


| Basic Information | |
|---|---|
| Family ID | F019551 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 229 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Number of Associated Samples | 178 |
| Number of Associated Scaffolds | 229 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 62.17 % |
| % of genes near scaffold ends (potentially truncated) | 44.54 % |
| % of genes from short scaffolds (< 2000 bps) | 87.34 % |
| Associated GOLD sequencing projects | 163 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.812 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (19.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.546 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.083 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 229 Family Scaffolds |
|---|---|---|
| PF00462 | Glutaredoxin | 17.47 |
| PF02169 | LPP20 | 13.54 |
| PF13671 | AAA_33 | 1.75 |
| PF06414 | Zeta_toxin | 0.87 |
| PF01106 | NifU | 0.87 |
| PF14328 | DUF4385 | 0.44 |
| PF09293 | RNaseH_C | 0.44 |
| PF01467 | CTP_transf_like | 0.44 |
| PF02739 | 5_3_exonuc_N | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
|---|---|---|---|
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.81 % |
| All Organisms | root | All Organisms | 33.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10052497 | Not Available | 2024 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10052827 | Not Available | 2015 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10218825 | Not Available | 623 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10280850 | Not Available | 507 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10177243 | Not Available | 610 | Open in IMG/M |
| 3300000137|LP_F_10_SI03_10DRAFT_c1007434 | All Organisms → Viruses → Predicted Viral | 2404 | Open in IMG/M |
| 3300000148|SI47jul10_100mDRAFT_c1021188 | Not Available | 1082 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1009501 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1015504 | Not Available | 975 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1022240 | Not Available | 781 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1024748 | Not Available | 620 | Open in IMG/M |
| 3300000187|SI53jan11_100mDRAFT_c1048919 | Not Available | 534 | Open in IMG/M |
| 3300001352|JGI20157J14317_10163573 | Not Available | 676 | Open in IMG/M |
| 3300001450|JGI24006J15134_10045157 | Not Available | 1841 | Open in IMG/M |
| 3300001450|JGI24006J15134_10048687 | All Organisms → Viruses → Predicted Viral | 1746 | Open in IMG/M |
| 3300001589|JGI24005J15628_10111106 | Not Available | 900 | Open in IMG/M |
| 3300002231|KVRMV2_100030335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 924 | Open in IMG/M |
| 3300002242|KVWGV2_10183393 | Not Available | 803 | Open in IMG/M |
| 3300003540|FS896DNA_10867581 | Not Available | 555 | Open in IMG/M |
| 3300003620|JGI26273J51734_10090805 | Not Available | 865 | Open in IMG/M |
| 3300005057|Ga0068511_1084784 | Not Available | 553 | Open in IMG/M |
| 3300005239|Ga0073579_1104113 | Not Available | 906 | Open in IMG/M |
| 3300005239|Ga0073579_1189490 | Not Available | 9040 | Open in IMG/M |
| 3300005398|Ga0066858_10161128 | Not Available | 648 | Open in IMG/M |
| 3300005404|Ga0066856_10300601 | Not Available | 692 | Open in IMG/M |
| 3300005404|Ga0066856_10391773 | Not Available | 595 | Open in IMG/M |
| 3300005408|Ga0066848_10097991 | Not Available | 798 | Open in IMG/M |
| 3300005431|Ga0066854_10026925 | Not Available | 1898 | Open in IMG/M |
| 3300005510|Ga0066825_10223405 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 694 | Open in IMG/M |
| 3300005934|Ga0066377_10298177 | Not Available | 500 | Open in IMG/M |
| 3300005960|Ga0066364_10310253 | Not Available | 554 | Open in IMG/M |
| 3300005971|Ga0066370_10014078 | Not Available | 2202 | Open in IMG/M |
| 3300006166|Ga0066836_10370012 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 862 | Open in IMG/M |
| 3300006316|Ga0068473_1360522 | Not Available | 553 | Open in IMG/M |
| 3300006332|Ga0068500_1172552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 3924 | Open in IMG/M |
| 3300006382|Ga0075494_1359814 | Not Available | 828 | Open in IMG/M |
| 3300006411|Ga0099956_1071923 | Not Available | 907 | Open in IMG/M |
| 3300006484|Ga0070744_10092206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 877 | Open in IMG/M |
| 3300006484|Ga0070744_10123606 | Not Available | 745 | Open in IMG/M |
| 3300006484|Ga0070744_10155804 | Not Available | 654 | Open in IMG/M |
| 3300006737|Ga0098037_1128705 | Not Available | 861 | Open in IMG/M |
| 3300006751|Ga0098040_1189563 | Not Available | 602 | Open in IMG/M |
| 3300006803|Ga0075467_10233357 | Not Available | 1006 | Open in IMG/M |
| 3300006928|Ga0098041_1229410 | Not Available | 593 | Open in IMG/M |
| 3300007283|Ga0066366_10392201 | Not Available | 602 | Open in IMG/M |
| 3300007291|Ga0066367_1175473 | Not Available | 815 | Open in IMG/M |
| 3300007345|Ga0070752_1207719 | Not Available | 777 | Open in IMG/M |
| 3300007555|Ga0102817_1030344 | Not Available | 1192 | Open in IMG/M |
| 3300007555|Ga0102817_1064246 | Not Available | 802 | Open in IMG/M |
| 3300007555|Ga0102817_1079562 | Not Available | 717 | Open in IMG/M |
| 3300007647|Ga0102855_1176960 | Not Available | 569 | Open in IMG/M |
| 3300007692|Ga0102823_1188131 | Not Available | 551 | Open in IMG/M |
| 3300007956|Ga0105741_1139190 | Not Available | 595 | Open in IMG/M |
| 3300008999|Ga0102816_1027198 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| 3300008999|Ga0102816_1252833 | Not Available | 556 | Open in IMG/M |
| 3300009172|Ga0114995_10543502 | Not Available | 635 | Open in IMG/M |
| 3300009193|Ga0115551_1397900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 592 | Open in IMG/M |
| 3300009422|Ga0114998_10502742 | Not Available | 568 | Open in IMG/M |
| 3300009426|Ga0115547_1215603 | Not Available | 603 | Open in IMG/M |
| 3300009433|Ga0115545_1143665 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 836 | Open in IMG/M |
| 3300009434|Ga0115562_1184503 | Not Available | 756 | Open in IMG/M |
| 3300009438|Ga0115559_1187163 | Not Available | 753 | Open in IMG/M |
| 3300009445|Ga0115553_1174699 | Not Available | 868 | Open in IMG/M |
| 3300009481|Ga0114932_10132344 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
| 3300009481|Ga0114932_10143310 | Not Available | 1471 | Open in IMG/M |
| 3300009481|Ga0114932_10894920 | Not Available | 512 | Open in IMG/M |
| 3300009496|Ga0115570_10268499 | Not Available | 747 | Open in IMG/M |
| 3300009496|Ga0115570_10289159 | Not Available | 713 | Open in IMG/M |
| 3300009496|Ga0115570_10440854 | Not Available | 550 | Open in IMG/M |
| 3300009505|Ga0115564_10484182 | Not Available | 598 | Open in IMG/M |
| 3300009508|Ga0115567_10346900 | Not Available | 922 | Open in IMG/M |
| 3300009512|Ga0115003_10664228 | Not Available | 607 | Open in IMG/M |
| 3300009550|Ga0115013_10017093 | All Organisms → Viruses → Predicted Viral | 3840 | Open in IMG/M |
| 3300009550|Ga0115013_10346624 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 932 | Open in IMG/M |
| 3300009550|Ga0115013_10646813 | Not Available | 711 | Open in IMG/M |
| 3300009593|Ga0115011_10880402 | Not Available | 748 | Open in IMG/M |
| 3300009703|Ga0114933_10122200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1813 | Open in IMG/M |
| 3300009703|Ga0114933_10819530 | Not Available | 593 | Open in IMG/M |
| 3300009706|Ga0115002_10865179 | Not Available | 627 | Open in IMG/M |
| 3300009785|Ga0115001_10283578 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1054 | Open in IMG/M |
| 3300009785|Ga0115001_10802119 | Not Available | 567 | Open in IMG/M |
| 3300009786|Ga0114999_10552983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 880 | Open in IMG/M |
| 3300009790|Ga0115012_10627870 | Not Available | 854 | Open in IMG/M |
| 3300010148|Ga0098043_1162647 | Not Available | 628 | Open in IMG/M |
| 3300010153|Ga0098059_1299250 | Not Available | 615 | Open in IMG/M |
| 3300011248|Ga0151670_1043774 | Not Available | 2094 | Open in IMG/M |
| 3300011252|Ga0151674_1004765 | All Organisms → Viruses | 1044 | Open in IMG/M |
| 3300011254|Ga0151675_1002630 | Not Available | 549 | Open in IMG/M |
| 3300011254|Ga0151675_1033376 | Not Available | 644 | Open in IMG/M |
| 3300011258|Ga0151677_1009329 | Not Available | 3525 | Open in IMG/M |
| 3300012413|Ga0138258_1467164 | All Organisms → Viruses | 658 | Open in IMG/M |
| 3300012928|Ga0163110_10752020 | Not Available | 763 | Open in IMG/M |
| 3300012952|Ga0163180_10043546 | All Organisms → Viruses → Predicted Viral | 2672 | Open in IMG/M |
| 3300012953|Ga0163179_10533820 | Not Available | 975 | Open in IMG/M |
| 3300012953|Ga0163179_11501560 | Not Available | 606 | Open in IMG/M |
| 3300017709|Ga0181387_1020579 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300017713|Ga0181391_1069799 | Not Available | 811 | Open in IMG/M |
| 3300017714|Ga0181412_1136965 | Not Available | 556 | Open in IMG/M |
| 3300017717|Ga0181404_1004543 | All Organisms → Viruses → Predicted Viral | 3841 | Open in IMG/M |
| 3300017719|Ga0181390_1044050 | Not Available | 1335 | Open in IMG/M |
| 3300017720|Ga0181383_1002992 | Not Available | 4713 | Open in IMG/M |
| 3300017720|Ga0181383_1012690 | Not Available | 2256 | Open in IMG/M |
| 3300017720|Ga0181383_1165440 | Not Available | 592 | Open in IMG/M |
| 3300017728|Ga0181419_1003082 | Not Available | 5400 | Open in IMG/M |
| 3300017728|Ga0181419_1069856 | Not Available | 890 | Open in IMG/M |
| 3300017729|Ga0181396_1054519 | Not Available | 797 | Open in IMG/M |
| 3300017733|Ga0181426_1112022 | Not Available | 548 | Open in IMG/M |
| 3300017735|Ga0181431_1103816 | Not Available | 637 | Open in IMG/M |
| 3300017740|Ga0181418_1028733 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
| 3300017741|Ga0181421_1065465 | Not Available | 957 | Open in IMG/M |
| 3300017744|Ga0181397_1003040 | Not Available | 5741 | Open in IMG/M |
| 3300017745|Ga0181427_1058140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 953 | Open in IMG/M |
| 3300017745|Ga0181427_1130435 | Not Available | 611 | Open in IMG/M |
| 3300017746|Ga0181389_1180809 | Not Available | 550 | Open in IMG/M |
| 3300017751|Ga0187219_1070477 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300017753|Ga0181407_1115980 | Not Available | 669 | Open in IMG/M |
| 3300017755|Ga0181411_1059935 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300017756|Ga0181382_1058547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1097 | Open in IMG/M |
| 3300017759|Ga0181414_1102572 | Not Available | 752 | Open in IMG/M |
| 3300017760|Ga0181408_1042146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1233 | Open in IMG/M |
| 3300017760|Ga0181408_1047455 | Not Available | 1153 | Open in IMG/M |
| 3300017763|Ga0181410_1088858 | Not Available | 904 | Open in IMG/M |
| 3300017764|Ga0181385_1002708 | Not Available | 6133 | Open in IMG/M |
| 3300017764|Ga0181385_1032700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1642 | Open in IMG/M |
| 3300017768|Ga0187220_1262164 | Not Available | 516 | Open in IMG/M |
| 3300017770|Ga0187217_1009100 | All Organisms → Viruses → Predicted Viral | 3668 | Open in IMG/M |
| 3300017771|Ga0181425_1165210 | Not Available | 699 | Open in IMG/M |
| 3300017772|Ga0181430_1082117 | Not Available | 972 | Open in IMG/M |
| 3300017779|Ga0181395_1054831 | All Organisms → Viruses → Predicted Viral | 1310 | Open in IMG/M |
| 3300017779|Ga0181395_1070197 | Not Available | 1138 | Open in IMG/M |
| 3300017786|Ga0181424_10064689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1580 | Open in IMG/M |
| 3300017786|Ga0181424_10344234 | Not Available | 614 | Open in IMG/M |
| 3300019025|Ga0193545_10083076 | Not Available | 674 | Open in IMG/M |
| 3300020165|Ga0206125_10029519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 3022 | Open in IMG/M |
| 3300020165|Ga0206125_10067630 | Not Available | 1634 | Open in IMG/M |
| 3300020165|Ga0206125_10090968 | Not Available | 1317 | Open in IMG/M |
| 3300020166|Ga0206128_1176995 | Not Available | 837 | Open in IMG/M |
| 3300020187|Ga0206130_10362206 | Not Available | 597 | Open in IMG/M |
| 3300020246|Ga0211707_1009971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1394 | Open in IMG/M |
| 3300020246|Ga0211707_1013510 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1171 | Open in IMG/M |
| 3300020247|Ga0211654_1013374 | Not Available | 1343 | Open in IMG/M |
| 3300020251|Ga0211700_1009703 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300020252|Ga0211696_1023801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 748 | Open in IMG/M |
| 3300020258|Ga0211529_1018078 | Not Available | 1191 | Open in IMG/M |
| 3300020268|Ga0211495_1031193 | Not Available | 1095 | Open in IMG/M |
| 3300020312|Ga0211542_1050599 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 769 | Open in IMG/M |
| 3300020319|Ga0211517_1054129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 790 | Open in IMG/M |
| 3300020343|Ga0211626_1045904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1124 | Open in IMG/M |
| 3300020385|Ga0211677_10071635 | All Organisms → Viruses → Predicted Viral | 1553 | Open in IMG/M |
| 3300020386|Ga0211582_10382076 | Not Available | 525 | Open in IMG/M |
| 3300020396|Ga0211687_10160105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 926 | Open in IMG/M |
| 3300020399|Ga0211623_10058175 | Not Available | 1316 | Open in IMG/M |
| 3300020400|Ga0211636_10265158 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 658 | Open in IMG/M |
| 3300020407|Ga0211575_10395280 | Not Available | 572 | Open in IMG/M |
| 3300020410|Ga0211699_10241667 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 696 | Open in IMG/M |
| 3300020411|Ga0211587_10133096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1062 | Open in IMG/M |
| 3300020411|Ga0211587_10325377 | Not Available | 629 | Open in IMG/M |
| 3300020419|Ga0211512_10506535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 538 | Open in IMG/M |
| 3300020428|Ga0211521_10426722 | Not Available | 577 | Open in IMG/M |
| 3300020431|Ga0211554_10235831 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 873 | Open in IMG/M |
| 3300020436|Ga0211708_10152370 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 920 | Open in IMG/M |
| 3300020436|Ga0211708_10235012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 740 | Open in IMG/M |
| 3300020438|Ga0211576_10505752 | Not Available | 610 | Open in IMG/M |
| 3300020445|Ga0211564_10014501 | All Organisms → Viruses → Predicted Viral | 3901 | Open in IMG/M |
| 3300020450|Ga0211641_10262986 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 848 | Open in IMG/M |
| 3300020459|Ga0211514_10656084 | Not Available | 512 | Open in IMG/M |
| 3300020464|Ga0211694_10076628 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300020468|Ga0211475_10121047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1351 | Open in IMG/M |
| 3300020470|Ga0211543_10384161 | Not Available | 675 | Open in IMG/M |
| 3300020471|Ga0211614_10394927 | Not Available | 611 | Open in IMG/M |
| 3300020595|Ga0206126_10096032 | Not Available | 1475 | Open in IMG/M |
| 3300021185|Ga0206682_10226893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 839 | Open in IMG/M |
| 3300021365|Ga0206123_10087788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1509 | Open in IMG/M |
| 3300021389|Ga0213868_10148115 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300021959|Ga0222716_10560005 | Not Available | 632 | Open in IMG/M |
| 3300022074|Ga0224906_1138519 | Not Available | 693 | Open in IMG/M |
| 3300022074|Ga0224906_1176359 | Not Available | 592 | Open in IMG/M |
| 3300022164|Ga0212022_1027822 | Not Available | 862 | Open in IMG/M |
| 3300022925|Ga0255773_10381181 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 542 | Open in IMG/M |
| 3300024235|Ga0228665_1068800 | Not Available | 730 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10069882 | Not Available | 1697 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10379813 | Not Available | 520 | Open in IMG/M |
| 3300024344|Ga0209992_10006947 | Not Available | 7811 | Open in IMG/M |
| 3300024344|Ga0209992_10017852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3955 | Open in IMG/M |
| 3300024344|Ga0209992_10018504 | All Organisms → Viruses → Predicted Viral | 3858 | Open in IMG/M |
| 3300024344|Ga0209992_10100910 | Not Available | 1295 | Open in IMG/M |
| 3300024344|Ga0209992_10140397 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1058 | Open in IMG/M |
| 3300024346|Ga0244775_10433608 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300024348|Ga0244776_10424850 | Not Available | 876 | Open in IMG/M |
| 3300025120|Ga0209535_1126952 | Not Available | 854 | Open in IMG/M |
| 3300025138|Ga0209634_1120755 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1119 | Open in IMG/M |
| 3300025138|Ga0209634_1331059 | Not Available | 510 | Open in IMG/M |
| 3300025594|Ga0209094_1044103 | All Organisms → Viruses | 1196 | Open in IMG/M |
| 3300025707|Ga0209667_1095611 | Not Available | 958 | Open in IMG/M |
| 3300025832|Ga0209307_1197279 | Not Available | 586 | Open in IMG/M |
| 3300025849|Ga0209603_1252709 | Not Available | 640 | Open in IMG/M |
| 3300025880|Ga0209534_10263255 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 817 | Open in IMG/M |
| 3300025881|Ga0209309_10489533 | Not Available | 513 | Open in IMG/M |
| 3300026188|Ga0208274_1136963 | Not Available | 536 | Open in IMG/M |
| 3300026201|Ga0208127_1010844 | All Organisms → Viruses → Predicted Viral | 3551 | Open in IMG/M |
| 3300027081|Ga0208954_1033633 | Not Available | 671 | Open in IMG/M |
| 3300027170|Ga0208963_1040555 | Not Available | 734 | Open in IMG/M |
| 3300027298|Ga0208970_1028310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1015 | Open in IMG/M |
| 3300027522|Ga0209384_1023492 | All Organisms → Viruses → Predicted Viral | 1921 | Open in IMG/M |
| 3300027631|Ga0208133_1055803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 950 | Open in IMG/M |
| 3300027668|Ga0209482_1018969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 3020 | Open in IMG/M |
| 3300027687|Ga0209710_1075106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1418 | Open in IMG/M |
| 3300027687|Ga0209710_1205017 | Not Available | 668 | Open in IMG/M |
| 3300027687|Ga0209710_1260424 | Not Available | 556 | Open in IMG/M |
| 3300027702|Ga0209036_1051714 | Not Available | 1324 | Open in IMG/M |
| 3300027751|Ga0208304_10319971 | Not Available | 539 | Open in IMG/M |
| 3300027752|Ga0209192_10139395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 966 | Open in IMG/M |
| 3300027830|Ga0209359_10262407 | Not Available | 785 | Open in IMG/M |
| 3300027859|Ga0209503_10010599 | All Organisms → Viruses → Predicted Viral | 4082 | Open in IMG/M |
| 3300028194|Ga0257106_1081339 | Not Available | 1183 | Open in IMG/M |
| 3300028488|Ga0257113_1030920 | Not Available | 1771 | Open in IMG/M |
| 3300029448|Ga0183755_1003404 | Not Available | 7964 | Open in IMG/M |
| 3300029448|Ga0183755_1008995 | All Organisms → Viruses → Predicted Viral | 4107 | Open in IMG/M |
| 3300029448|Ga0183755_1064564 | Not Available | 847 | Open in IMG/M |
| 3300031519|Ga0307488_10061633 | All Organisms → Viruses → Predicted Viral | 2857 | Open in IMG/M |
| 3300031519|Ga0307488_10081550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2404 | Open in IMG/M |
| 3300031519|Ga0307488_10191467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1394 | Open in IMG/M |
| 3300031519|Ga0307488_10326795 | Not Available | 976 | Open in IMG/M |
| 3300031599|Ga0308007_10291827 | Not Available | 543 | Open in IMG/M |
| 3300031773|Ga0315332_10866223 | Not Available | 544 | Open in IMG/M |
| 3300032006|Ga0310344_11414132 | Not Available | 570 | Open in IMG/M |
| 3300032047|Ga0315330_10384643 | Not Available | 868 | Open in IMG/M |
| 3300032047|Ga0315330_10624596 | Not Available | 636 | Open in IMG/M |
| 3300032073|Ga0315315_10826964 | Not Available | 841 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 19.21% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 17.03% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.59% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.55% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 4.37% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.06% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.06% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.06% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.18% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.18% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.18% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.18% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.75% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.75% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.31% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.87% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.44% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.44% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.44% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.44% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.44% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.44% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.44% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.44% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.44% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000137 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10 | Environmental | Open in IMG/M |
| 3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000187 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 100m | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
| 3300005431 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006382 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006411 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0200m | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011248 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.2 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300019025 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
| 3300020252 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020268 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556113-ERR599107) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020319 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020386 | Marine microbial communities from Tara Oceans - TARA_B100000609 (ERX555990-ERR599038) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020407 | Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300026188 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV43 (SPAdes) | Environmental | Open in IMG/M |
| 3300026201 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027081 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027170 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027298 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100524973 | 3300000101 | Marine | MFKIIVLVAAIVVITTQWSDFNEIVNLTKIIEVTSEVITKVKE* |
| DelMOSum2010_100528274 | 3300000101 | Marine | MFKMIMLVAAIVVITTQWSEFNEIVNLASIFEVTGEIITKVKE* |
| DelMOSum2010_102188252 | 3300000101 | Marine | MFKLILWIAAIVIITTQWNAFTEIVDLAKIIEVTHEIITKVKE* |
| DelMOSum2010_102808502 | 3300000101 | Marine | MFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE* |
| DelMOSum2011_101772432 | 3300000115 | Marine | MFKIIMFVAAIVVITTQWDAFTEIVDLAKVIEVTHEIITKVKE* |
| LP_F_10_SI03_10DRAFT_10074344 | 3300000137 | Marine | MFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIIMKVKE* |
| SI47jul10_100mDRAFT_10211883 | 3300000148 | Marine | ALFNGRWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| LPaug09P1610mDRAFT_10095014 | 3300000149 | Marine | LFNKRWCLGETVMFKLIILVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| LPaug09P1610mDRAFT_10155043 | 3300000149 | Marine | IILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| LPaug09P1610mDRAFT_10222402 | 3300000149 | Marine | GETVMFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| LPaug08P2610mDRAFT_10247482 | 3300000159 | Marine | MFKIIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| SI53jan11_100mDRAFT_10489192 | 3300000187 | Marine | IAAIVIITTQWSAFTEIVDLAKVIEVTHEIIMKVKE* |
| JGI20157J14317_101635732 | 3300001352 | Pelagic Marine | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFXVTSEIITKVKE* |
| JGI24006J15134_100451574 | 3300001450 | Marine | MFKIIILVAAIVVITTQWSAFTEIVDLAKIIEVTHEVITKVKE* |
| JGI24006J15134_100486872 | 3300001450 | Marine | MFKIIMFVAAIVVITTQWNAFTEIVDLAKVIEVTHEIITKVKE* |
| JGI24005J15628_101111061 | 3300001589 | Marine | MFKLILWIAAIVIITTQWNAFTEIVDLAKVIEVTHEIITKVKE* |
| KVRMV2_1000303352 | 3300002231 | Marine Sediment | MFKLIVWIAAIVIITTQWNAFTEIVDXAKVIEVTHEXITKVKE* |
| KVWGV2_101833932 | 3300002242 | Marine Sediment | LIVLVAAVIIITTQWSAFTDVVDLAKVIXXTXEIITKVKE* |
| FS896DNA_108675811 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | IMYKLILLVACIVVITVHWTEFNDIVNLASIFEVTGEIITKVKE* |
| JGI26273J51734_100908052 | 3300003620 | Marine | ETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0068511_10847841 | 3300005057 | Marine Water | RNNKMFKLIVLLAAIIVITTQWGAFTDIIDVSKALEVTSEIITKVKE* |
| Ga0073579_11041132 | 3300005239 | Marine | MFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0073579_118949014 | 3300005239 | Marine | MFKLIVLVAAIVVITTQWSAFNEIVNLASIFEVTREIITKVKE* |
| Ga0066858_101611282 | 3300005398 | Marine | MFKLIVLVAAIVIITTQWGAFTDIVDLAKVFEVTGEIITKVKE* |
| Ga0066856_103006012 | 3300005404 | Marine | MFKLIVLLAAIIVITTQWGAFTDIIDVSKALEVTSEIITKVKE* |
| Ga0066856_103917731 | 3300005404 | Marine | MFKMIVLVAAIVVITTQWNDFNEIVNLTKIIEVTGEVITKVKE* |
| Ga0066848_100979912 | 3300005408 | Marine | GETVMFKIIILVAAIIVITTQWSEFNEIVNLASIFEVTGEIIMKVKE* |
| Ga0066854_100269251 | 3300005431 | Marine | MFKIIILVAAIIVITTQWSEFNEIVNLASIFEVTGEIITKVKE* |
| Ga0066825_102234053 | 3300005510 | Marine | MFKLIVLLAAIIVITTQWGAFTDIIDVSKALEVTGEIITKVKE* |
| Ga0066377_102981772 | 3300005934 | Marine | MFKLIVLLAAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE* |
| Ga0066364_103102532 | 3300005960 | Marine | MFKLIVLLAAIIVITTQWGAFTDIVDVSKAIEVTSEIITKVKE* |
| Ga0066370_100140787 | 3300005971 | Marine | MYKLILLVAAIVIITTQWSAFTEAVDFVKMIEVTSEIITKVKE* |
| Ga0066836_103700123 | 3300006166 | Marine | MFKLIVLLAAIIVITTQWGAFTDIVDISKALEVTGEIITKVKE* |
| Ga0068473_13605221 | 3300006316 | Marine | MYKLILLVACIVVITVHWTEFNDIVNLASIFEVTGEIITKVKE* |
| Ga0068500_11725529 | 3300006332 | Marine | MFKLIVWIAAIVIITTQWNAFTEIVDLAKVIEVTHEIITKVKE* |
| Ga0075494_13598142 | 3300006382 | Aqueous | MFKIIMFVAAIVVITTQWDAFTEIVDLAKIIEVTHEIITKVKE* |
| Ga0099956_10719232 | 3300006411 | Marine | MYKLIVLVAAIVIITTQWSAFTDVVDLAKIFEVTGEIITKVKE* |
| Ga0070744_100922061 | 3300006484 | Estuarine | MFKLIILVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0070744_101236062 | 3300006484 | Estuarine | MFKLIVLVAAIVIITTQWSEFNEIVNLASIFEITSEIITKVKE* |
| Ga0070744_101558041 | 3300006484 | Estuarine | FKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE* |
| Ga0098037_11287052 | 3300006737 | Marine | MYKLIVLVAAVVVITTQWSDFTDIVDLAKIFEVTGEVITKVKE* |
| Ga0098040_11895631 | 3300006751 | Marine | MYKLIILVACIVVITVHWTEFNDIVNLASIFEVTGDIITKVKE* |
| Ga0075467_102333572 | 3300006803 | Aqueous | MFKMIMLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKAKE* |
| Ga0098041_12294102 | 3300006928 | Marine | MFKLIVLVAAIVVITTQWNDFTEIVDLASIFEVTSEIITKVKE* |
| Ga0066366_103922011 | 3300007283 | Marine | MFKLIVLVAAIVVITTQWGAFTDIVDLAKVFEITGEIITKVKE* |
| Ga0066367_11754733 | 3300007291 | Marine | MFKIIILVAAIVVITTQWSEFNEIVNLASIFEVIGEIITKVKE* |
| Ga0070752_12077192 | 3300007345 | Aqueous | MFKMIMLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0102817_10303444 | 3300007555 | Estuarine | MFKMIVLVAAIVVITTQWNDFNEIVNLTKIIEVTGEVI |
| Ga0102817_10642461 | 3300007555 | Estuarine | CLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0102817_10795622 | 3300007555 | Estuarine | GETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0102855_11769602 | 3300007647 | Estuarine | CLGETVMFKIIMFVAAIVVITTQWNAFTEIVDLAKVIEVTHEIITKVKE* |
| Ga0102823_11881311 | 3300007692 | Estuarine | AIVIITTQWNAFTEIVDLAKIIEVTHEIITKVKE* |
| Ga0105741_11391903 | 3300007956 | Estuary Water | MFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIIT |
| Ga0102816_10271982 | 3300008999 | Estuarine | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0102816_12528331 | 3300008999 | Estuarine | MFKIIILVAAIIVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0114995_105435021 | 3300009172 | Marine | MFKIIMFVAAIVVITTQWDAFTEIVDLAKIIEVTHEVVTKVKE* |
| Ga0115551_13979002 | 3300009193 | Pelagic Marine | MFKLILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0114998_105027421 | 3300009422 | Marine | TVMFKIIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115547_12156031 | 3300009426 | Pelagic Marine | TVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115545_11436651 | 3300009433 | Pelagic Marine | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITK |
| Ga0115562_11845032 | 3300009434 | Pelagic Marine | LGETVMFKIIVWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE* |
| Ga0115559_11871632 | 3300009438 | Pelagic Marine | RWCLGETVMFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE* |
| Ga0115553_11746993 | 3300009445 | Pelagic Marine | AAIVVITTQWSEFNEIVNLASIFEVTSEIITKDKE* |
| Ga0114932_101323443 | 3300009481 | Deep Subsurface | MYKLIILVAAIVIITTQWGAFTDIIDLTKVFEVTSEIITKVKE* |
| Ga0114932_101433101 | 3300009481 | Deep Subsurface | MFKLIVLVAAVIIITTQWSAFTDVVDLAKVIEVTHEIITKVKE* |
| Ga0114932_108949201 | 3300009481 | Deep Subsurface | NMFKLIVLVAAVIIITTQWSAFTDVVDLAKVIEVTHEIITKVKE* |
| Ga0115570_102684992 | 3300009496 | Pelagic Marine | GETVMFKLIVLVAAIVVITTQWSEFNEIVNLASICEVTSEIITKVKE* |
| Ga0115570_102891593 | 3300009496 | Pelagic Marine | MFKLIILVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKV |
| Ga0115570_104408542 | 3300009496 | Pelagic Marine | MFKIIVWIAAIVIITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115564_104841821 | 3300009505 | Pelagic Marine | MFKLIILVAAIVVITTQWSEFNEIVNLASIFEVTSEII |
| Ga0115567_103469001 | 3300009508 | Pelagic Marine | FKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115003_106642282 | 3300009512 | Marine | GETVMFKIIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115013_100170936 | 3300009550 | Marine | MYKLIVLVAAVVIITTQWSAFTEAVDLVKMIEVTSEIITKVKE* |
| Ga0115013_103466242 | 3300009550 | Marine | MFKLIVWIAAIVIITTQWSAFTEIVDLAKIIEVTHEIIIKVKE* |
| Ga0115013_106468132 | 3300009550 | Marine | MVNGRNNKMFKLIVLLAAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE* |
| Ga0115011_108804021 | 3300009593 | Marine | IMFKMIVLVAAIVVITTQWNDFNEIVNLTKIIEVTGEVITKVKE* |
| Ga0114933_101222003 | 3300009703 | Deep Subsurface | MYKLIILVAAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE* |
| Ga0114933_108195302 | 3300009703 | Deep Subsurface | MVFGRNNNMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115002_108651792 | 3300009706 | Marine | VAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115001_102835784 | 3300009785 | Marine | MFKIIVLVAAIVVITTQWSEFNEIVNLASIFEVTSE |
| Ga0115001_108021192 | 3300009785 | Marine | AIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0114999_105529833 | 3300009786 | Marine | AAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0115012_106278703 | 3300009790 | Marine | MVFGRNNNMFKLIVLVAAVIIITTQWSAFTDVVDLAKIFEVTGEIITKVKE* |
| Ga0098043_11626471 | 3300010148 | Marine | KLIVLVAAVVVITTQWGAFTEIVDLAKILEVSSEIITKVKE* |
| Ga0098059_12992502 | 3300010153 | Marine | KMFKLIVLVAAIVVITTQWGAFTDIVDLAKVFEITGEIITKVKE* |
| Ga0151670_10437742 | 3300011248 | Marine | MFKLIVLVAAIVVITTQWSDFTDIVDLAKIFEVTGEVITKVKE* |
| Ga0151674_10047652 | 3300011252 | Marine | MFKIIVLVAAIVVITTQWSEFNEIVNLAKIIEVTHEIITKVKE* |
| Ga0151675_10026302 | 3300011254 | Marine | MFKLIVLVAAIVVITTQWNDFTEIVDLTKIIEVTGEVITKVKE* |
| Ga0151675_10333762 | 3300011254 | Marine | LGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0151677_10093298 | 3300011258 | Marine | MFKIIVLVAAIVVITTQWSDFNEIVNLTKIIEVTGEVITKVKE* |
| Ga0138258_14671642 | 3300012413 | Polar Marine | MFKIIILVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0163110_107520203 | 3300012928 | Surface Seawater | MGETIMFKIIVWIAAIVIITTQWNAFTEIVDLAKILELTHEVITKVKE* |
| Ga0163180_100435462 | 3300012952 | Seawater | MYKLIVLVAAIVVITTQWGAFTEIVDLAKVLEVTGEIITKVKE* |
| Ga0163179_105338201 | 3300012953 | Seawater | RWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE* |
| Ga0163179_115015602 | 3300012953 | Seawater | MFKLIVLVAAIVVITTQWGAFTEIVDLAKVLEVTGEIITKVKE* |
| Ga0181387_10205792 | 3300017709 | Seawater | MFKIIVWIAAIVIITTQWSAFTEIVDLAKAIEVTHEIITKVKE |
| Ga0181391_10697991 | 3300017713 | Seawater | TVMFKLIVLVAAIVIITTQWSEFNEIVNLASIFEITSEIITKVKE |
| Ga0181412_11369651 | 3300017714 | Seawater | MFKLILWIAAIVIITTQWNAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0181404_10045431 | 3300017717 | Seawater | WCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181390_10440504 | 3300017719 | Seawater | ETVMFKLIVLVAAIVIITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181383_100299211 | 3300017720 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTLL |
| Ga0181383_10126901 | 3300017720 | Seawater | CLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTHEIITKVKE |
| Ga0181383_11654401 | 3300017720 | Seawater | TVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181419_10030821 | 3300017728 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTS |
| Ga0181419_10698561 | 3300017728 | Seawater | KXKWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181396_10545192 | 3300017729 | Seawater | ETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181426_11120222 | 3300017733 | Seawater | CLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181431_11038163 | 3300017735 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKDFL |
| Ga0181418_10287335 | 3300017740 | Seawater | RWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181421_10654652 | 3300017741 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFKVTSEIITKVKE |
| Ga0181397_10030402 | 3300017744 | Seawater | MFKLIVLVAAIVVITTQWSEYNEIVNLASIFEVTSEIITKVKE |
| Ga0181427_10581403 | 3300017745 | Seawater | LVAAIVVITTQWNDFNEIVNLTKIIEVTGEVITKVKE |
| Ga0181427_11304351 | 3300017745 | Seawater | LILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0181389_11808091 | 3300017746 | Seawater | MFKMIVLVAAIVVITTQWSAFTEIVNLAKVLEVSSEIIT |
| Ga0187219_10704772 | 3300017751 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSDIITNVEE |
| Ga0181407_11159801 | 3300017753 | Seawater | RRWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181411_10599351 | 3300017755 | Seawater | MFKLIVLVAAIVISTTQRSEFNEIVNLASIFEITSEIITK |
| Ga0181382_10585472 | 3300017756 | Seawater | MFKLIVLVAAIVIITTQWSEFNEIVNLASIFEVTSEIITKVKEWINI |
| Ga0181414_11025722 | 3300017759 | Seawater | FKIIILVAAIIVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181408_10421463 | 3300017760 | Seawater | GETIMFKMIVLVAAIVVITTQWNDFNEIVNLTKIIEVTGEVITKVKE |
| Ga0181408_10474551 | 3300017760 | Seawater | KWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181410_10888581 | 3300017763 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEITSEIITKVKE |
| Ga0181385_100270813 | 3300017764 | Seawater | MFKMIVLVAAIVVITTQWSAFTEIVNLAKVLEVSSEIITKVKE |
| Ga0181385_10327005 | 3300017764 | Seawater | ETVMFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0187220_12621642 | 3300017768 | Seawater | MFKLILWIAAIVIITTQWNAFTEIVDLAKVIEVTHEIIMKVKE |
| Ga0187217_10091008 | 3300017770 | Seawater | MFKIIVWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIIMKVKE |
| Ga0181425_11652102 | 3300017771 | Seawater | VAAIVVITTQWSAFTEIVNLAKVLEVSSEIITKVKE |
| Ga0181430_10821171 | 3300017772 | Seawater | MFKLIVLVAAIVVITTQWNDFNEIVNLTKIIEVTGEVITKVKE |
| Ga0181395_10548313 | 3300017779 | Seawater | MFKLILWIAAIVIITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181395_10701971 | 3300017779 | Seawater | KLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0181424_100646894 | 3300017786 | Seawater | MFKLIVLVAAIVVITTQWSEFNENVNLASIFEVTSEIITKVKE |
| Ga0181424_103442341 | 3300017786 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEII |
| Ga0193545_100830762 | 3300019025 | Marine | MFKLIVLVAAIVVVTTQWGAFTEIVDLAKVLEVTGEIITKVKE |
| Ga0206125_100295196 | 3300020165 | Seawater | GETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0206125_100676302 | 3300020165 | Seawater | MFKLIILVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0206125_100909682 | 3300020165 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0206128_11769951 | 3300020166 | Seawater | LGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0206130_103622062 | 3300020187 | Seawater | AAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0211707_10099711 | 3300020246 | Marine | MFKLIVLLAAIIVITTQWGAFTDIIDVSKALEVTSEIITKVKE |
| Ga0211707_10135104 | 3300020246 | Marine | MYKLILLVAAIVIITTQWSAFTEAVDFVKMIEVTSEIITKVKE |
| Ga0211654_10133743 | 3300020247 | Marine | MFKLIVLVAAIVVITTQWNDFTEIVDLASIFEVTSEIITKVKE |
| Ga0211700_10097032 | 3300020251 | Marine | MYKLIVLVAAIVIITTQWSAFTEAVDFVKMIEVTSEIITKVKE |
| Ga0211696_10238012 | 3300020252 | Marine | MVFGRNNNMFKLIVLLAAIIVITTQWGAFTDIVDVSKAIEVTSEIITKVKE |
| Ga0211529_10180782 | 3300020258 | Marine | MFKLIVLLAAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE |
| Ga0211495_10311933 | 3300020268 | Marine | MFKLIILVAAIIVITTQWSEFNEIVNLASIFDVTSEIITKVKE |
| Ga0211542_10505991 | 3300020312 | Marine | MYKLIVLVAAVIIITTQWSAFTEAVDFVKMIEVTSEIITKVKE |
| Ga0211517_10541291 | 3300020319 | Marine | LSNRRWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0211626_10459042 | 3300020343 | Marine | MFKLIVLVAAIVVITTQWGAFTDIVDLAKVFEITGEIITKVKE |
| Ga0211677_100716355 | 3300020385 | Marine | LVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0211582_103820762 | 3300020386 | Marine | MYKLILLVAAVVIITTQWSAFTEAVDLVKMIEVTSEIITKVKE |
| Ga0211687_101601052 | 3300020396 | Marine | MFKIIMFVAAIVVITTQWDAFTEIVDLAKIIEVTHEVVTKVKE |
| Ga0211623_100581754 | 3300020399 | Marine | MFKIIILVAAIVVITTQWSEFNEIVNLASIFEVIGEIITKVKE |
| Ga0211636_102651581 | 3300020400 | Marine | MFKLIVLLAAIIVITTQWGAFTDIVDISKAIEVTSEIITKVKE |
| Ga0211575_103952802 | 3300020407 | Marine | MFKIIILVAAIIVITTQWSEFNEIVNLASIFEVTGEIITKVKE |
| Ga0211699_102416671 | 3300020410 | Marine | MYKLILLVAAIVIITTQWSAFTEAVDFVKMIEVTSEIITKVK |
| Ga0211587_101330963 | 3300020411 | Marine | NNKMFKLIVLLAAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE |
| Ga0211587_103253771 | 3300020411 | Marine | MYKLIVLVAAVIVITTQWSAFTEAVDLVKMIEVTSEII |
| Ga0211512_105065352 | 3300020419 | Marine | MYKLIILVAAIVVITTQWGAFTDIVDLTKVFEVTGEIITKVKE |
| Ga0211521_104267222 | 3300020428 | Marine | ILVAAIVIITTQWGAFTDIIDLTKVFEVTSEIITKVKE |
| Ga0211554_102358313 | 3300020431 | Marine | MFKLILWIAAIVIITTQWNAFTEIVDLAKIIEVTHEIITKVKE |
| Ga0211708_101523703 | 3300020436 | Marine | MGGTIMYKLIVLVAAVVIITTQWSAFTEAVDLVKMIEVTSEIITKVKE |
| Ga0211708_102350122 | 3300020436 | Marine | MYKLILLVAAVVIITTQWSAFTDVVDLAKIFEVTGEIITKVKE |
| Ga0211576_105057521 | 3300020438 | Marine | VAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0211564_1001450110 | 3300020445 | Marine | MFKLIVLLAAIIVITTQWGAFTDIVDISKALEVTGEIITKVKE |
| Ga0211641_102629861 | 3300020450 | Marine | MFKLIVLLAAIIVITTQWGAFTDIIDVSKALEVTSEIITK |
| Ga0211514_106560842 | 3300020459 | Marine | IVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0211694_100766284 | 3300020464 | Marine | IVLVAAVIIITTQWSAFTDVVDLAKVIEVTHEIITKVKE |
| Ga0211475_101210471 | 3300020468 | Marine | AAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE |
| Ga0211543_103841612 | 3300020470 | Marine | MYKLILLVAAIVIITTQWTAFTEAVDLVRMIEVTSEIITKVKE |
| Ga0211614_103949271 | 3300020471 | Marine | MYKLIVLVAAVIVITTQWSAFTEAVDLVKMIEVTSEIITKVKE |
| Ga0206126_100960321 | 3300020595 | Seawater | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSE |
| Ga0206682_102268932 | 3300021185 | Seawater | MFKIIVWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0206123_100877883 | 3300021365 | Seawater | MFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0213868_101481154 | 3300021389 | Seawater | MFKMIMLVAAIVVITTQWSEFNEIVNLASIFEVTGEIITKVKE |
| Ga0222716_105600052 | 3300021959 | Estuarine Water | MFKMIVLVAAIVVITTQWNDFNEIVNLTKIIEVTGEVITKVKE |
| Ga0224906_11385192 | 3300022074 | Seawater | LIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0224906_11763591 | 3300022074 | Seawater | VMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0212022_10278223 | 3300022164 | Aqueous | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTGEIITKVKE |
| Ga0255773_103811812 | 3300022925 | Salt Marsh | MFKLIVLLAAIIVITTQWGAFTDIVDVSKALEVTSE |
| Ga0228665_10688002 | 3300024235 | Seawater | MFKLIMLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| (restricted) Ga0233438_100698825 | 3300024255 | Seawater | MFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIIMKVKE |
| (restricted) Ga0233438_103798132 | 3300024255 | Seawater | RDALFKXKWCLGETVMFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209992_100069471 | 3300024344 | Deep Subsurface | NKMFKLIVLLAAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE |
| Ga0209992_100178528 | 3300024344 | Deep Subsurface | MYKLIILVAAIIVITTQWGTFTDIVDVSKALEVTSEIITKVKE |
| Ga0209992_1001850410 | 3300024344 | Deep Subsurface | MFKLIVLVAAVIIITTQWSAFTDVVDLAKVIEVTHEIITKVKE |
| Ga0209992_101009103 | 3300024344 | Deep Subsurface | MYKLIILVAAIVIITTQWGAFTDIIDLTKVFEVTSEIITKVKE |
| Ga0209992_101403971 | 3300024344 | Deep Subsurface | MYKLIVLVAAIVIITTQWSAFTDVVDLAKIFEVTGEIITKVKE |
| Ga0244775_104336084 | 3300024346 | Estuarine | MFKIIILVAAIIVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0244776_104248501 | 3300024348 | Estuarine | VMFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209535_11269521 | 3300025120 | Marine | GETVMFKIIMFVAAIVVITTQWDAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0209634_11207553 | 3300025138 | Marine | MFKIIMFVAAIVVITTQWDAFTEIVNLAKVIEVTHEIITKVKE |
| Ga0209634_13310592 | 3300025138 | Marine | MFKIIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEI |
| Ga0209094_10441033 | 3300025594 | Pelagic Marine | MFKLIVLVAAIVIITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209667_10956111 | 3300025707 | Marine | MFKLILWIAAIVIITTQWSEFNEIVNLASIFEVTGEIITKVKE |
| Ga0209307_11972791 | 3300025832 | Pelagic Marine | WCLGETVMFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0209603_12527093 | 3300025849 | Pelagic Marine | MFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTH |
| Ga0209534_102632551 | 3300025880 | Pelagic Marine | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIIT |
| Ga0209309_104895331 | 3300025881 | Pelagic Marine | FKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0208274_11369632 | 3300026188 | Marine | MFKLIVLVAAIVIITTQWGAFTDIVDLAKVFEVTGEIITKVKE |
| Ga0208127_101084410 | 3300026201 | Marine | MFKLIVLLAAIIVITTQWGAFTDIIDVSKALEVTGEIITKVKE |
| Ga0208954_10336332 | 3300027081 | Marine | NTWDALFNKRWCLGETVMFKLIILVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0208963_10405551 | 3300027170 | Marine | KIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0208970_10283103 | 3300027298 | Marine | VLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209384_10234923 | 3300027522 | Marine | MFKIIILVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0208133_10558031 | 3300027631 | Estuarine | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEI |
| Ga0209482_10189695 | 3300027668 | Marine | MFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209710_10751063 | 3300027687 | Marine | MFKIIILVAAIIVITTQWSAFTEIVDLAKVIEVTHEIIMKVKE |
| Ga0209710_12050172 | 3300027687 | Marine | MFKIIMFVAAIVVITTQWDAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0209710_12604242 | 3300027687 | Marine | MFKIIMLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209036_10517142 | 3300027702 | Marine | MFKLIVLLAAIIVITTQWGAFTDIVDVSKAIEVTSEIITKVKE |
| Ga0208304_103199711 | 3300027751 | Estuarine | MFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKV |
| Ga0209192_101393952 | 3300027752 | Marine | MFKIIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209359_102624071 | 3300027830 | Marine | DALFIRRWCLGETVMFKIIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0209503_100105994 | 3300027859 | Marine | MYKLIVLVAAVVIITTQWSAFTEAVDLVKMIEVTSEIITKVKE |
| Ga0257106_10813394 | 3300028194 | Marine | MFKIIMFVAAIVVITTQWNAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0257113_10309204 | 3300028488 | Marine | MYKLILLVACIVVITVHWTEFNDIVNLASIFEVTGEIITKVKE |
| Ga0183755_10034049 | 3300029448 | Marine | MYKLIILVAAIIVITTQWGAFTDIVDVSKALEVTSEIITKVKE |
| Ga0183755_10089957 | 3300029448 | Marine | MFKLIVLVAAIVVITTQWGAFTEIVDLAKVLEVTGEIITKVKE |
| Ga0183755_10645643 | 3300029448 | Marine | KMFKLIVLVAAIVVITTQWGAFTDIVDLAKVFEITGEIITKVKE |
| Ga0307488_100616332 | 3300031519 | Sackhole Brine | MFKIIMLVAAIVVITTQWSEFNEIVNLASIFEVTGEIITKVKE |
| Ga0307488_100815504 | 3300031519 | Sackhole Brine | MFKIIILVAAIVVITTQWSAFTEIVDLAKIIEVTHEVITKVKE |
| Ga0307488_101914673 | 3300031519 | Sackhole Brine | MFKLIVLVAAIVIITTQWSEFNEIVNLASIFEITSEIITKVKE |
| Ga0307488_103267953 | 3300031519 | Sackhole Brine | MFKIIMFVAAIVVITTQWSAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0308007_102918272 | 3300031599 | Marine | MFKIILLVAAIVVITTQWSEFNEIVNLASIFEVTKMMDKSI |
| Ga0315332_108662231 | 3300031773 | Seawater | VAAIVVITTQWNDFNEIVNLTKIIEVTGEVITKVKE |
| Ga0310344_114141322 | 3300032006 | Seawater | MFKLIVWIAAIVIITTQWNAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0315330_103846431 | 3300032047 | Seawater | TWDALFNGRWCLGETVMFKLILWIAAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE |
| Ga0315330_106245962 | 3300032047 | Seawater | TWDALSNRRWCLGETVMFKLIVLVAAIVVITTQWSEFNEIVNLASIFEVTSEIITKVKE |
| Ga0315315_108269641 | 3300032073 | Seawater | AAIVIITTQWSAFTEIVDLAKVIEVTHEIITKVKE |
| ⦗Top⦘ |