3300010401 | Terrestrial Soil | MSNFLSALTNVERTRLFGELNYMNLEEIRGFCSERGIPYRIVAEYPN |
Ga0134123_100566254 | 3300010403 | Terrestrial Soil | MPNVLSQLTKSEQARLLEELNYMNLEEIRGFCSARGIPYRIVAESSNGT* |
Ga0134123_103597351 | 3300010403 | Terrestrial Soil | MNVLSRLTRAERTRLLEEMNYMNLEEIRGFCSARGIPYRIVAERRNGKVTATKDTD |
Ga0137436_10902302 | 3300011423 | Soil | LNKSNFLSQLTERERARLLQELNYMNLEEIRGFCSERGIPYRI |
Ga0137455_11896592 | 3300011429 | Soil | MKRMSNFLSQLTARARARLLEELNYMNLEEIRGFCSVRGIPYRIMAESADGKV |
Ga0137423_10560003 | 3300011430 | Soil | MPNFLSKLTQGEQARLLEELNYMNLDEIRGFCRPRGIPYKIVAE |
Ga0137344_10946951 | 3300012159 | Soil | LNKSNFLSQLTASERARLLEELNYMNLEEIRGFCSERGIPYRITAESADGTVKATKDT |
Ga0137388_103198483 | 3300012189 | Vadose Zone Soil | MSNFLSRLTASERARLLEELNYMNLEEIRGFCSERGIPYRIMAESADGKVKA |
Ga0137399_116639361 | 3300012203 | Vadose Zone Soil | MPNPLSQLTKDAQARFLEELNYLNLEEIRGFCSDRGIPYKILAEYPNGKM |
Ga0137387_108795081 | 3300012349 | Vadose Zone Soil | MSNFLSQLSASERARLLKELNYMNLEEIRGFCSERGI |
Ga0137366_103931751 | 3300012354 | Vadose Zone Soil | MSNFLSQLTASERARLLKELNYMNLEEIRGFCSERGIPYRIM |
Ga0137369_111360991 | 3300012355 | Vadose Zone Soil | MNFLSRLTTSEQARLLEELNYMNLEEIRGFCSERAIPYRIVAEYSN |
Ga0137360_117718722 | 3300012361 | Vadose Zone Soil | MSNFLSQLTKGEQARLLEELNYMNLEEIHVFCSERGIPYRIVAEY |
Ga0157296_102096582 | 3300012905 | Soil | MPNPLSKLTKGERTRLLEELHYMNLEEIRAFCEGQIA |
Ga0137419_100700361 | 3300012925 | Vadose Zone Soil | MSNFLSQLTASERARLLKELNYMNLEEIRGFCSERGIPY |
Ga0164301_116094242 | 3300012960 | Soil | MSNFLSQLTASDRARLLEELNYMNLEEIRGFCSERGIPYRIVAESANGKVKAT* |
Ga0126369_103358134 | 3300012971 | Tropical Forest Soil | MPNFLSKLTKDEQARLLEELNYMNLDEIRGFCVPRG |
Ga0164306_112183022 | 3300012988 | Soil | MPNLLSPLTARERTRLLEELNYMNLEEIRGFCSARGIPYRIVAEYPGGKVKV |
Ga0164305_103702381 | 3300012989 | Soil | MSNFLSQLTASERARLLEELNYMNLEEIRGFCSVRGIPYRIMAESAEGKVKATKDTD |
Ga0164305_112351092 | 3300012989 | Soil | MPNFLSKLTKGEQARLLEELNYMNLDEIRGFCVPRGIPYRIVA |
Ga0163162_106559392 | 3300013306 | Switchgrass Rhizosphere | MPNMLLQLTRAEQAQLLEELNYMNIEEIRAFCAARAIPFRIVAEHSNGKVKA |
Ga0157375_120583112 | 3300013308 | Miscanthus Rhizosphere | MPNPLSKLTKGERTRLLEELNYLNLAEIRGFCSARG |
Ga0163163_102603053 | 3300014325 | Switchgrass Rhizosphere | MSNLLSQLTKSERARLLEDLNYLNLEEIRDFCSKHG |
Ga0163163_109554303 | 3300014325 | Switchgrass Rhizosphere | MANFLSQLTKSERARLLEELNYMNLEEIRGFCSERAIPYRIVAEY* |
Ga0163163_121089952 | 3300014325 | Switchgrass Rhizosphere | MSNFLSQLGKREQARLLEELNYMNLEEIRGFCSTRGIPYRIVAEDANGRVKPTQD |
Ga0157380_103309873 | 3300014326 | Switchgrass Rhizosphere | MSNFLSQLTTTERARFLEELNYMNLEEIRGFCSVRAIPYRIVAESSNGKVKAT |
Ga0157380_114348891 | 3300014326 | Switchgrass Rhizosphere | MSNVLAQLTTSERARLLEELNYMNLEEVRGFCSARAIP |
Ga0157380_118639982 | 3300014326 | Switchgrass Rhizosphere | MPSLLSQLTKGERARLLEEMNYLNLAEIRGFCSARGIPYKILA |
Ga0157377_104297472 | 3300014745 | Miscanthus Rhizosphere | MSNLLSQLTASARARLLEELNYMNLEEIRGFCSERGIPYRIVVESADG |
Ga0173480_104651941 | 3300015200 | Soil | MSNLLSQLSKGERARLLEELNYMNLEEIRGFCSTRGIPYRV |
Ga0173480_105824401 | 3300015200 | Soil | MPNMLSQLTRAEQAQLLEELNYMNIEEIRAFCAARAIPFRIVAEH |
Ga0137418_110396581 | 3300015241 | Vadose Zone Soil | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCAERGIPYRIVAES |
Ga0137409_101841581 | 3300015245 | Vadose Zone Soil | MSNFLSQLTASERARLLKELNYMNLEEIRGFCSERGIPYRIMA |
Ga0137409_102922631 | 3300015245 | Vadose Zone Soil | MSNFLSRLTASERARLLEELNYMNLEEIRGFCSERGIPYRIMA |
Ga0180071_10835561 | 3300015249 | Soil | MSNFLSQLTASERARLLEELNYMNLEEICGFCSERGIPYRIMAESADGKVKATKD |
Ga0180085_12466732 | 3300015259 | Soil | MSNFLSQLTASARARLLEELNYMNLEEIRGFCSERGIS* |
Ga0132258_138342162 | 3300015371 | Arabidopsis Rhizosphere | MPNFLSKLTKGEQARLLEELNYMNLDEIRGFCVPRGIPYRIVAEYSSGKVKATKHT |
Ga0132258_138685563 | 3300015371 | Arabidopsis Rhizosphere | MPNFLAKLTKGEQARLLEELNYMNLEEIRGFCVPRGIPYKIVA |
Ga0132256_1017532882 | 3300015372 | Arabidopsis Rhizosphere | MANFLSQLTKSERARLLEELNYMNLEEIRGFCSER |
Ga0132256_1021342602 | 3300015372 | Arabidopsis Rhizosphere | MPDLLARLTSGEQARFLEELNYLNLEEIRGFCSRR |
Ga0132256_1034302702 | 3300015372 | Arabidopsis Rhizosphere | MWMPNFLSQLTISERDRLLEELNYMNLEEIRGFCSERAIPY |
Ga0132257_1032013681 | 3300015373 | Arabidopsis Rhizosphere | MSNLLSQFTKSERTRLLEELNYMNLEEIRGFCSER |
Ga0132257_1043007622 | 3300015373 | Arabidopsis Rhizosphere | MNVLSRLTRAERTRLLEELNYLNLEEIRGFCSARG |
Ga0184610_13072431 | 3300017997 | Groundwater Sediment | MSNFLSQLSASERARLLEELNYMNLEEIRGFCSEHGIPYRIVA |
Ga0184605_103966481 | 3300018027 | Groundwater Sediment | MSNFLSQLTASERARLLEELNYMNLEEIRGFCSERGIPYRIVAESADGKVKATKD |
Ga0184611_10221964 | 3300018067 | Groundwater Sediment | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCSERAI |
Ga0184629_102690641 | 3300018084 | Groundwater Sediment | MSNLLLQLTASERARLLEELNYMNLEQIRGFCSVRGIPYRIMAES |
Ga0184629_104671981 | 3300018084 | Groundwater Sediment | MSNLLSKLTKGEQARLLEELNYMNLAEIRGFCSARGIPHRIVAEYPNGK |
Ga0066662_121300861 | 3300018468 | Grasslands Soil | MSNFLSQLTASERARLLEELNYMNLEEIRSFCSERGIPYRIMAESAAGKVKATKDTDR |
Ga0066669_104989973 | 3300018482 | Grasslands Soil | MPDFLSQLTKGEQARLLEELNYMNLEEIRGFCSARGIPYKIMAEY |
Ga0173481_103681312 | 3300019356 | Soil | MSNFLSQLTIRERERLLEELNYMNLEEIRGFCSERAIPYRIVAECSNGKVKATKDTDR |
Ga0173482_100940021 | 3300019361 | Soil | MPNLLSQLTKGERTRLLEELNYMNLEEIRDFCSKRGIP |
Ga0193699_103982612 | 3300021363 | Soil | MPNFLSQLTKSEPARLLEELNYLNLEEIRGFCSVRGI |
Ga0210409_113608252 | 3300021559 | Soil | MSNSLSQLTASERALLLEELNYMNLEEIRGFCSVRGIPHRIMAESADGKVKATKDTD |
Ga0222622_101173773 | 3300022756 | Groundwater Sediment | LNKSNFLSQLTTSERARLLEELNYMNLEEIRGFCSVRGIPYRIMAESADGKVKATK |
Ga0222622_109495301 | 3300022756 | Groundwater Sediment | MSNLLSQLTRTEQARLLEEMNYMNLEEIRGFCSERGIPYRIVA |
Ga0247686_10369871 | 3300024177 | Soil | MSNLLSQLTTSERARLLEELNYMNLEEIRGFCSARAIPYRIVAELSN |
Ga0207680_105149973 | 3300025903 | Switchgrass Rhizosphere | MPNFLSKLTKGEQARLLEELNYMNLDEIRGFCVPRGI |
Ga0207680_113731491 | 3300025903 | Switchgrass Rhizosphere | MSNFLSKLTASERARLLEELNYMNLEEIRGFCSEREIPYRIMAESA |
Ga0207645_102641613 | 3300025907 | Miscanthus Rhizosphere | MPNVLSQLTKSEQARLLEELNYMNLEEIRGFCSARGIPYRI |
Ga0207663_104715142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNSLSQLTKSERARLLDELNYMNLEEIRGFCSERGIPYRIVAESPSGKLKA |
Ga0207646_101585881 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNLLSQLNKEKQARLLEDLNYMNMEEIRGFCSARGIPYKILAEYPNGKVKATKDTDR |
Ga0207646_101805423 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNFLSPLTKSEQTRLLEELNYMNLAEIRGFCSERGIPYRIVAEYPNGKLKAT |
Ga0207646_114728641 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNFLSQLTTRERARLLEELNYMNLEEIRGFCSARAIPYR |
Ga0207650_115572662 | 3300025925 | Switchgrass Rhizosphere | VKATRRDRNVLSQLDEAGQARLLEELNYMNLEEIRGFCSERGIPYRVMAEHPDG |
Ga0207701_107396271 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNFLSKLTQGEQARLLEELNYMNLDEIRGFCRPRGIPYKIVAEYSNGRIKAT |
Ga0207709_113043372 | 3300025935 | Miscanthus Rhizosphere | MNVLSQLTTAERTRLLEELNYMNLEEIRGFCSARGIPYRIVA |
Ga0207670_108861091 | 3300025936 | Switchgrass Rhizosphere | MPNLLSKLTESEQARLLEEVNYMNLGEIRGFCSPRGIPYKIVAEYPN |
Ga0207669_115901611 | 3300025937 | Miscanthus Rhizosphere | MSNLLSRLTKSEQARLLEELNYMNLEEIRGFCSARGIPYRIVAEYPN |
Ga0207711_100062361 | 3300025941 | Switchgrass Rhizosphere | MSNVLAQLTTSERARLLEELNYMNLEEVRGFCSARAIPFR |
Ga0207679_101468882 | 3300025945 | Corn Rhizosphere | MSNLLSQLTASARARLLEELNYMNLEEIRGFCTKRGIPYRIVAESADGTVKAT |
Ga0207651_115588802 | 3300025960 | Switchgrass Rhizosphere | MSNFLSQLTISERERLLEELNYMNLEEIRGFCSERAI |
Ga0207677_120180782 | 3300026023 | Miscanthus Rhizosphere | LYSILSQLTASERARLLEDLNYMNLEEIRGFCSARGIPYRIMAESANGKVKATKDTD |
Ga0207703_103799982 | 3300026035 | Switchgrass Rhizosphere | MSNFLSQLTASARARLLEELNYMNLEEIRGFCSARGIPYRIMAESVDGKVKATKDTD |
Ga0207708_103773043 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNFLAQLTTSERARLLEELNYMNLEEIRGFCSARGIPYRIVAESSNGT |
Ga0207648_100239141 | 3300026089 | Miscanthus Rhizosphere | MSNLLSQLTASARARLLEELNYMNLEEIRGFCSERGIPYRIVME |
Ga0207675_1012396283 | 3300026118 | Switchgrass Rhizosphere | MPNFLSKLTQGEQARLLEELNYMNLDEIRGFCRPR |
Ga0207675_1025300231 | 3300026118 | Switchgrass Rhizosphere | MSNFLSQLTASARARLLEELNYMNLEEIRGFCSARGIPYRIMAESADGKVKATKDTDR |
Ga0207683_111769742 | 3300026121 | Miscanthus Rhizosphere | MSNFLSVLTKSEQARLLEELNYMNLEEIRGFCSERGIPYKIVAEYANGKVKS |
Ga0209236_11632512 | 3300026298 | Grasslands Soil | MIRMTNLLSQLTKDEQARLLEELNYLNLGEIRGFCSERGIP |
Ga0209818_10644041 | 3300027637 | Agricultural Soil | MANLLSQLTKSEQARLLEEMNYMNLEEIRGFCSARGIPYKIVAEYPNGRVK |
Ga0209814_103901361 | 3300027873 | Populus Rhizosphere | VNFLSQLTKSEQARLLEELNYMNLEEIRGFCSEHGIPYR |
Ga0209814_104052802 | 3300027873 | Populus Rhizosphere | MPNFLSQLTKGEQARLLEELNYMNLEEIRGFCSARGIPYK |
Ga0209814_104193541 | 3300027873 | Populus Rhizosphere | MSNFLSQLTKSERAQLLGELNYMNLEEIRGFCSERGIPYR |
Ga0209590_102514811 | 3300027882 | Vadose Zone Soil | MSNFLSQLTASERARLLEELNYMNLEEIRGFCSERGIPYRIMAESADGTVKATKDT |
Ga0209486_100666812 | 3300027886 | Agricultural Soil | MPNLLSQLAKGEQTRLLEELNYMNLEEIHGFCSAHGIPFKVLAEHSDGKVK |
Ga0268264_117476901 | 3300028381 | Switchgrass Rhizosphere | MPNLLSQLNKDERARLLDELNYMNMEEIRGFCTARGISYRILAEYPNGK |
Ga0268264_118080102 | 3300028381 | Switchgrass Rhizosphere | MSNFLSQLTKSERARLLEELNYMNLEEIRGFCSERAIPYRIVAEYSNGKVKATKDT |
Ga0247828_110343042 | 3300028587 | Soil | MSNFLSQLTISERERLLEELNYMNLEEIRGFCSQRGIPYRIMAESA |
Ga0247828_111549012 | 3300028587 | Soil | MANMLSQLTRAEQARLLEELNYMNLEEIRAFCAAHAIPFR |
Ga0307305_103053432 | 3300028807 | Soil | MSNFLSQLTKSERARLLGELNYMNLEEIRGFCSERG |
Ga0307304_105829141 | 3300028885 | Soil | MSNFLSQLTASERARLLEELNYMNLEEIRGFCSVRGIPYRIMAESADGKVKATKDT |
Ga0310888_103814782 | 3300031538 | Soil | MSNFLSQLTASERARLLEDMNYLNLEEIRGFCTQRGIPYRIMAESGDGKVKATK |
Ga0310887_101361893 | 3300031547 | Soil | MSNFLSQLTTNERERLLEELNYMNLEEIRGFCSERAIPYRIVAEYS |
Ga0310887_102079241 | 3300031547 | Soil | MPNFLAKLTKGEQARLLEELNYMNLEEIRGFCVPR |
Ga0310887_103839981 | 3300031547 | Soil | MSNFLSQLTIRERERLLEELNYMNLEEIRGFCSERAIPYRIVAEYSN |
Ga0310887_104670551 | 3300031547 | Soil | MPSLLSQLCIGERARLVEELNYLNLAEIRGFCSSRGIPYK |
Ga0310887_107932722 | 3300031547 | Soil | MANLLAQLTKRERARLLEELNYMNLEEIRGFCSTRGIPYRIVAEYPDG |
Ga0318560_107283622 | 3300031682 | Soil | LSTHRSNLLSQLAKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAEHSN |
Ga0310813_109524472 | 3300031716 | Soil | MPDFLARLTKAVQSQLFEEMNYMNLEEIRGFCSERGIPYRIVMAYPDG |
Ga0307469_110457861 | 3300031720 | Hardwood Forest Soil | LSNSLSQLTASERARLLDELNYMNLEEIRGFCSERG |
Ga0307405_110919892 | 3300031731 | Rhizosphere | MSNFLSQLTTSEQARLLEEVNYLNLEEIRGFCLERGIPYRIVAEYPNG |
Ga0307468_1014261672 | 3300031740 | Hardwood Forest Soil | MSNFLSQLTASARARLLEELNYMNLEEIRGFCSARGIPYRIMAESADGKVKATK |
Ga0306918_109820201 | 3300031744 | Soil | MPNLLSQLTKTERTRLFEELNYMNLEEIQGFCSARGIPFRIIAEYPNGK |
Ga0307473_104684402 | 3300031820 | Hardwood Forest Soil | MSNLLSQLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAES |
Ga0307413_101489491 | 3300031824 | Rhizosphere | MTSMSNFLSQLTKNEQARLLQELNYMNLEEIRGFCSQRG |
Ga0307410_119860781 | 3300031852 | Rhizosphere | MSNFLSALTKVERAGLLEELNYLNLEEIRGFCSERGIPYRIA |
Ga0310904_107374441 | 3300031854 | Soil | MSNFLSQLTISERERLLEELNYMNLEEIRGFCSERAIPYRIVAE |
Ga0310904_113344861 | 3300031854 | Soil | MPNLLSVLTKIERTRLLEELNYMNLEEIRVFCSERRIPYRIVAEYPNGKVKK |
Ga0310904_113490531 | 3300031854 | Soil | MSNFLSQLTKSERARLLEELNYMNLEEVRGFCSERAIPYRIVAEYSNGKVKATKD |
Ga0310892_102935281 | 3300031858 | Soil | MSNFLSQLTIRERERLLEELNYMNLEEIRGFCSERAIPYRIVAE |
Ga0310892_108214871 | 3300031858 | Soil | MSNFLSQLTISERERLLEELNYMNLEEIRGFCSERA |
Ga0310900_110566002 | 3300031908 | Soil | MNALSQLTKSERVRLLEELNYMNLEEIRGFCAERGIPHRI |
Ga0307412_115708881 | 3300031911 | Rhizosphere | VPRFLSKLTESEQGRLLEELNYMNLEEIRGFCSVRGIPYRI |
Ga0310885_102481391 | 3300031943 | Soil | MSNFLSQLTISERERLLEELNYMNLEEIRGFCSERAIPYRIVAEYSNGKVKA |
Ga0310903_105501682 | 3300032000 | Soil | MSNLLSQITKNEQARLLEELNCMNLEEIRGFCSERGIPYRIVAECPNG |
Ga0307416_1002630831 | 3300032002 | Rhizosphere | MTSMSNFLSQLTKNEQARLLQELNYMNLEEIRGFCSQRGIPYRVV |
Ga0310906_108903582 | 3300032013 | Soil | MANYLSQLTASERARLLEELNYMNLEEIRGFCLTRAIPYRI |
Ga0310899_101452633 | 3300032017 | Soil | MPNFLAKLTKGEQARLLEELNYMNLDEIRGFCFPRGIPYKILAEY |
Ga0310890_113802502 | 3300032075 | Soil | MANLLAQLTKRERARLLEELNYMNLEEIRGFCSMRGIPYRIVAEY |
Ga0307415_1015627332 | 3300032126 | Rhizosphere | MPNFLSQLTTSERERLLDELNYMNMEEIRGFCATRGIPYRVMA |
Ga0315912_103759212 | 3300032157 | Soil | MSHLLSQLARSERTRLLEEMNYMNLAEIRGFCAKRGIPYRIVAEYPGGKVKATPDT |
Ga0307471_1012871312 | 3300032180 | Hardwood Forest Soil | MPNFLSKLTKGEQARLLEELNYMNLDEIRGFCFPRGIPYKIVAEYA |
Ga0307471_1024595941 | 3300032180 | Hardwood Forest Soil | MSNFLSRLTKSEQARLLEELNYMNLEEIRGFCSERGIPYRIVAESSNGKVKATKD |
Ga0307471_1042009382 | 3300032180 | Hardwood Forest Soil | MPNFLSKLTKGEQARLLEELNYMNLDEIRGFCFPRGIPYRIVAEYSSGK |
Ga0247830_103152593 | 3300033551 | Soil | MANLLSQLTKSEQARLLEEMNYMNLEEIRGFCSARGIPYKIVAEYPNGRVKATK |
Ga0364933_016931_1606_1725 | 3300034150 | Sediment | MANFMAQLTKSEQARLLEELNYMNLAEIRAFCSERGIPYR |
Ga0364923_0070211_725_850 | 3300034690 | Sediment | MPNFLSKLNKSEQERLLEELNYMNLDEIRGFCFPRGIPYKIL |
⦗Top⦘ |