Basic Information | |
---|---|
Family ID | F019738 |
Family Type | Metagenome |
Number of Sequences | 228 |
Average Sequence Length | 42 residues |
Representative Sequence | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLD |
Number of Associated Samples | 205 |
Number of Associated Scaffolds | 228 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.63 % |
% of genes near scaffold ends (potentially truncated) | 95.18 % |
% of genes from short scaffolds (< 2000 bps) | 94.30 % |
Associated GOLD sequencing projects | 193 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.772 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (8.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.614 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.789 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 228 Family Scaffolds |
---|---|---|
PF02371 | Transposase_20 | 1.32 |
PF12705 | PDDEXK_1 | 1.32 |
PF00589 | Phage_integrase | 0.88 |
PF05116 | S6PP | 0.44 |
PF14319 | Zn_Tnp_IS91 | 0.44 |
PF04796 | RepA_C | 0.44 |
PF00239 | Resolvase | 0.44 |
PF01339 | CheB_methylest | 0.44 |
PF00665 | rve | 0.44 |
PF01609 | DDE_Tnp_1 | 0.44 |
PF02781 | G6PD_C | 0.44 |
PF00872 | Transposase_mut | 0.44 |
PF13700 | DUF4158 | 0.44 |
PF00999 | Na_H_Exchanger | 0.44 |
PF00069 | Pkinase | 0.44 |
COG ID | Name | Functional Category | % Frequency in 228 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.75 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.32 |
COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 0.88 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.44 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.44 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.44 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.44 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.44 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.44 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.44 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.44 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.44 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.44 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.44 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.44 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.44 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.44 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.44 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.44 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.44 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.44 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.44 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.44 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.44 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.77 % |
Unclassified | root | N/A | 16.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_109025971 | Not Available | 565 | Open in IMG/M |
3300001356|JGI12269J14319_10188300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
3300001526|A105W1_1168178 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300002072|JGIcombinedJ21914_10125092 | Not Available | 764 | Open in IMG/M |
3300004024|Ga0055436_10236557 | Not Available | 580 | Open in IMG/M |
3300004635|Ga0062388_100894206 | Not Available | 852 | Open in IMG/M |
3300005434|Ga0070709_11718920 | Not Available | 512 | Open in IMG/M |
3300005466|Ga0070685_10912395 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300005573|Ga0078972_1089059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 1847 | Open in IMG/M |
3300005587|Ga0066654_10573432 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005591|Ga0070761_10614475 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300005921|Ga0070766_10518195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300006028|Ga0070717_10969739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
3300006041|Ga0075023_100618177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300006052|Ga0075029_100550314 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300006086|Ga0075019_10357961 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300006162|Ga0075030_100219701 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300006163|Ga0070715_10429429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 741 | Open in IMG/M |
3300006173|Ga0070716_101050795 | Not Available | 647 | Open in IMG/M |
3300006174|Ga0075014_100367024 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300006176|Ga0070765_101879088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300006176|Ga0070765_102058384 | Not Available | 534 | Open in IMG/M |
3300006224|Ga0079037_101050778 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300006755|Ga0079222_11126921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300006795|Ga0075520_1192707 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300006844|Ga0075428_102670995 | Not Available | 509 | Open in IMG/M |
3300006904|Ga0075424_100995015 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300009012|Ga0066710_103536212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 590 | Open in IMG/M |
3300009088|Ga0099830_10777777 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300009183|Ga0114974_10609273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300009503|Ga0123519_10158885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
3300009524|Ga0116225_1402697 | Not Available | 609 | Open in IMG/M |
3300009525|Ga0116220_10196172 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300009631|Ga0116115_1105464 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300009636|Ga0116112_1237696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 502 | Open in IMG/M |
3300009637|Ga0116118_1073278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
3300009665|Ga0116135_1371468 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300010046|Ga0126384_12257810 | Not Available | 525 | Open in IMG/M |
3300010341|Ga0074045_10188494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1386 | Open in IMG/M |
3300010356|Ga0116237_10850690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300010359|Ga0126376_12722100 | Not Available | 544 | Open in IMG/M |
3300010362|Ga0126377_10899133 | Not Available | 948 | Open in IMG/M |
3300010379|Ga0136449_104561295 | Not Available | 508 | Open in IMG/M |
3300010398|Ga0126383_11295157 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300012038|Ga0137431_1125185 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300012199|Ga0137383_10240487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
3300012202|Ga0137363_10806682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 796 | Open in IMG/M |
3300012202|Ga0137363_11457350 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300012206|Ga0137380_11639690 | Not Available | 527 | Open in IMG/M |
3300012930|Ga0137407_11256233 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300012944|Ga0137410_10595879 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300012948|Ga0126375_10435808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 958 | Open in IMG/M |
3300012964|Ga0153916_10908905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300013308|Ga0157375_11038609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
3300013770|Ga0120123_1023593 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300014155|Ga0181524_10254063 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300014158|Ga0181521_10577943 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300014165|Ga0181523_10790880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 517 | Open in IMG/M |
3300014200|Ga0181526_10492384 | Not Available | 776 | Open in IMG/M |
3300014201|Ga0181537_10936586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300014201|Ga0181537_11122294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 531 | Open in IMG/M |
3300014490|Ga0182010_10828393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 525 | Open in IMG/M |
3300014492|Ga0182013_10704776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 505 | Open in IMG/M |
3300014493|Ga0182016_10686587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300014498|Ga0182019_10880253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 644 | Open in IMG/M |
3300014498|Ga0182019_11425891 | Not Available | 514 | Open in IMG/M |
3300014501|Ga0182024_10240197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2439 | Open in IMG/M |
3300014502|Ga0182021_12591492 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300014655|Ga0181516_10232829 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300014657|Ga0181522_10430769 | Not Available | 791 | Open in IMG/M |
3300014745|Ga0157377_10609404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 780 | Open in IMG/M |
3300014839|Ga0182027_10036386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Trichlorobacter → Trichlorobacter thiogenes | 6330 | Open in IMG/M |
3300015245|Ga0137409_10739502 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300015371|Ga0132258_11733576 | Not Available | 1575 | Open in IMG/M |
3300015372|Ga0132256_101898814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 703 | Open in IMG/M |
3300016387|Ga0182040_11410865 | Not Available | 590 | Open in IMG/M |
3300016404|Ga0182037_10768632 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300016422|Ga0182039_10630011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 940 | Open in IMG/M |
3300017789|Ga0136617_10580750 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300017933|Ga0187801_10135098 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300017934|Ga0187803_10325945 | Not Available | 615 | Open in IMG/M |
3300017966|Ga0187776_10726694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 705 | Open in IMG/M |
3300017975|Ga0187782_10755875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 751 | Open in IMG/M |
3300017975|Ga0187782_11563005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300017995|Ga0187816_10506105 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300018007|Ga0187805_10395253 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300018019|Ga0187874_10189976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
3300018026|Ga0187857_10468116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300018026|Ga0187857_10522754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 531 | Open in IMG/M |
3300018030|Ga0187869_10359961 | Not Available | 696 | Open in IMG/M |
3300018033|Ga0187867_10548220 | Not Available | 634 | Open in IMG/M |
3300018034|Ga0187863_10447226 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300018043|Ga0187887_10714751 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300018044|Ga0187890_10552683 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300018047|Ga0187859_10467521 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300018062|Ga0187784_10705342 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300018081|Ga0184625_10233252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 964 | Open in IMG/M |
3300018481|Ga0190271_12706913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 595 | Open in IMG/M |
3300020002|Ga0193730_1155106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 602 | Open in IMG/M |
3300020021|Ga0193726_1022788 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
3300021372|Ga0213877_10216187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 627 | Open in IMG/M |
3300021377|Ga0213874_10267659 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300021406|Ga0210386_11708349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300021420|Ga0210394_11304092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 620 | Open in IMG/M |
3300021477|Ga0210398_10738519 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300021477|Ga0210398_11138318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 619 | Open in IMG/M |
3300022756|Ga0222622_10605572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 791 | Open in IMG/M |
3300022875|Ga0224553_1050524 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
(restricted) 3300023060|Ga0224519_1045092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 547 | Open in IMG/M |
3300024056|Ga0124853_1243914 | All Organisms → cellular organisms → Bacteria | 3989 | Open in IMG/M |
3300025507|Ga0208188_1131281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300025527|Ga0208714_1064893 | Not Available | 765 | Open in IMG/M |
3300025527|Ga0208714_1078972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300025878|Ga0209584_10238118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300025888|Ga0209540_10444817 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300025891|Ga0209585_10090754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
3300025891|Ga0209585_10451115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 530 | Open in IMG/M |
3300025910|Ga0207684_10531004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 1007 | Open in IMG/M |
3300025911|Ga0207654_11136634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 569 | Open in IMG/M |
3300025924|Ga0207694_10159382 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
3300025930|Ga0207701_11521433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300026035|Ga0207703_12147708 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300026216|Ga0209903_1049269 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300026527|Ga0209059_1350456 | Not Available | 501 | Open in IMG/M |
3300026550|Ga0209474_10561448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300026953|Ga0207835_1033820 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300027024|Ga0207819_1030469 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300027266|Ga0209215_1052892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300027394|Ga0209904_1020372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 520 | Open in IMG/M |
3300027568|Ga0208042_1176529 | Not Available | 531 | Open in IMG/M |
3300027676|Ga0209333_1113865 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300027680|Ga0207826_1172444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 588 | Open in IMG/M |
3300027706|Ga0209581_1045848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1764 | Open in IMG/M |
3300027767|Ga0209655_10295447 | Not Available | 523 | Open in IMG/M |
3300027853|Ga0209274_10464708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 655 | Open in IMG/M |
3300027855|Ga0209693_10620247 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300027863|Ga0207433_10152488 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
3300027874|Ga0209465_10450523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 644 | Open in IMG/M |
3300027889|Ga0209380_10569252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300027895|Ga0209624_10871363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 589 | Open in IMG/M |
3300027903|Ga0209488_10162449 | Not Available | 1686 | Open in IMG/M |
3300027910|Ga0209583_10219369 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300027911|Ga0209698_10065939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3112 | Open in IMG/M |
3300028047|Ga0209526_10574772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
3300028552|Ga0302149_1177926 | Not Available | 555 | Open in IMG/M |
3300028572|Ga0302152_10147657 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300028572|Ga0302152_10289917 | Not Available | 537 | Open in IMG/M |
3300028775|Ga0302231_10188362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 862 | Open in IMG/M |
3300028776|Ga0302303_10157374 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300028776|Ga0302303_10327144 | Not Available | 514 | Open in IMG/M |
3300028795|Ga0302227_10217314 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300028800|Ga0265338_10615571 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300028860|Ga0302199_1249171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 534 | Open in IMG/M |
3300029883|Ga0311327_10488227 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300029914|Ga0311359_10730027 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300029944|Ga0311352_11273451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 556 | Open in IMG/M |
3300029951|Ga0311371_11174159 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300029952|Ga0311346_10790074 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300029982|Ga0302277_1033052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 2682 | Open in IMG/M |
3300029986|Ga0302188_10031898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 2622 | Open in IMG/M |
3300030007|Ga0311338_10779052 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300030044|Ga0302281_10360045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 568 | Open in IMG/M |
3300030053|Ga0302177_10506760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 623 | Open in IMG/M |
3300030057|Ga0302176_10182460 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300030114|Ga0311333_10864142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300030399|Ga0311353_10449704 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300030399|Ga0311353_10695297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 878 | Open in IMG/M |
3300030503|Ga0311370_11370768 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300030520|Ga0311372_11737634 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300030520|Ga0311372_12527711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300030580|Ga0311355_11019912 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300030688|Ga0311345_10986256 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300030746|Ga0302312_10305691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300031228|Ga0299914_10491120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 1061 | Open in IMG/M |
3300031231|Ga0170824_117817492 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300031232|Ga0302323_100920510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
3300031234|Ga0302325_10691751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 1471 | Open in IMG/M |
3300031235|Ga0265330_10217608 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300031235|Ga0265330_10508957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 513 | Open in IMG/M |
3300031236|Ga0302324_101721302 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300031241|Ga0265325_10439238 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300031463|Ga0272448_1078451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2240 | Open in IMG/M |
3300031524|Ga0302320_11519440 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300031525|Ga0302326_13348419 | Not Available | 537 | Open in IMG/M |
3300031545|Ga0318541_10242805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 1000 | Open in IMG/M |
3300031572|Ga0318515_10466354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 675 | Open in IMG/M |
3300031668|Ga0318542_10403856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 706 | Open in IMG/M |
3300031708|Ga0310686_105623639 | Not Available | 909 | Open in IMG/M |
3300031708|Ga0310686_105911304 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031712|Ga0265342_10135806 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300031712|Ga0265342_10307567 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300031716|Ga0310813_10082485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2457 | Open in IMG/M |
3300031719|Ga0306917_10751850 | Not Available | 765 | Open in IMG/M |
3300031747|Ga0318502_10544376 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300031788|Ga0302319_10183819 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
3300031788|Ga0302319_10227042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2308 | Open in IMG/M |
3300031788|Ga0302319_10626710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
3300031788|Ga0302319_11717937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300031873|Ga0315297_11222413 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300031880|Ga0318544_10310851 | Not Available | 612 | Open in IMG/M |
3300031912|Ga0306921_10873471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
3300031954|Ga0306926_11836739 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300032009|Ga0318563_10583634 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300032076|Ga0306924_11238383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 805 | Open in IMG/M |
3300032094|Ga0318540_10294429 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300032160|Ga0311301_10185902 | All Organisms → cellular organisms → Bacteria | 3613 | Open in IMG/M |
3300032173|Ga0315268_11296307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300032401|Ga0315275_11563980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 706 | Open in IMG/M |
3300032770|Ga0335085_10213959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2348 | Open in IMG/M |
3300032782|Ga0335082_11469154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 553 | Open in IMG/M |
3300032805|Ga0335078_11248149 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300032828|Ga0335080_10859939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 933 | Open in IMG/M |
3300032828|Ga0335080_11099946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300032892|Ga0335081_10469215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1594 | Open in IMG/M |
3300032892|Ga0335081_11883852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300032892|Ga0335081_12408642 | Not Available | 547 | Open in IMG/M |
3300032898|Ga0335072_10942036 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300032955|Ga0335076_11432786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 577 | Open in IMG/M |
3300032955|Ga0335076_11715884 | Not Available | 517 | Open in IMG/M |
3300033004|Ga0335084_10944712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 870 | Open in IMG/M |
3300033134|Ga0335073_11069151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 826 | Open in IMG/M |
3300033405|Ga0326727_11198762 | Not Available | 529 | Open in IMG/M |
3300033557|Ga0316617_101216054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 748 | Open in IMG/M |
3300033827|Ga0334848_096448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 523 | Open in IMG/M |
3300034113|Ga0364937_118438 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300034124|Ga0370483_0204931 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300034149|Ga0364929_0113668 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300034150|Ga0364933_171678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 565 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.33% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 6.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.82% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.95% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.95% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.51% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.51% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.07% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.63% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.63% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.19% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.75% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.32% |
Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.32% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.32% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.32% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.32% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.88% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.88% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.44% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.44% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.44% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.44% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.44% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.44% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.44% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.44% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.44% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.44% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.44% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.44% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.44% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001526 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illumina | Environmental | Open in IMG/M |
3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009503 | Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010356 | AD_USDEca | Engineered | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022875 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14 | Environmental | Open in IMG/M |
3300023060 (restricted) | Peat soil microbial communities from Stordalen Mire, Sweden - IR.B.S.T0 | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026953 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes) | Environmental | Open in IMG/M |
3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031463 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033827 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9 | Environmental | Open in IMG/M |
3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1090259712 | 3300001213 | Wetland | MLTTEQINDLHRFYWSDHWPIRKIERHLHMGWKTSKKYLDAPAQ |
JGI12269J14319_101883003 | 3300001356 | Peatlands Soil | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPAQTPAG |
A105W1_11681782 | 3300001526 | Permafrost | MLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKY |
JGIcombinedJ21914_101250922 | 3300002072 | Arctic Peat Soil | MLNTDQINDLHRFYWSDRWPIRKIERHLRMGWRTIKKYLDMP |
Ga0055436_102365572 | 3300004024 | Natural And Restored Wetlands | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLE |
Ga0062388_1008942061 | 3300004635 | Bog Forest Soil | MLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPAQG |
Ga0070709_117189202 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTTEQINDLHRLYWSEHWPIRKIERHLNMGWQTIKKYLDAPAQGPAKR |
Ga0070685_109123952 | 3300005466 | Switchgrass Rhizosphere | MLSTEQINELHRLYWSERWPIRKIERHLRMGWRTIRKYLEQPAQTRLL |
Ga0078972_10890593 | 3300005573 | Hot Spring | MLTADQINDLHSLYWSERWPIRKIERHLHRSWRTIKVA* |
Ga0066654_105734322 | 3300005587 | Soil | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPA |
Ga0070761_106144752 | 3300005591 | Soil | MLSTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGV |
Ga0070766_105181951 | 3300005921 | Soil | MLTTEQINDLHRLYWSEQWPIRKIERHLNMGWKTIRK |
Ga0070717_109697393 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTTEQINDLHRLYWSEHWPIRKIERHLNMGWKTIRKYLDAPA |
Ga0075023_1006181771 | 3300006041 | Watersheds | MLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYLHAPAQAP |
Ga0075029_1005503141 | 3300006052 | Watersheds | MLTNEQIQTLHQLFYAERWPIRKIERHLRMGWRTIKKYLHQP |
Ga0075019_103579611 | 3300006086 | Watersheds | MLTSEQINDLHRLYWSEHWPIRKIERHLKMSWRTIKKY |
Ga0075030_1002197011 | 3300006162 | Watersheds | MLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIKKYLDAPT* |
Ga0070715_104294292 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSADQINDLHRLYWAERWPIRKIERHLRMSWRTIKK |
Ga0070716_1010507951 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTTDQINDLHHLYWVARWPIRKIEQHLRMSWHTIKKYL |
Ga0075014_1003670241 | 3300006174 | Watersheds | MLTNEQIQTLHQLFYAERWPIRKIERHLRMGWRTIKKYLHQPDQP |
Ga0070765_1018790881 | 3300006176 | Soil | MLTTEQINDLHRLYWSEHWPIRKIERHLKMCWKTIKKYLDA |
Ga0070765_1020583841 | 3300006176 | Soil | MLTGDQINELHLLYVSEKWPIRKIERHLNMGWRTIRKYLDAPAQGA |
Ga0079037_1010507783 | 3300006224 | Freshwater Wetlands | MLTTEQINDLHCLYWSEHWPIRKIERHLHMGWDTIKKYLDMP |
Ga0079222_111269213 | 3300006755 | Agricultural Soil | MLTSDQINDLHQMYWSERCSIRKIERHLNMGWRTIKK |
Ga0075520_11927072 | 3300006795 | Arctic Peat Soil | MLTTEQINDLHRRYWSDHWPIRKIERHLHMGWDTIKKYLDMPA |
Ga0075428_1026709952 | 3300006844 | Populus Rhizosphere | MLTNEQIQTLHQLYYAERWPIRKIERHLRLGWRTIQKYLQKPDQP |
Ga0075424_1009950151 | 3300006904 | Populus Rhizosphere | MLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLH |
Ga0066710_1035362122 | 3300009012 | Grasslands Soil | MLTIEQINELHRLYWSERWPIRKIERHLRMSWRTIKQYLD |
Ga0099830_107777772 | 3300009088 | Vadose Zone Soil | MLTTEQINELHRLYWSEHWPIRKIERQLNMGWKTIRKYLDA |
Ga0114974_106092732 | 3300009183 | Freshwater Lake | MLDTDQINELHRLYWAEQWSIRRIERHLKMCWRTIRKYLDVPSQIPALRH |
Ga0123519_101588853 | 3300009503 | Hot Spring | MLTADQINDLHCLYWSERWPIRKIERHLHRSWRTIKAA* |
Ga0116225_14026972 | 3300009524 | Peatlands Soil | VPHKGKRALLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTIKKYLEA |
Ga0116220_101961721 | 3300009525 | Peatlands Soil | MLTTDQINDLHHLYWAERWPIHKIEQHLRMSWHTIKK |
Ga0116115_11054642 | 3300009631 | Peatland | MRIEPMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQ |
Ga0116112_12376962 | 3300009636 | Peatland | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDMPAQTPAGRP |
Ga0116118_10732782 | 3300009637 | Peatland | MLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPA |
Ga0116135_13714682 | 3300009665 | Peatland | MLTTDQINDLHHPYWAEHWPIRKIEQHLRMCWHTIKKYLEAPAQ |
Ga0126384_122578101 | 3300010046 | Tropical Forest Soil | GNRAMLSTEQIKDLHRLYWSERWPIRKIERHLRMGWHTCV* |
Ga0074045_101884942 | 3300010341 | Bog Forest Soil | MRIEPMLTTEQINDLHRRYWSDHWPIRKIERHLHMGWDTIKK* |
Ga0116237_108506901 | 3300010356 | Anaerobic Digestor Sludge | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLEA |
Ga0126376_127221001 | 3300010359 | Tropical Forest Soil | KGNRAMLSTEQIKDLHRLYWSERWPIRKIERHLRMGWHTCV* |
Ga0126377_108991332 | 3300010362 | Tropical Forest Soil | MLTTDQINDLHRLYWSEHWPIRKIERHLHMSWRTIKKYL |
Ga0136449_1045612951 | 3300010379 | Peatlands Soil | MLSTEQINDLHRLYWSERWPIRKIERHLSMGWHTIRKYLDA |
Ga0126383_112951573 | 3300010398 | Tropical Forest Soil | MLSTDQINDLHRLYWSEHWPIRKIERHLRISWHTIKKYLDAPA |
Ga0137431_11251851 | 3300012038 | Soil | MLTPDQINDLHRLYWSERWPIRKIERHLRMGWRTIKKY |
Ga0137383_102404873 | 3300012199 | Vadose Zone Soil | MLTTDQINELHRLYWSERWPIRKIERQLNIGWKTIRQYLDAPA |
Ga0137363_108066822 | 3300012202 | Vadose Zone Soil | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIK |
Ga0137363_114573501 | 3300012202 | Vadose Zone Soil | MRIEPMLTTEQINDLNRLYWSEHWPIRKIERHLHMG |
Ga0137380_116396902 | 3300012206 | Vadose Zone Soil | MLTTDQINELHRLDWSEHWPIRKIERRLRMSWRTIQKYLNAPGKHPPRG |
Ga0137407_112562332 | 3300012930 | Vadose Zone Soil | MLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTI |
Ga0137410_105958791 | 3300012944 | Vadose Zone Soil | MLTTDQINDLHRLYWSEHWSIRKIERHLKLSWRTIQKYLEAPGKRPALS* |
Ga0126375_104358082 | 3300012948 | Tropical Forest Soil | MLTTEQINDLHRFYWSDHWPIRKIERHLHMGWKTIKKYLDAPAQ |
Ga0153916_109089051 | 3300012964 | Freshwater Wetlands | MLTNEQIQILHQLYYAERWPIRKIERHLRMGWRTINKYLHQPDQPAVS |
Ga0157375_110386092 | 3300013308 | Miscanthus Rhizosphere | MLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDTPAQTTA |
Ga0120123_10235931 | 3300013770 | Permafrost | MLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYLHAPAQAPA |
Ga0181524_102540631 | 3300014155 | Bog | MLTTDQINDLHHLYWVEHWPIRKIEQHLRMSWHTIKKY |
Ga0181521_105779432 | 3300014158 | Bog | VLTTDQINDLHHLFWSEHWPIRKIEGHLRMSWRTIK |
Ga0181523_107908802 | 3300014165 | Bog | MLSTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGVAQR |
Ga0181526_104923842 | 3300014200 | Bog | MLTTDQINDLHHLYEVEHWPIRKIEQYLRMSWRTIKKYLDALAQT |
Ga0181537_109365861 | 3300014201 | Bog | MLTSDQINELHRLYVSERWPIRKIERHLNMGWKTIKKYLDAPA |
Ga0181537_111222942 | 3300014201 | Bog | MLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIRKYLKA |
Ga0182010_108283932 | 3300014490 | Fen | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDM |
Ga0182013_107047762 | 3300014492 | Bog | MRIESMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKK |
Ga0182016_106865872 | 3300014493 | Bog | MLTTEQINDLHRFYWSEHWPIRKIERHLHMGWKTIKKYL |
Ga0182019_108802531 | 3300014498 | Fen | MLTNEQINDLHRFYWSERWPIRKIERHLQMGWKTIKK |
Ga0182019_114258912 | 3300014498 | Fen | MLSNEQINDLHRLYWSERWPIRKIERHLSMGWHTIRKYLDAPAQGPAQRP |
Ga0182024_102401975 | 3300014501 | Permafrost | LNRSTNLNRLYRSERWPVRKIERHLCMSWHTIRKYLDAPAQAPAIL* |
Ga0182021_125914921 | 3300014502 | Fen | MRIEPMLTTEQINDLHRLYWSDHWPIRKIERHLHM |
Ga0181516_102328293 | 3300014655 | Bog | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLH |
Ga0181522_104307692 | 3300014657 | Bog | MLTSDQIHELHRLYVSEKWPIRKIERHLNMGWRTIRKYLDAPAQGAT |
Ga0157377_106094042 | 3300014745 | Miscanthus Rhizosphere | MTMLTTEHINDLHRFYWSERWPIRKIERHLKMGWKTIKKYLD |
Ga0182027_100363865 | 3300014839 | Fen | MLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYL |
Ga0137409_107395023 | 3300015245 | Vadose Zone Soil | MLTADQINDLHRLYWSEHWSIRKIERHLKLSWRTIQKYLEAPAQTPAKRE |
Ga0132258_117335762 | 3300015371 | Arabidopsis Rhizosphere | MLTADQINDLHRLYWSARWPIRKIERHLHRSWRTIKKYLDAPRP |
Ga0132256_1018988141 | 3300015372 | Arabidopsis Rhizosphere | MLNTEQINELHRLYWSERWPIRKIERHLRMSWRTIKKYLHAPAQ |
Ga0182040_114108652 | 3300016387 | Soil | MLTTEQINDLHRFYWSERWPIRKIERHLHMGWKTIKKYLVAPAQSPAT |
Ga0182037_107686322 | 3300016404 | Soil | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWNTIKKYLDMPAQTPAG |
Ga0182039_106300111 | 3300016422 | Soil | MLSTEQINDLHRLYWSERWPVRKIAQHLHMGCNTIRKYLN |
Ga0136617_105807503 | 3300017789 | Polar Desert Sand | MLTTDQINELHRLYWSEHWPIRKIERQLNMGWKTIRKYIDAPA |
Ga0187801_101350982 | 3300017933 | Freshwater Sediment | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLETPAQT |
Ga0187803_103259451 | 3300017934 | Freshwater Sediment | MLTADQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLVAPAQT |
Ga0187776_107266942 | 3300017966 | Tropical Peatland | MLTTDQINELHRLYWSEHWPIRKIERHLRMSWRTIEIFLDGAPAHAQVAFDL |
Ga0187782_107558751 | 3300017975 | Tropical Peatland | VLTTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPAQGPA |
Ga0187782_115630051 | 3300017975 | Tropical Peatland | MLSTEQINDLHRLYWSERWPIRKIERHLQMGWHTIRKY |
Ga0187816_105061052 | 3300017995 | Freshwater Sediment | MLTTDQINDLHHLYWAEHWPIRKIEQHLRMSWQTIKKYLEAPRRRLRRRLA |
Ga0187805_103952531 | 3300018007 | Freshwater Sediment | MLTTDQINDLHRLYWSEHWPIRKIERYLHMGWQTIKKYL |
Ga0187874_101899761 | 3300018019 | Peatland | MLTTDQINDLHHVYWVEHWPIRKIEQRLGMSWRTIKKYLEAPAQTPAA |
Ga0187857_104681162 | 3300018026 | Peatland | MLSTEQINDLHRLYWSEHWPIRKIERHLRMGWHTI |
Ga0187857_105227542 | 3300018026 | Peatland | MLTTEQINDLHRLYWSERWSIRKIERHLSMGWHTIRKYLDAPA |
Ga0187869_103599612 | 3300018030 | Peatland | MLSTEQINDLHRLYWSERWPIRKIERHLSMGWHTIRKYLDAP |
Ga0187867_105482201 | 3300018033 | Peatland | MLTTDQINDLHHLYWVEHWPIHKIEQHLGMSWRTIKKYLEA |
Ga0187863_104472262 | 3300018034 | Peatland | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWDTIK |
Ga0187887_107147511 | 3300018043 | Peatland | MLTTDQINDLHHLYWAEHWPIRKIEQHLRMSWHTIKKYLEAPAQTPAARS |
Ga0187890_105526831 | 3300018044 | Peatland | MLTSDQINELHLLYVSEKWPIRKIERHLNMGWRTIRKYLDA |
Ga0187859_104675211 | 3300018047 | Peatland | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPA |
Ga0187784_107053421 | 3300018062 | Tropical Peatland | MLTDEQIQTLHQLYYAERWPIRKIERHLDMGWRTIKKYLHQPDQPA |
Ga0184625_102332522 | 3300018081 | Groundwater Sediment | MLTTDQINDLHRLYWSERWPIRKIERHLRINWRTIKKYLDAPAQGP |
Ga0190271_127069131 | 3300018481 | Soil | MLTADQINDLHRLYWSERWPIRKIERHLHRSWRTIKKY |
Ga0193730_11551061 | 3300020002 | Soil | MLTTDQINDLHRLFWSEHWPIRKIERHLKMCWKTIKV |
Ga0193726_10227884 | 3300020021 | Soil | MLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTI |
Ga0213877_102161872 | 3300021372 | Bulk Soil | MLSTEQINDLHRLYWSERWPVRKIERHLRMSWRTIRKYLDAP |
Ga0213874_102676591 | 3300021377 | Plant Roots | MLTSDQINELHRMYVSEKWPIRKIERHLNMGWKTIKKY |
Ga0210386_117083491 | 3300021406 | Soil | MLTTDQINELHRLYWSERWPIRKIERQLNIGWKTIRKYLDAPAQDPLRRDR |
Ga0210394_113040921 | 3300021420 | Soil | MLSADQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQSPAQRQ |
Ga0210398_107385192 | 3300021477 | Soil | MLTSDQINELHRLYVSEKWPIRKIERHLNMGWRTIRKYLDMPAQG |
Ga0210398_111383182 | 3300021477 | Soil | MLSTDQINDLHRLYWSEHWPIRKIERHLGMSWRTIKKYLDA |
Ga0222622_106055721 | 3300022756 | Groundwater Sediment | MLTNEQINDLHRFYWSERWPIRKIERHLKLGWKTIKKS |
Ga0224553_10505242 | 3300022875 | Soil | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTP |
(restricted) Ga0224519_10450922 | 3300023060 | Soil | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETI |
Ga0124853_12439146 | 3300024056 | Freshwater Wetlands | MLTTDQINDLHRRYWSERWPIRKIERYLRMDWQTIRKYLDMPAQTPAGRP |
Ga0208188_11312812 | 3300025507 | Peatland | MLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDA |
Ga0208714_10648931 | 3300025527 | Arctic Peat Soil | MLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTIKKYLEAPAQTPAA |
Ga0208714_10789721 | 3300025527 | Arctic Peat Soil | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLEAPAQTP |
Ga0209584_102381181 | 3300025878 | Arctic Peat Soil | MLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTIK |
Ga0209540_104448172 | 3300025888 | Arctic Peat Soil | MKIEPMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWET |
Ga0209585_100907544 | 3300025891 | Arctic Peat Soil | MLNTDQINGLHRFYWSDRWPIRKIERHLRMGWRTIKKYLD |
Ga0209585_104511151 | 3300025891 | Arctic Peat Soil | MKIEPMLTTEQINDLHRLYWSEHWPIRKIERHLHM |
Ga0207684_105310043 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSTEQINELHRLYWSERWPVRKIALHLHMGCNTIRKYLN |
Ga0207654_111366342 | 3300025911 | Corn Rhizosphere | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLD |
Ga0207694_101593821 | 3300025924 | Corn Rhizosphere | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPAQTPAGRP |
Ga0207701_115214331 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNTDQINDLHRLYWSEHWSIRRIERHLKMCWKTIRK |
Ga0207703_121477081 | 3300026035 | Switchgrass Rhizosphere | MLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLEAPAQTPA |
Ga0209903_10492692 | 3300026216 | Soil | MLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIKKYLDAPA |
Ga0209059_13504562 | 3300026527 | Soil | MLTSDQINELHRLYVSEQWPIRKIERHLNMGWQTTIKKYL |
Ga0209474_105614481 | 3300026550 | Soil | MLTTEQINDLHRLYWSEHWPIRKIERHLNMGWRTIRKYLDAPA |
Ga0207835_10338201 | 3300026953 | Tropical Forest Soil | MLTADQINDLHHLYWAERWPIRKIEQHLCMSWRTIKKYLEAPAQKPATRS |
Ga0207819_10304691 | 3300027024 | Tropical Forest Soil | MLTADQINDLHHLYWAERWPIRKIEQHLCMSWRTIKKYLEAPAQKP |
Ga0209215_10528921 | 3300027266 | Forest Soil | MLSTDQINDLHRLYWSERWTIRKIERHLRMGWRTIKKYL |
Ga0209904_10203721 | 3300027394 | Thawing Permafrost | MRIEPMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWDTIKKYLDMPCLLYTSRCV |
Ga0208042_11765292 | 3300027568 | Peatlands Soil | MLTTDQINDLHHLYWAERWTIRKIEQHLRMSWHTIKKYLETPAQTSAT |
Ga0209333_11138651 | 3300027676 | Forest Soil | MLTSDQINELHRLYVSEKWPIRKIERHLNMGWRTIRKYLE |
Ga0207826_11724442 | 3300027680 | Tropical Forest Soil | MLTADQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQAPAQRQ |
Ga0209581_10458484 | 3300027706 | Surface Soil | MLTTEQINELHHLYWSERWSIRKIERHLRMGWRTIRKYLESPAQ |
Ga0209655_102954472 | 3300027767 | Bog Forest Soil | MLTSDQINDLHRLYVSEKWPIRKIERHLNMGWRTIRKYLDTPAQGAAP |
Ga0209274_104647082 | 3300027853 | Soil | MLTTEQINDLHRLYWSEHWPIRKIERQLNIGWRTIRKYLDAPAQA |
Ga0209693_106202472 | 3300027855 | Soil | MLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIR |
Ga0207433_101524883 | 3300027863 | Hot Spring | MLTADQINDLHSLYWSERWPIRKIERHLHRSWRTIKVA |
Ga0209465_104505231 | 3300027874 | Tropical Forest Soil | MLSTDQINDLYRLYWSERWPIRKIERHLRMGWRTIKKYLDAPAQGP |
Ga0209380_105692521 | 3300027889 | Soil | MLTTEQINDLHRLYWSEHWPIRKIERQLNIGWRTIHKYLNAP |
Ga0209624_108713631 | 3300027895 | Forest Soil | MLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLNA |
Ga0209488_101624491 | 3300027903 | Vadose Zone Soil | RAMLTADQINDLHRLYWSEHWSIRKIERHVKMNWRTIQKYLEAPGKRPALS |
Ga0209583_102193691 | 3300027910 | Watersheds | MLSTDQINNLHRLYWSERWAIRKIERHLKISWKTIRKYLHAPAQAP |
Ga0209698_100659394 | 3300027911 | Watersheds | MLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIKKYLDAPT |
Ga0209526_105747721 | 3300028047 | Forest Soil | MLTTEQINDLHRLYWSEHWPIRKIERHLNMGWKTIRKYLD |
Ga0302149_11779262 | 3300028552 | Bog | MLTSEQINDLHRLYWAEHWPIRKIERHLNMGWQTIKKYL |
Ga0302152_101476571 | 3300028572 | Bog | MLTSDQINELHRLYVSERWPIRKIERHLKLGWKTIKKYLE |
Ga0302152_102899171 | 3300028572 | Bog | MLTTDQINDLHRLYWSEHWPIRKIERQLNMGWKTIQKYLVAPA |
Ga0302231_101883622 | 3300028775 | Palsa | MLSTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDA |
Ga0302303_101573742 | 3300028776 | Palsa | MLTSDQINELHRLYVSERWPIRKIERHLKLGWKTIKKYLET |
Ga0302303_103271441 | 3300028776 | Palsa | MLTSEQINDLHRLYWAEHWPIRKIERHLNMGWQTIKKYLDAPAQGVT |
Ga0302227_102173141 | 3300028795 | Palsa | MLTTAQINDLHRLYWSDHWPIRKIERHLHMGWETIK |
Ga0265338_106155711 | 3300028800 | Rhizosphere | MLTSDQINDLHRLYWSERWPIRKIERHLKMGWRTIKKYLDM |
Ga0302199_12491711 | 3300028860 | Bog | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYL |
Ga0311327_104882272 | 3300029883 | Bog | MLTSDQINELHRLYVSERWPIRKIERHLKLGWKTIKKYL |
Ga0311359_107300271 | 3300029914 | Bog | MLTTDQINDLHHLYWSEHWPIRRIEQHLCMTWRTIKK |
Ga0311352_112734512 | 3300029944 | Palsa | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTPAGRS |
Ga0311371_111741591 | 3300029951 | Palsa | MLTTDQINELHRLYWSEHWPIRKIERQLNMGWRTIRKYIDAPAQSALHR |
Ga0311346_107900742 | 3300029952 | Bog | MLTSEQINDLHRLYWAEHWPIRKIERHLNMGWHTIKKYLDAPAQGA |
Ga0302277_10330525 | 3300029982 | Bog | MLTTDQINDLHRLYWSEHWPIRKIERQLNMGWKTIQKYLVAPAQSA |
Ga0302188_100318981 | 3300029986 | Bog | MLTTDQINDLHRLYWSEHWPIRKIERQLNMGWKTI |
Ga0311338_107790522 | 3300030007 | Palsa | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQ |
Ga0302281_103600451 | 3300030044 | Fen | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLD |
Ga0302177_105067602 | 3300030053 | Palsa | MLTTDQINDLHRLYWSERWPIRKIERHLRMGWHTIKKYLEAPAQGPA |
Ga0302176_101824601 | 3300030057 | Palsa | MLTTEQINDLHRLYWSEHWPIRKIERHLRMGWETIKKYLDMPAQT |
Ga0311333_108641421 | 3300030114 | Fen | MLTSDQINDLHHLYWVEHWPIRKIEQHLRMSWRTIKKYLEAPAQT |
Ga0311353_104497043 | 3300030399 | Palsa | MLTSEQINDLHRLYWSERWPIRKIERHLKMGWKTIKKYLNAPAQG |
Ga0311353_106952972 | 3300030399 | Palsa | MLTTDQINDLHRLYWSERWPIRKIERHLRMGWHTIKKYLEAPAQGP |
Ga0311370_113707681 | 3300030503 | Palsa | MLTSEQINDLHRLYWSERWPIRKIERHLKMGWKTIK |
Ga0311372_117376341 | 3300030520 | Palsa | MLTTDQINELHRLYWSERWPIRKIERQLNIGWKTIRKYLDAPAQD |
Ga0311372_125277112 | 3300030520 | Palsa | MLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYL |
Ga0311355_110199121 | 3300030580 | Palsa | MLTTDQINELHRLYWSEHWPIRKIERQLNMGWRTIRKYIDAPAQSALHRNR |
Ga0311345_109862561 | 3300030688 | Bog | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDMPAQTP |
Ga0302312_103056912 | 3300030746 | Palsa | MLTTEQINDLHRLYWSEHWPIRKIERHLRMGWETIKK |
Ga0299914_104911201 | 3300031228 | Soil | MLDTDQINDLHRLYWSERWSIRKIERHLKMGWRTIRKYLEAPAQ |
Ga0170824_1178174923 | 3300031231 | Forest Soil | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPAQ |
Ga0302323_1009205103 | 3300031232 | Fen | MLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIRKYLDAPAQGAV |
Ga0302325_106917511 | 3300031234 | Palsa | VLSTEQINDLHRLYWSEHWPIRKIERHLRMGWHTIRKYLDAP |
Ga0265330_102176081 | 3300031235 | Rhizosphere | MLTTEQINDLHHLYWSEHWPIRKIERHLHMGWETIKKYLDMPAQTPAGR |
Ga0265330_105089571 | 3300031235 | Rhizosphere | MLDTEQINDPHRLYWSERWSIRKIERHLKMGWRTIRKYLE |
Ga0302324_1017213021 | 3300031236 | Palsa | MLTSEQINDLHRLYWAEHWPIRKIERHLNMGWQTIKKYLDA |
Ga0265325_104392381 | 3300031241 | Rhizosphere | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLEAP |
Ga0272448_10784513 | 3300031463 | Sediment | MLTADQINDLHSLYWSERWPIRKIERHLHRSWRTIKAA |
Ga0302320_115194401 | 3300031524 | Bog | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTPA |
Ga0302326_133484191 | 3300031525 | Palsa | MLTSEQINDLHRLYWAEHWPIRKIERHLTLGWQTIKKYLDAP |
Ga0318541_102428053 | 3300031545 | Soil | MLTTDQINDLYRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQG |
Ga0318515_104663542 | 3300031572 | Soil | MLTNEQIQTLHQLYYAERWSIRKIERHLSMGWRTIKKYLQQPD |
Ga0318542_104038562 | 3300031668 | Soil | MLTTDQINDLYRLYWSERWPIRKIERHLRMSWRTIKKYLDGPAQ |
Ga0310686_1056236391 | 3300031708 | Soil | MLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPAQ |
Ga0310686_1059113041 | 3300031708 | Soil | MLSTEQINYLHRLYWSERWPMRKIERHLRMGWQTIRKYL |
Ga0265342_101358061 | 3300031712 | Rhizosphere | MLTTEQINDLHHLYWSEHWPIRKIERHLHMGWETIKKYL |
Ga0265342_103075671 | 3300031712 | Rhizosphere | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTPAGRP |
Ga0310813_100824854 | 3300031716 | Soil | MLTTDRINELHRLYWSERWPIRKIERHLRMSWRTIKKY |
Ga0306917_107518502 | 3300031719 | Soil | MLTTDQINGRLYWTEHWPIRKIERHLRMNWRTIKKYLDAPAQAPA |
Ga0318502_105443761 | 3300031747 | Soil | MLTTEQINDLHRLYWSDHWPIRKIERHLHMGWNTIK |
Ga0302319_101838191 | 3300031788 | Bog | MLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTI |
Ga0302319_102270421 | 3300031788 | Bog | MLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIHKYLEAPAQGP |
Ga0302319_106267101 | 3300031788 | Bog | MLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIRKYLEALAQVPAVRSG |
Ga0302319_117179371 | 3300031788 | Bog | MLTSDQINELHRLYISERWPIRKIERHLKLGWKTIKKYLETPAQ |
Ga0315297_112224131 | 3300031873 | Sediment | MLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTI |
Ga0318544_103108512 | 3300031880 | Soil | MLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQGPALR |
Ga0306921_108734711 | 3300031912 | Soil | MLTIEQINDLHRLYWSEHWPIRKIERHLHMGWKTIKK |
Ga0306926_118367392 | 3300031954 | Soil | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLETPAQ |
Ga0318563_105836342 | 3300032009 | Soil | MLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYLHAP |
Ga0306924_112383831 | 3300032076 | Soil | MLNTEQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLD |
Ga0318540_102944291 | 3300032094 | Soil | MLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLEAPAQ |
Ga0311301_101859021 | 3300032160 | Peatlands Soil | MLTTDQINDLHHLYWAEHWPIRKIEQHLRMSWHTIK |
Ga0315268_112963071 | 3300032173 | Sediment | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLETPAQTPATR |
Ga0315275_115639802 | 3300032401 | Sediment | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETI |
Ga0335085_102139593 | 3300032770 | Soil | MLTTDQINDLHHLYWSEHWPIRKIERHLRMSWRTIKKYLHA |
Ga0335082_114691541 | 3300032782 | Soil | MLTSDQINDLHRLYWSEHWPIRKIERHLHRSWRTIKKYLDAP |
Ga0335078_112481491 | 3300032805 | Soil | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLKAP |
Ga0335080_108599393 | 3300032828 | Soil | MLTTDQINDLHRLYWSERWPIRKIERHLQMGWHTIRKYLDAPAQGPA |
Ga0335080_110999461 | 3300032828 | Soil | MLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKY |
Ga0335081_104692153 | 3300032892 | Soil | MLSTEQINELHRLYWSERWPIRKIERHLRMSWRTIKKYLH |
Ga0335081_118838521 | 3300032892 | Soil | MLTTDQINDLHHLYWSERWPIRRIERHLHLSWRTIKKYLEAPAQ |
Ga0335081_124086421 | 3300032892 | Soil | MLTHEQIQTLYQLFYAERWPIRKIERHLGMGWRTIKK |
Ga0335072_109420361 | 3300032898 | Soil | MLTADQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLKAPAQT |
Ga0335076_114327861 | 3300032955 | Soil | MLTADQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYL |
Ga0335076_117158841 | 3300032955 | Soil | MLTTDQINELHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGP |
Ga0335084_109447121 | 3300033004 | Soil | MLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKK |
Ga0335073_110691511 | 3300033134 | Soil | MLTTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGPA |
Ga0326727_111987621 | 3300033405 | Peat Soil | MLSTEQINDLHRLYWSEHWPIRKIERHLRMGWHTIRKYLDAPAQGPAR |
Ga0316617_1012160541 | 3300033557 | Soil | MLTADQINDLHRLYWSERWPIRKIERHLHRSWRTIKKYLDAPAQSAA |
Ga0334848_096448_1_120 | 3300033827 | Soil | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLD |
Ga0364937_118438_2_151 | 3300034113 | Sediment | MLTPDQINDLHRLYWSERWPIRKIERHLRMGWRTIKKYLDMPAQTPAGRP |
Ga0370483_0204931_544_669 | 3300034124 | Untreated Peat Soil | MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDMP |
Ga0364929_0113668_732_860 | 3300034149 | Sediment | MLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLKAPA |
Ga0364933_171678_425_565 | 3300034150 | Sediment | MRIEPMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMP |
⦗Top⦘ |