NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019500

Metagenome / Metatranscriptome Family F019500

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019500
Family Type Metagenome / Metatranscriptome
Number of Sequences 229
Average Sequence Length 50 residues
Representative Sequence IHWNVNASPVNYETATFTVNGVTAQQQLGAYEPLNTTNEFVVKLGFRF
Number of Associated Samples 164
Number of Associated Scaffolds 229

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.18 %
% of genes near scaffold ends (potentially truncated) 95.63 %
% of genes from short scaffolds (< 2000 bps) 95.20 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.476 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere
(8.734 % of family members)
Environment Ontology (ENVO) Unclassified
(43.231 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(64.629 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 25.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 229 Family Scaffolds
PF00069Pkinase 3.49
PF00400WD40 3.06
PF03641Lysine_decarbox 2.18
PF01364Peptidase_C25 1.75
PF04972BON 1.75
PF00190Cupin_1 1.31
PF12680SnoaL_2 1.31
PF07995GSDH 1.31
PF07366SnoaL 1.31
PF02867Ribonuc_red_lgC 1.31
PF11746DUF3303 0.87
PF03449GreA_GreB_N 0.87
PF07228SpoIIE 0.87
PF12796Ank_2 0.87
PF13302Acetyltransf_3 0.87
PF13360PQQ_2 0.87
PF08450SGL 0.87
PF14031D-ser_dehydrat 0.87
PF02518HATPase_c 0.87
PF02687FtsX 0.87
PF12704MacB_PCD 0.87
PF07690MFS_1 0.87
PF10009DUF2252 0.87
PF13442Cytochrome_CBB3 0.87
PF12867DinB_2 0.87
PF13924Lipocalin_5 0.87
PF00106adh_short 0.44
PF00912Transgly 0.44
PF00196GerE 0.44
PF04199Cyclase 0.44
PF13847Methyltransf_31 0.44
PF03795YCII 0.44
PF09903DUF2130 0.44
PF00581Rhodanese 0.44
PF08281Sigma70_r4_2 0.44
PF01979Amidohydro_1 0.44
PF09278MerR-DNA-bind 0.44
PF00282Pyridoxal_deC 0.44
PF00571CBS 0.44
PF00903Glyoxalase 0.44
PF05598DUF772 0.44
PF01713Smr 0.44
PF05721PhyH 0.44
PF01738DLH 0.44
PF01326PPDK_N 0.44
PF13620CarboxypepD_reg 0.44
PF00135COesterase 0.44
PF13594Obsolete Pfam Family 0.44
PF04264YceI 0.44
PF08327AHSA1 0.44
PF07929PRiA4_ORF3 0.44
PF01590GAF 0.44
PF01312Bac_export_2 0.44
PF13460NAD_binding_10 0.44
PF02776TPP_enzyme_N 0.44
PF03551PadR 0.44
PF07676PD40 0.44
PF12893Lumazine_bd_2 0.44
PF11218DUF3011 0.44
PF12697Abhydrolase_6 0.44
PF00326Peptidase_S9 0.44
PF03466LysR_substrate 0.44
PF06114Peptidase_M78 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 229 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 13.97
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 2.18
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 1.31
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 1.31
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.87
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.87
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.87
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.44
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.44
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.44
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.44
COG0789DNA-binding transcriptional regulator, MerR familyTranscription [K] 0.44
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.44
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.44
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.44
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.44
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.44
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.44
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.44
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.44
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.48 %
UnclassifiedrootN/A20.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2038011000|ACOD_FV90NF401C6Z53All Organisms → cellular organisms → Bacteria500Open in IMG/M
2162886011|MRS1b_contig_5857007All Organisms → cellular organisms → Bacteria → Acidobacteria1139Open in IMG/M
2162886012|MBSR1b_contig_7563710All Organisms → cellular organisms → Bacteria → Acidobacteria1527Open in IMG/M
2170459003|FZN2CUW02HE1L3All Organisms → cellular organisms → Bacteria521Open in IMG/M
2170459014|G1P06HT01EAR8QAll Organisms → cellular organisms → Bacteria632Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11048997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1095Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101269921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300000890|JGI11643J12802_10029548Not Available671Open in IMG/M
3300000955|JGI1027J12803_101263194Not Available539Open in IMG/M
3300000955|JGI1027J12803_107297162Not Available701Open in IMG/M
3300004114|Ga0062593_100510420All Organisms → cellular organisms → Bacteria → Proteobacteria1117Open in IMG/M
3300004153|Ga0063455_100977922All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → unclassified Pseudomonadaceae → Pseudomonadaceae bacterium610Open in IMG/M
3300004463|Ga0063356_100379323All Organisms → cellular organisms → Bacteria1805Open in IMG/M
3300004463|Ga0063356_102920760All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis736Open in IMG/M
3300004479|Ga0062595_101365656Not Available643Open in IMG/M
3300004643|Ga0062591_100326426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1225Open in IMG/M
3300004643|Ga0062591_100691449All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005172|Ga0066683_10909431Not Available504Open in IMG/M
3300005289|Ga0065704_10705812Not Available559Open in IMG/M
3300005293|Ga0065715_10359492All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005294|Ga0065705_11107075All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005328|Ga0070676_10224022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1243Open in IMG/M
3300005328|Ga0070676_11388229Not Available538Open in IMG/M
3300005329|Ga0070683_100564316All Organisms → cellular organisms → Bacteria → Acidobacteria1089Open in IMG/M
3300005333|Ga0070677_10289756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium828Open in IMG/M
3300005333|Ga0070677_10508988Not Available654Open in IMG/M
3300005334|Ga0068869_100205118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Sulfobacillus1556Open in IMG/M
3300005334|Ga0068869_101248598Not Available654Open in IMG/M
3300005334|Ga0068869_101937243Not Available528Open in IMG/M
3300005340|Ga0070689_100614823All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300005341|Ga0070691_10656641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300005341|Ga0070691_10680432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300005347|Ga0070668_100318219All Organisms → cellular organisms → Bacteria → Acidobacteria1309Open in IMG/M
3300005354|Ga0070675_100360263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1291Open in IMG/M
3300005354|Ga0070675_102227042All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005355|Ga0070671_100258446Not Available1480Open in IMG/M
3300005356|Ga0070674_100844084All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300005356|Ga0070674_101710051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300005356|Ga0070674_101823109Not Available552Open in IMG/M
3300005364|Ga0070673_101367134All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005365|Ga0070688_100281818All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300005365|Ga0070688_101518399All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300005367|Ga0070667_101278975All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005367|Ga0070667_101442203All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005438|Ga0070701_10805013All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005438|Ga0070701_10910360All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005441|Ga0070700_100054453All Organisms → cellular organisms → Bacteria2500Open in IMG/M
3300005444|Ga0070694_101798021All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005456|Ga0070678_100259344All Organisms → cellular organisms → Bacteria1461Open in IMG/M
3300005456|Ga0070678_100884073All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300005456|Ga0070678_101378567All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005456|Ga0070678_101901452All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300005457|Ga0070662_100799920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300005466|Ga0070685_10445079All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300005466|Ga0070685_11257006All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300005526|Ga0073909_10518449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300005536|Ga0070697_100096574All Organisms → cellular organisms → Bacteria2451Open in IMG/M
3300005543|Ga0070672_100878480Not Available791Open in IMG/M
3300005546|Ga0070696_100285640Not Available1259Open in IMG/M
3300005546|Ga0070696_101432000All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → unclassified Caldithrix → Caldithrix sp.590Open in IMG/M
3300005548|Ga0070665_100665698All Organisms → cellular organisms → Bacteria → Acidobacteria1054Open in IMG/M
3300005549|Ga0070704_101516462All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005564|Ga0070664_100822177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345869Open in IMG/M
3300005564|Ga0070664_101692076All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300005615|Ga0070702_101341402All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005617|Ga0068859_100795123Not Available1034Open in IMG/M
3300005618|Ga0068864_100634079All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300005618|Ga0068864_101045069All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300005618|Ga0068864_101907945All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005713|Ga0066905_100446831Not Available1062Open in IMG/M
3300005713|Ga0066905_101681141All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005764|Ga0066903_101445157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_211295Open in IMG/M
3300005764|Ga0066903_105327601Not Available680Open in IMG/M
3300005764|Ga0066903_108485212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae524Open in IMG/M
3300005841|Ga0068863_100050459All Organisms → cellular organisms → Bacteria → Proteobacteria3943Open in IMG/M
3300006046|Ga0066652_100240766All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1579Open in IMG/M
3300006049|Ga0075417_10246987All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300006196|Ga0075422_10127254All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300006237|Ga0097621_100525075Not Available1075Open in IMG/M
3300006358|Ga0068871_100922960All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300006358|Ga0068871_101798311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300006580|Ga0074049_12773749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14522Open in IMG/M
3300006852|Ga0075433_11119799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300006854|Ga0075425_101984331All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300006880|Ga0075429_100790048All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300006880|Ga0075429_101530580All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300006914|Ga0075436_100266732All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300009098|Ga0105245_10764831Not Available1002Open in IMG/M
3300009148|Ga0105243_12018842All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300009156|Ga0111538_10242830All Organisms → cellular organisms → Bacteria2281Open in IMG/M
3300009162|Ga0075423_10129985All Organisms → cellular organisms → Bacteria2643Open in IMG/M
3300009162|Ga0075423_12895034All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300009177|Ga0105248_11107661All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300009177|Ga0105248_12159276Not Available633Open in IMG/M
3300009551|Ga0105238_10085505All Organisms → cellular organisms → Bacteria3142Open in IMG/M
3300010043|Ga0126380_11456860All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300010045|Ga0126311_11905684Not Available505Open in IMG/M
3300010329|Ga0134111_10147272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium930Open in IMG/M
3300010359|Ga0126376_13056760Not Available517Open in IMG/M
3300010366|Ga0126379_12912776All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300010366|Ga0126379_13527382All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300010371|Ga0134125_12428633All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300010396|Ga0134126_11607522All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300010397|Ga0134124_11532266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300010398|Ga0126383_10901221All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300010399|Ga0134127_10242918All Organisms → cellular organisms → Bacteria1701Open in IMG/M
3300010403|Ga0134123_12667555All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300011119|Ga0105246_11201367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium698Open in IMG/M
3300011119|Ga0105246_11433559All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300011269|Ga0137392_10875448All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300011437|Ga0137429_1169460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300012021|Ga0120192_10157517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi500Open in IMG/M
3300012212|Ga0150985_105712220All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300012212|Ga0150985_106908859All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300012212|Ga0150985_114914461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300012212|Ga0150985_118710050All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella810Open in IMG/M
3300012212|Ga0150985_119359546All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300012469|Ga0150984_109309309All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300012469|Ga0150984_120168447All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300012478|Ga0157328_1006663All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012895|Ga0157309_10177849All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300012899|Ga0157299_10267258Not Available550Open in IMG/M
3300012904|Ga0157282_10021031Not Available1345Open in IMG/M
3300012908|Ga0157286_10104768All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300012908|Ga0157286_10392469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300012951|Ga0164300_10900239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300012958|Ga0164299_10410762All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis873Open in IMG/M
3300012961|Ga0164302_10094653All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300012961|Ga0164302_10979812All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300012971|Ga0126369_13621660All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300012986|Ga0164304_10134543All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300012989|Ga0164305_11920966All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300013297|Ga0157378_10272521All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300013306|Ga0163162_10853115All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis1026Open in IMG/M
3300013306|Ga0163162_12512406All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300013308|Ga0157375_10368516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1603Open in IMG/M
3300013308|Ga0157375_13152542All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300014325|Ga0163163_10050561All Organisms → cellular organisms → Bacteria4093Open in IMG/M
3300014745|Ga0157377_11424084All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300014878|Ga0180065_1081781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300014969|Ga0157376_11801631All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300014969|Ga0157376_12898515All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300015258|Ga0180093_1012928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1640Open in IMG/M
3300015371|Ga0132258_10427959All Organisms → cellular organisms → Bacteria3295Open in IMG/M
3300015371|Ga0132258_10444789All Organisms → cellular organisms → Bacteria → Acidobacteria3230Open in IMG/M
3300015372|Ga0132256_101387089All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300015372|Ga0132256_101537238Not Available776Open in IMG/M
3300015373|Ga0132257_100228223All Organisms → cellular organisms → Bacteria2216Open in IMG/M
3300015373|Ga0132257_100336729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1821Open in IMG/M
3300015373|Ga0132257_102612318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium657Open in IMG/M
3300015374|Ga0132255_101162941All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300015374|Ga0132255_102250618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300015374|Ga0132255_103246981All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300015374|Ga0132255_103416796Not Available676Open in IMG/M
3300015374|Ga0132255_104326346Not Available602Open in IMG/M
3300015374|Ga0132255_104957407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria564Open in IMG/M
3300016387|Ga0182040_11490740Not Available574Open in IMG/M
3300017792|Ga0163161_11528205All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300017997|Ga0184610_1190738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300018029|Ga0187787_10420144Not Available532Open in IMG/M
3300018058|Ga0187766_10393474All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300018064|Ga0187773_11068104All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300018089|Ga0187774_11000905All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300019257|Ga0180115_1047551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300019361|Ga0173482_10600272All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300021082|Ga0210380_10252652All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300021445|Ga0182009_10070846All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300021445|Ga0182009_10520128All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300024055|Ga0247794_10294537All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300025885|Ga0207653_10131748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium908Open in IMG/M
3300025893|Ga0207682_10332444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium714Open in IMG/M
3300025893|Ga0207682_10496056Not Available578Open in IMG/M
3300025903|Ga0207680_11301768All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium517Open in IMG/M
3300025907|Ga0207645_10752141Not Available663Open in IMG/M
3300025917|Ga0207660_11519656All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300025918|Ga0207662_10218566All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300025920|Ga0207649_10149784Not Available1606Open in IMG/M
3300025920|Ga0207649_10784899All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300025923|Ga0207681_10286258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1299Open in IMG/M
3300025926|Ga0207659_11217773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300025926|Ga0207659_11823582All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300025927|Ga0207687_11427120All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300025935|Ga0207709_11353555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300025936|Ga0207670_10951093Not Available721Open in IMG/M
3300025936|Ga0207670_11943105Not Available500Open in IMG/M
3300025937|Ga0207669_10336243All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300025937|Ga0207669_10560840All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300025937|Ga0207669_10774125All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300025938|Ga0207704_11782249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300025940|Ga0207691_10596426All Organisms → cellular organisms → Bacteria → Acidobacteria935Open in IMG/M
3300025940|Ga0207691_11185905Not Available633Open in IMG/M
3300025942|Ga0207689_10222340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Sulfobacillus1560Open in IMG/M
3300025942|Ga0207689_10769826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium812Open in IMG/M
3300025945|Ga0207679_12167882All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300025960|Ga0207651_11171694Not Available689Open in IMG/M
3300025972|Ga0207668_10876849All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300025981|Ga0207640_10750250Not Available841Open in IMG/M
3300025981|Ga0207640_12064091All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300025985|Ga0210117_1074408All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium592Open in IMG/M
3300025986|Ga0207658_10956096Not Available781Open in IMG/M
3300026088|Ga0207641_10361674All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300026095|Ga0207676_11118059Not Available779Open in IMG/M
3300026095|Ga0207676_11459378All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300026121|Ga0207683_11001703All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300026121|Ga0207683_11066408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300026121|Ga0207683_11381540All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300027821|Ga0209811_10204359All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300028379|Ga0268266_10881990All Organisms → cellular organisms → Bacteria → Acidobacteria865Open in IMG/M
3300028379|Ga0268266_11030567Not Available796Open in IMG/M
3300028379|Ga0268266_11192330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300028592|Ga0247822_11438915Not Available581Open in IMG/M
3300028608|Ga0247819_10323948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola870Open in IMG/M
3300028792|Ga0307504_10199640All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300031170|Ga0307498_10271848All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.623Open in IMG/M
3300031231|Ga0170824_117595165All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031716|Ga0310813_10890988Not Available806Open in IMG/M
3300031720|Ga0307469_12453135All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031781|Ga0318547_11006744All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300031910|Ga0306923_12397703All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031913|Ga0310891_10393346Not Available504Open in IMG/M
3300031939|Ga0308174_10453974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM12531041Open in IMG/M
3300032013|Ga0310906_10404121All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300032017|Ga0310899_10178683Not Available925Open in IMG/M
3300032075|Ga0310890_11333794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300032144|Ga0315910_11551730All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300032180|Ga0307471_104353303Not Available500Open in IMG/M
3300032205|Ga0307472_101523964Not Available654Open in IMG/M
3300033433|Ga0326726_10333141Not Available1429Open in IMG/M
3300034148|Ga0364927_0005197All Organisms → cellular organisms → Bacteria2537Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere8.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.37%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere3.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.18%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.75%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.31%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.31%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.87%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.87%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.87%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.44%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.44%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.44%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.44%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.44%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.44%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.44%
Fungus GardenHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.44%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2038011000Fungus garden microbial communities from Atta colombica in Panama - from dump topHost-AssociatedOpen in IMG/M
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025985Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ACODT_104003102038011000Fungus GardenEPEYIHWNVNASPVNFETATFTVNSITVQEQLGAYEPLNRTNEFTVKFGVHF
MRS1b_0819.000013102162886011Miscanthus RhizosphereRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF
MBSR1b_0915.000013902162886012Miscanthus RhizospherePVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF
E4A_053396602170459003Grass SoilVHWNVNASPLNYETATFTVNGVTAAEQLGAYEPVNNTNEFGVKLGFHF
2PV_028642202170459014Switchgrass, Maize And Mischanthus LitterVNNETVTFTVNRITARQQLGFYEPFNTTNEFGVKLGFKF
ICChiseqgaiiFebDRAFT_1104899713300000363SoilEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
INPhiseqgaiiFebDRAFT_10126992113300000364SoilPVNSETATFTVNNVTARQQVGFYEPLNTTNEFLVKLGXHF*
JGI11643J12802_1002954833300000890SoilRQWSVEPEYIHWNVSASDVNVETATFTVNGITARQQLGAYEPVNHTNEFNVKLGFRF*
JGI1027J12803_10126319423300000955SoilNISSSPVNYEIATFTVNSVTVREQLGAYEPFNVTNEFGVRLGFHF*
JGI1027J12803_10729716213300000955SoilSASPVNYETATFTVNGVTVQQQLGAYEPLNSTNEFVVKVGFHF*
Ga0062593_10051042013300004114SoilVNYETATFTVNGITAKQDLGAYEPDNSTNEFGVRFGFRIP*
Ga0063455_10097792213300004153SoilLNRHWSVEPSYIHWNVSASAVRESTVTFTVNGIRADQQLGAYEPDNATDEWSVNLGFHF*
Ga0063356_10037932343300004463Arabidopsis Thaliana RhizosphereIHWKVSDSPVNYETATFTVNDITAREQRGFYEPMNTTNEFAVKLGFHF*
Ga0063356_10292076013300004463Arabidopsis Thaliana RhizosphereWSVEPGYIHWNVSASNVDYSTATFTVNGITARQQLGAYEPDNATNEYFVNLGFHF*
Ga0062595_10136565613300004479SoilPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
Ga0062591_10032642633300004643SoilHWKVSDSPVNYETATFTVNDITAREQRGFYEPMNTTNEFAVKLGFHF*
Ga0062591_10069144923300004643SoilASPVNYETAAYTVNRITAQESLGAYEPLNRTNEFTVKLGFRF*
Ga0066683_1090943113300005172SoilYQATRHWSLEPSYVHWNVSASPVNYSTAAFTVNNVTAQQRLGFYEPLNTTNELGVKLGFHF*
Ga0065704_1070581213300005289Switchgrass RhizosphereAKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
Ga0065715_1035949213300005293Miscanthus RhizosphereWSVAPEYIHWNVTASPVNYETAAYTVNRITAQESLGAYEPLNRTNEFTVKLGFRF*
Ga0065705_1110707513300005294Switchgrass RhizosphereKYQMTRQWSVEPEYIHWNVSASPVNYEAATFTVNGITVQEQVGAYEPLNRTNEFVVKLGFRFARRQ*
Ga0070676_1022402213300005328Miscanthus RhizospherePEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
Ga0070676_1138822913300005328Miscanthus RhizospherePEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF*
Ga0070683_10056431623300005329Corn RhizospherePEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF*
Ga0070677_1028975613300005333Miscanthus RhizosphereGWALRAGAKYQMTRQWSVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF*
Ga0070677_1050898823300005333Miscanthus RhizosphereSGWALRARAKYQITRKWSVEPEYVHWSVGASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFVVKLGFHF*
Ga0068869_10020511823300005334Miscanthus RhizosphereYSVTRHWSVEPSYIHWSVSSSPVNFEIAEYTVNNITADEQLGAYEPVNHTNEFFVKLGFHF*
Ga0068869_10124859823300005334Miscanthus RhizosphereVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF*
Ga0068869_10193724323300005334Miscanthus RhizosphereSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF*
Ga0070689_10061482323300005340Switchgrass RhizosphereTTYVRWSVDASPVSVETVSFTVNGITAQEQFGAVEPLNSTNEFAVKLGFHF*
Ga0070691_1065664123300005341Corn, Switchgrass And Miscanthus RhizosphereVSASPVSDETATFTVNGITAREQLGAFEPLNTTREFGIKLGFHVG*
Ga0070691_1068043213300005341Corn, Switchgrass And Miscanthus RhizosphereGYIHWKVSASPVNYETATFTVNSITVRQQFGAYEPLNTTDEFVLKLGFRF*
Ga0070668_10031821913300005347Switchgrass RhizosphereWALRARAKYQMTSRWSVEPEYIHWNVSDSPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF*
Ga0070675_10036026323300005354Miscanthus RhizosphereYIHWNVSSSPVNYETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF*
Ga0070675_10222704223300005354Miscanthus RhizosphereVEPAYIHWNVNASPVNYETATFTVNGVTAQEQLGAYEPVNRTNEFVVKLGFHF*
Ga0070671_10025844623300005355Switchgrass RhizosphereVSASPVNYETATFTVNNITAQEQLGAYEPDNNTNEFGVRFGFRF*
Ga0070674_10084408413300005356Miscanthus RhizosphereLRASAKYQVTRRWSVEPAYIYWHVSASTVNYGTATFTVNNVTVVQQVGAYEPVNVTHEFVVRLGFHL*
Ga0070674_10171005123300005356Miscanthus RhizosphereVELQYIHWNVNASAVNYETATFTVNGVTARQQLGAYEPLNRTNELVAKVGFRL*
Ga0070674_10182310913300005356Miscanthus RhizospherePEYIHWNVSSSPVNYETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF*
Ga0070673_10136713413300005364Switchgrass RhizosphereARAKYQMTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF*
Ga0070688_10028181813300005365Switchgrass RhizospherePTYVRWSVDASPVSVETVSFTVNGITAQEQFGAVEPLNSTNEFAVKLGFHF*
Ga0070688_10151839913300005365Switchgrass RhizosphereQWWVEPEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF*
Ga0070667_10127897523300005367Switchgrass RhizosphereVSASPVNYETATFTVNHVTVQEQFGAYEPANVTHEFVVKLGLHL*
Ga0070667_10144220323300005367Switchgrass RhizosphereRASAKYQVTRRWSVEPAYIYWHVSASTVNYGTATFTVNNVTVVQQVGAYEPVNVTHEFVVRLGFHL*
Ga0070701_1080501313300005438Corn, Switchgrass And Miscanthus RhizosphereVTRHWSVEPSFIHWSIDASPVSDETATFTVNGITVDQQLGAYEPVNTTNEFAVKLGFHF*
Ga0070701_1091036023300005438Corn, Switchgrass And Miscanthus RhizosphereKYQMTRQWSVEPEYIHWNVSASNVNEETATFTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF*
Ga0070700_10005445313300005441Corn, Switchgrass And Miscanthus RhizosphereSKRWSVELQYIHWNVNASAVNYETATFTVNGVTARQQLGAYEPLNRTNELVAKVGFRL*
Ga0070694_10179802113300005444Corn, Switchgrass And Miscanthus RhizosphereHWNVSASPVNYETATFTVNRITAQEQFGAYEPLNTTNEFTVRLGLHF*
Ga0070678_10025934433300005456Miscanthus RhizosphereVEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF*
Ga0070678_10088407323300005456Miscanthus RhizosphereASNVSETTATFTVNGIPAREQLGAYEPDNDTNEFFLNLGFHF*
Ga0070678_10137856723300005456Miscanthus RhizosphereSPVSPITATFTVNGITASEQLGAVEPVNFTNEFGVKFGFRFK*
Ga0070678_10190145213300005456Miscanthus RhizosphereWAVRAGGTYQVSRRWSIEPSFIHWDVDDSPVRYMTATFSVNGVTARQELGAVEPDNVTNEVSVRLGFHF*
Ga0070662_10079992023300005457Corn RhizosphereDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF*
Ga0070685_1044507913300005466Switchgrass RhizosphereMTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF*
Ga0070685_1125700613300005466Switchgrass RhizosphereKYQMTRQWSVEPQYIHWNVSDSPVSYETATYTVNGITAQEQLGAYEPLNRTNEFVVKIGLRF*
Ga0073909_1051844923300005526Surface SoilYWRVRASPVSYETATFTVNHITASEQLGAYEPLNVTREFGVKLGFHF*
Ga0070697_10009657413300005536Corn, Switchgrass And Miscanthus RhizosphereASPVSYETATYTVNRITASEQLGAYEPLNVTREFGVKLGFHF*
Ga0070672_10087848023300005543Miscanthus RhizospherePVSHETATFTVNSVTVRQQFGAYEPLNRTNEFVVKLGFRF*
Ga0070696_10028564033300005546Corn, Switchgrass And Miscanthus RhizosphereASPVNYETATFTVRGVTAQEQLGAYEPVNRTNEFVVKLGFRF*
Ga0070696_10143200023300005546Corn, Switchgrass And Miscanthus RhizospherePYYVQWRVSASPVSYETATYTVNRITASEQLGAYEPLNVTREFGVKLGFHF*
Ga0070665_10066569823300005548Switchgrass RhizosphereDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLIRVGFRF*
Ga0070704_10151646213300005549Corn, Switchgrass And Miscanthus RhizosphereKYQMTRQWSVEPEYIHWNVSASNVNEETATVTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF*
Ga0070664_10082217713300005564Corn RhizosphereYETLTFTVNNITAREQRGAYEPDNNTHEFGVKVGLHF*
Ga0070664_10169207623300005564Corn RhizosphereTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF*
Ga0070702_10134140213300005615Corn, Switchgrass And Miscanthus RhizosphereNVNEETATFTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF*
Ga0068859_10079512313300005617Switchgrass RhizospherePVNYQTATFTVNRVTAHQQLGAYEPWNATNEFGVRLGLHF*
Ga0068864_10063407923300005618Switchgrass RhizosphereATFTVNSVRAKEQLGAYEPLNMTNEFGVKLGLHF*
Ga0068864_10104506913300005618Switchgrass RhizosphereKYQMTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF*
Ga0068864_10190794523300005618Switchgrass RhizosphereETATFTVNNATAQEQLGAYEPVNLTSEFGVRLGFHF*
Ga0066905_10044683133300005713Tropical Forest SoilETATFTVNGITVQQQLGFYEPLNRTNEFVVRIGFRFSRP*
Ga0066905_10168114123300005713Tropical Forest SoilPYYLHWHVSDSPVSYETVSFTVDRITAEQQLGAYEPLNVTREFGVKLGFHF*
Ga0066903_10144515713300005764Tropical Forest SoilYEVATFTVNNVTAQEQLGAYEPNNSTSEFGVRLGFHF*
Ga0066903_10532760113300005764Tropical Forest SoilSLEPSYIYWHVGASAVHEETATFTVNGVTAHEALGAFEPDNVTHEFDVKLGFTF*
Ga0066903_10848521223300005764Tropical Forest SoilWSVEPEYIHWNVSASPVSYGTVAFTVNGITAQEQLGAYEPFNRTEEFVVKIGVRF*
Ga0068863_10005045973300005841Switchgrass RhizosphereSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
Ga0066652_10024076633300006046SoilHSGWAVRASAKYQLTRRWSVEPEYIHWNVSDSPVNYQTATFTVNGITVEEQLGAYEPLNHTNEFVVNLGFRF*
Ga0075417_1024698713300006049Populus RhizosphereYPLTRHWSVEPSYIHWSVSASPVNFESVAFTVNNITAEEDLGAYEPVNHTNEFFVRLGFHF*
Ga0075422_1012725423300006196Populus RhizosphereEPEYIHWNVSASPVNFETATFTVNGISVRQQLGFYEPLNTTNEFVMKLGFRF*
Ga0097621_10052507543300006237Miscanthus RhizosphereARAKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
Ga0068871_10092296013300006358Miscanthus RhizosphereVNYETATFTVNDVTAQEQLGAYEPLNVTSEFGVRLGFHF*
Ga0068871_10179831123300006358Miscanthus RhizosphereTVNDSPVNDETVTFTVHNVTADEQLGFYEPHNVTNEFGVKLGVHFK*
Ga0074049_1277374923300006580SoilTATFTVNNATALEQLGAYEPVNVTSEFGVRLAFHF*
Ga0075433_1111979913300006852Populus RhizospherePSYIHWSIDASPVSDETATFTVNGITVDQQLGAYEPVNTTNEFAVKLGFHF*
Ga0075425_10198433123300006854Populus RhizosphereVNYETASFTVNRITVQEQLGAYEPLNRTNEFVVKLGFRFQAFR*
Ga0075429_10079004823300006880Populus RhizosphereVNFETVAFTVNNVTAQEQWGAYEPLNTTNEFVVKLGFHF*
Ga0075429_10153058013300006880Populus RhizosphereIHWNVNASPVNYETATFTVNGVTAQQQLGAYEPLNTTNEFVVKLGFRF*
Ga0075436_10026673213300006914Populus RhizosphereVRWHVSSSPVNYETATFTVDSVTAQEQLGAYEPVNVTSEFGVRLGFH
Ga0105245_1076483113300009098Miscanthus RhizosphereYFVHWTVSASPVNYETATFTVNNITAQEQLGAYEPDNNTNEFGVRFGFRF*
Ga0105243_1201884223300009148Miscanthus RhizosphereASPVNYETATFTVNGITARQQLGAYEPLNRTNEFVGRLGFRF*
Ga0111538_1024283013300009156Populus RhizosphereIDSPVNYETATFTVHGITARQQVGAYEPLNKTDEFVVKLGVRF*
Ga0075423_1012998513300009162Populus RhizosphereVHWNVSSSPVNYETATFTVNNVTALEQLGAYEPFNSTNEFGVRLGLHF*
Ga0075423_1289503413300009162Populus RhizosphereSAKYQVARNWSVEPAYIHWNVNASPVNYETATFTVNGVTAQEQLGAYEPVNRTNEFVVKLGFHF*
Ga0105248_1110766113300009177Switchgrass RhizosphereQETATFTVNNVRAKEQLGAYEPLNMTNEFGVKLGLHF*
Ga0105248_1215927613300009177Switchgrass RhizosphereGAKYQMTRHWSVAPEYIHWNVSASPVNYETATFTVKSITVRQQLGAYEPLNRTNEFVVRLGFRF*
Ga0105238_1008550513300009551Corn RhizosphereQLTRHWSVAPEYIHWNVSSSPVNYETATFTVNNITVDQQLGAYEPLNTTNELGVKLGFRF
Ga0126380_1145686023300010043Tropical Forest SoilRASAKYQITRLWWLEPEYIHWNVTASPVNYETATFTVNRITAHQQLGFYEPLNTTNEFVVKLGFRF*
Ga0126311_1190568423300010045Serpentine SoilMSRRWSVEGSFIHWDVGASPVRELTATFTVNGITAQQQLGALEPDNTTNEVSMGLGFHF*
Ga0134111_1014727243300010329Grasslands SoilEPYYLHWHVSASPVSDETATFTVNGITAREQLGAYEPVNFTREFGVQLGFHF*
Ga0126376_1305676013300010359Tropical Forest SoilNASAVNTGTVTFTVNNVTARELLGAYEPFNVTNEFGVKLGLHF*
Ga0126379_1291277613300010366Tropical Forest SoilWSVEPYYVHWTVSASSVNYETATFTVNGVTAQEQLGAYEPLNTTNEFGVKLGFHF*
Ga0126379_1352738223300010366Tropical Forest SoilELSIEPEYIHWNVSASPVNDETATFTVGGITTVQQLGAYEPLNRTNEFTVKLGVRF*
Ga0134125_1242863323300010371Terrestrial SoilRARGKYQMTRQWSVEPEYIHWNVSASNVNEETATVTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF*
Ga0134126_1160752223300010396Terrestrial SoilEMVTFTVNGVSASEQLGAYEPVNHTSEFGVSLGFHF*
Ga0134124_1153226613300010397Terrestrial SoilFIHWSIDASPVSDETATFTVNGITVDQQLGAYEPVNTTNEFAVKLGFHF*
Ga0126383_1090122113300010398Tropical Forest SoilSAKYQVTRNWSVEPYYVHWTVSASSVNYETATFTVNGVTAQEQLGAYEPLNTTNEFGVKLGFHF*
Ga0134127_1024291813300010399Terrestrial SoilPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF*
Ga0134123_1266755523300010403Terrestrial SoilVSPITATFTVNGITASEQLGAVEPVNFTNEFGVKFGFRFK*
Ga0105246_1120136723300011119Miscanthus RhizosphereMTRQWSVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF*
Ga0105246_1143355913300011119Miscanthus RhizosphereRRFWVEPAYIHWKVSASPVAYETATFTVNGVTAQEQFGAVEPLNTTNEFVVKFGFRF*
Ga0137392_1087544823300011269Vadose Zone SoilVNDETVAFTVNNVTAHEQLGFYEPWNVTNEFGVKLGLHFK*
Ga0137429_116946013300011437SoilHWNVSASPVNYETSTFTVNGDTVRQQLGAYEPLNTTNEFVVKIGLRF*
Ga0120192_1015751723300012021TerrestrialATFTVNGISARQQVGAYEPENVTHEWFVNLGFHF*
Ga0150985_10571222013300012212Avena Fatua RhizosphereATFTVNRVTAQQQLGYYEPLNATNEFVVKLGFHF*
Ga0150985_10690885923300012212Avena Fatua RhizosphereVGRQVFPVESETVTFTVSDVSAREQLGFYEPFIVTSEIGVRLGFHF*
Ga0150985_11491446133300012212Avena Fatua RhizosphereVSDSPVNYETVTFTVNRITAQEQLGYYEPFNVTNEFGLKLGFHF*
Ga0150985_11871005013300012212Avena Fatua RhizosphereYETATFTVNGITVEEQLGAYEPLNKTDEFVLKLGVRF*
Ga0150985_11935954623300012212Avena Fatua RhizosphereVEPAYIHWNVSASPVSFETATFTVNRITAQQQFGAIEPLNSTNEFAVKLGFRF*
Ga0150984_10930930933300012469Avena Fatua RhizosphereWGAEYTHGNVSASPVNDETATFTVNHITVDQQLGAYEPLNTTNELVVKLGFRF*
Ga0150984_12016844723300012469Avena Fatua RhizosphereYQFGRQWWVEPEYTHWNVDASPVNYETATFTVNNITVQQQLGAYEPLNRTDEFLMRVGFRF*
Ga0157328_100666313300012478Arabidopsis RhizosphereTATLTVNNATAQEQLGAYEPVNVTSEFGVRLGFHF*
Ga0157309_1017784913300012895SoilIATFTVNDVTVQQQFGAYEPLNMTHEFVVRLGFHL*
Ga0157299_1026725823300012899SoilVNFETATLTVNGITARQRLGAYEPVNHTNEFNVKLGFRF*
Ga0157282_1002103113300012904SoilMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
Ga0157286_1010476813300012908SoilVSDSPVSYETATYTVNGITAQEQLGAYEPLNRTNEFVVKIGLRF*
Ga0157286_1039246923300012908SoilYVHWNVSASPVNYETATFTVSGIRARQQWGAYEPLNKTNEFVVRLGFRF*
Ga0164300_1090023923300012951SoilPVNYETATFTVNGITAQEQFGAYEPVNVTHEFVLRLGFHL*
Ga0164299_1041076213300012958SoilVSASPVNYETATFTVTNVTAQEQLGAYEPLNLTHEFVVNFGFHF*
Ga0164302_1009465313300012961SoilNRWSVEPSYVHWRVSASNVSETTATFTVNGITAREQLGAYEPDNDTNEFFLNLGFHF*
Ga0164302_1097981213300012961SoilVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF*
Ga0126369_1362166013300012971Tropical Forest SoilYETATFTVNGITAQEQLGAVEPLNNTNEFAIKLGFHF*
Ga0164304_1013454323300012986SoilSAKYEFTNRWSVEPSYLHWRVSASNVSETTATFTVNGITAREQLGAYEPDNDTNEFFLNLGFHF*
Ga0164305_1192096613300012989SoilPVSPIMATFTVNGITAQEQLGAVEPVNFTNEFGVKFGVRFK*
Ga0157378_1027252113300013297Miscanthus RhizosphereETASFTVNRITAEQQVGAYEPLNVTHEFGLKLGVHF*
Ga0163162_1085311523300013306Switchgrass RhizosphereKYQMARRWSVEPGYIHWNVSASNVDYTTATFTVNGITARQQLGAYEPDNATNEYFVNLGFHF*
Ga0163162_1251240623300013306Switchgrass RhizosphereVSETTATFTVNGIPAREQLGAYEPDNDTNEFFLNLGFHF*
Ga0157375_1036851633300013308Miscanthus RhizosphereLRASARFQIARHWSAEPEYIHWNVSSSPVNYETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF*
Ga0157375_1315254213300013308Miscanthus RhizosphereRFWVEPAYIHWKVSASPVAYETATFTVNGVTAQEQFGAVEPLNTTNEFVVKFGFRF*
Ga0163163_1005056143300014325Switchgrass RhizosphereIRASAKYQLSRRFFVEPAYIYWKVSASPVSYETASFTVNGITAQEQFGAVEPFNSTNEFAVKLSFHF*
Ga0157377_1142408413300014745Miscanthus RhizosphereEIATFTVNGITAQEQFGAYEPRNVTNEFGVKLGIRF*
Ga0180065_108178123300014878SoilPVNYETATFTVNCITVRQQLGAYGPLNTTNEFVVKIGLRF*
Ga0157376_1180163113300014969Miscanthus RhizosphereVNYETATFTVNNATAQEQLGAYEPVNVTSEFGVRLGFHF*
Ga0157376_1289851513300014969Miscanthus RhizosphereVSLETATFTVNGITAQEQLGAVEPLNNTNEFAVKLGFHF*
Ga0180093_101292813300015258SoilIHWNVIASPVNYETSTFTVNGDTVRQQLGAYEPLNTTNEFVVKIGLRF*
Ga0132258_1042795953300015371Arabidopsis RhizospherePVNYETATFTVNNITAQEQMGAYEPHNITSEFGVRLHLHF*
Ga0132258_1044478933300015371Arabidopsis RhizosphereNVGASPVNYETATFTVNSITAQEQLGAYEPLNTTNEFVVKLGFRFARRR*
Ga0132256_10138708923300015372Arabidopsis RhizosphereLEPSFVHWSIDASPVNYETVAFTVNNVTAHQQLGAYEPVNTTNEFAMKLGYRF*
Ga0132256_10153723823300015372Arabidopsis RhizosphereYQTATFTVNGITVEEQLGAYEPLNPTNEFVVNLGFRF*
Ga0132257_10022822313300015373Arabidopsis RhizosphereWHVGASPVSYEMASFTVNRVTAEQQIGAYEPLNVTREFGVKLGFHF*
Ga0132257_10033672923300015373Arabidopsis RhizosphereATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF*
Ga0132257_10261231823300015373Arabidopsis RhizosphereAKYQVTRQWSVEPEFIHWNISASPVNYETATFTLDGITARQQLGAYEPVNRTNEFVVKLGFHF*
Ga0132255_10116294123300015374Arabidopsis RhizosphereRASAKYQLTRHWSVEPAYTHWNVSASPVNYETAAFTVNGVTVQEQFGAYEPLNSTNEFVVKLGFRF*
Ga0132255_10225061823300015374Arabidopsis RhizosphereIHWSVGASNVDDTTATFTVNGITARQQLGAYEPDNVTNEFSVNLGFHF*
Ga0132255_10324698113300015374Arabidopsis RhizosphereEPAYTHWNVSASPVNYQTATFTVNGVTAQEQFGAYEPLNSTNEFVVKLGFHF*
Ga0132255_10341679613300015374Arabidopsis RhizosphereNVSSSPVNYETATFTVHSITAQEQRGFYEPLNRTNEFVVKLGFRF*
Ga0132255_10432634613300015374Arabidopsis RhizosphereSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEVFVKLGFRF*
Ga0132255_10495740713300015374Arabidopsis RhizosphereVNYETATFTVNRITAQQQVGAYEPLNRTNEFVVKLGFRF*
Ga0182040_1149074013300016387SoilRNWSVEPYYIHWSVSASPVNYETAMFTINDVTAQEQLGAYEPVNTTNEFGVKLGFHF
Ga0163161_1152820513300017792Switchgrass RhizosphereRVSASNVSETTATFTVNGITAREQLGAYEPDNDTNEFFLNLGFHF
Ga0184610_119073813300017997Groundwater SedimentKYRMTRRWSVEPDCIHWNVSASPVNYETATFTVNGNTARQQLGAYEPLNTTNEFVVKIGLRF
Ga0187787_1042014423300018029Tropical PeatlandTGRWSVEPEFIHWNVSASPVNYETATFTVHGITAQQQLGAYEPLNTTNEFLVKLGFRF
Ga0187766_1039347423300018058Tropical PeatlandVNASPVNTGTVAFTVNNVTAHELLGAYEPFNVTNEFGVKLGLHF
Ga0187773_1106810423300018064Tropical PeatlandYQVTKSWSVEPYFVHWSVSDSPLSYETATFTVNNVTAQQQLGAYEPMNTTNEFGVKLGVH
Ga0187774_1100090513300018089Tropical PeatlandFIHWNVSASQVNYETATFTVHGITAQQQLGAYEPLNTTNEFVVKLGFRF
Ga0180115_104755123300019257Groundwater SedimentSPVNYETSTFTVNGDTVRQQLGAYEPLNTTNEFVVKIGLRF
Ga0173482_1060027223300019361SoilSLTDSQDTRETVKFTVSRVTASEQLGAYEPVNVTNEFGVTLGFHF
Ga0210380_1025265223300021082Groundwater SedimentTLRASAKYQITRQWAIEPYYVHWNVADSPVSVGTASFTVNGVTAQQQVGFYEPHNFTNEFGVKLGFRF
Ga0182009_1007084613300021445SoilYELTRGWSVEPYYVHWRVSASPVSYETATYTVNRITASEQLGAYEPLNVSREFGVKLGVH
Ga0182009_1052012813300021445SoilKYQLTRHWSVEPSYIHWNVSASPVRSSTVTFTVNGISADQPFGAYEPVNTTNEWTVALGFYF
Ga0247794_1029453723300024055SoilGWGIRASAKYQLSRRFSVEPTYVRWSVDASPVSVETVSFTVNGITAQEQFGAVEPLNSTNEFAVKLGFHF
Ga0207653_1013174813300025885Corn, Switchgrass And Miscanthus RhizosphereAKYQMTRHWSVEPGYIHWNVSASPVNYETATFTVNSITVRQQFGAYEPLNTTDEFVLELGFRF
Ga0207682_1033244413300025893Miscanthus RhizosphereRAGAKYQMTRQWSVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF
Ga0207682_1049605613300025893Miscanthus RhizosphereASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFVVKLGFHF
Ga0207680_1130176813300025903Switchgrass RhizosphereKYQMTRKWSVEPEYIHWNVSASPVSYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF
Ga0207645_1075214123300025907Miscanthus RhizosphereVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF
Ga0207660_1151965613300025917Corn RhizosphereYYLHWHVSDSPVSYETVSFTVNRITAEQQLGAYEPLNVTREFGVKLGFHF
Ga0207662_1021856623300025918Switchgrass RhizosphereRAKYQMTRKWSVEPEYIHWNVSASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFAVKLGFHF
Ga0207649_1014978453300025920Corn RhizosphereRARAKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF
Ga0207649_1078489923300025920Corn RhizospherePVNTQIATFTVNNVTVQQQFGAYEPLNMTHEFLVRLGFHL
Ga0207681_1028625813300025923Switchgrass RhizosphereIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF
Ga0207659_1121777313300025926Miscanthus RhizosphereDSPVKYETATFTVNNVTAQEQLGAYEPHNTTNEFGVRLGFHF
Ga0207659_1182358213300025926Miscanthus RhizosphereTATFTVNGVTAQQPFGAYEPRNVTNEFGVKLGIRF
Ga0207687_1142712013300025927Miscanthus RhizosphereNFEIAEYTVNNISADEQLGAYEPVNHTNEFFVKLGFHF
Ga0207709_1135355513300025935Miscanthus RhizosphereASPVNYETATFTVNGITARQQLGAYEPLNRTNEFVGRLGFRF
Ga0207670_1095109323300025936Switchgrass RhizosphereVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF
Ga0207670_1194310513300025936Switchgrass RhizosphereLRARAKYQMTRKWSVEPEYIHWNVSASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFVVKLGFHF
Ga0207669_1033624323300025937Miscanthus RhizosphereWWVEPEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLIRVGFRF
Ga0207669_1056084023300025937Miscanthus RhizosphereSRRWSVELQYIHWNVNASAVNYETATFTVNGVTARQQLGAYEPLNRTNELVAKVGFRL
Ga0207669_1077412513300025937Miscanthus RhizosphereLRASAKYQVTRRWSVEPAYIYWHVSASTVNYGTATFTVNNVTVVQQVGAYEPVNVTHEFVVRLGFHL
Ga0207704_1178224913300025938Miscanthus RhizosphereVEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF
Ga0207691_1059642613300025940Miscanthus RhizospherePEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF
Ga0207691_1118590523300025940Miscanthus RhizosphereSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF
Ga0207689_1022234013300025942Miscanthus RhizosphereYSVTRHWSVEPSYIHWSVSSSPVNFEIAEYTVNNITADEQLGAYEPVNHTNEFFVKLGFH
Ga0207689_1076982623300025942Miscanthus RhizosphereSVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF
Ga0207679_1216788223300025945Corn RhizosphereGWALRGRGKYQMTRRWSVEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF
Ga0207651_1117169423300025960Switchgrass RhizosphereVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF
Ga0207668_1087684913300025972Switchgrass RhizospherePVNHETATFTVNSITVRQQLGAYEPLNRTNEFIVRLGFRL
Ga0207640_1075025013300025981Corn RhizosphereYIHWTVGASPVNYETATFTVRGVTAQEQLGAYEPVNRTNEFVVKLGFRF
Ga0207640_1206409123300025981Corn RhizosphereWKISASPVNYETATFTVNSITVRQQFGAYEPLNRTDEFLMRVGFRF
Ga0210117_107440823300025985Natural And Restored WetlandsFVTFTVNGIQAREQLGAYEPLNTTREAGVKVVFRF
Ga0207658_1095609613300025986Switchgrass RhizospherePEYIHWTVGASPVNYETATFTVRGVTAQEQLGAYEPVNRTNEFVVKLGFRF
Ga0207641_1036167433300026088Switchgrass RhizosphereVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF
Ga0207676_1111805913300026095Switchgrass RhizosphereWNVSSSAVNDETAMFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF
Ga0207676_1145937813300026095Switchgrass RhizosphereYLHWRVSASNVSETTATFTVNGIPASEQLGAYEPDNDTNEFFLNLGFHF
Ga0207683_1100170313300026121Miscanthus RhizosphereASNVSETTATFTVNGIPAREQLGAYEPDNDTNEFFLNLGFHF
Ga0207683_1106640813300026121Miscanthus RhizosphereTRRWSVEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF
Ga0207683_1138154023300026121Miscanthus RhizospherePDTRETVKFTVSRVTASEQLGAYEPVNVTNEFGVTLGFHF
Ga0209811_1020435923300027821Surface SoilYWRVRASPVSYETATFTVNHITASEQLGAYEPLNVTREFGVKLGFHF
Ga0268266_1088199013300028379Switchgrass RhizosphereDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLIRVGFRF
Ga0268266_1103056733300028379Switchgrass RhizosphereRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF
Ga0268266_1119233013300028379Switchgrass RhizosphereETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF
Ga0247822_1143891513300028592SoilPVNYETATFTVNTMTAREQLGAYEPVNVTSEFGVRLGVHF
Ga0247819_1032394813300028608SoilTAAYTFNTMTAREQLGAYEPVNVTSEFGVRLGVHF
Ga0307504_1019964023300028792SoilSYETATYTVNHITASEQLGAYEPLNMTREFGVKLGFHF
Ga0307498_1027184823300031170SoilSSSPVNYETATFTVNNVTAREQLGAYEPVNVTNEFGVRLGVHF
Ga0170824_11759516523300031231Forest SoilRFSVEPAYIYWKVSASPVSIETATFTVNGITAQEQLGAVEPLNSTNEFAVKLGFHF
Ga0310813_1089098823300031716SoilRWSIEPSYIHWSVDASPVNYETATFSVNGVTARQQLGAYEPVNATDEFAVKLGFRF
Ga0307469_1245313523300031720Hardwood Forest SoilGWGLRTSAKYQMTKQWSLEPEYIHWNVGSSPVNYETASFTVNRITVQEQLGAYEPLNRTNEFVVKLGFRFKAFR
Ga0318547_1100674413300031781SoilIHWNVSTSPVNYETATFTVNGITVQEQLGAYEPLNTTNEFVVKLGLRF
Ga0306923_1239770313300031910SoilSSPVNYETVAFTVNGITAHEQLGAYEPNNNTNEFGLKLGFHF
Ga0310891_1039334623300031913SoilRAKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF
Ga0308174_1045397413300031939SoilVQSSAVESETVAFTVNHVTAREQLGAYEPHNITNEIGVRLGLHF
Ga0310906_1040412123300032013SoilQTSGWALRARAKYQMTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF
Ga0310899_1017868313300032017SoilAPEFIHWNVSASPVSHETATFTVNSVTVRQQFGAYEPLNRTNEFVVKLGFRF
Ga0310890_1133379423300032075SoilKYQITRRWSVEPQYIHWNVGASPVNYETATFTVNGITARQQLGAYEPLNRTNEFVGRLGFRF
Ga0315910_1155173013300032144SoilTIEGLDDVSFTQSKGWAARFGAKYQLTRQWSVEPLYVHWHVDDSTVEPVIATFTVNNITVQQQFGAVEPVNHTNEFVVKFGFRFR
Ga0307471_10435330313300032180Hardwood Forest SoilSPVSDETATYTVRGVTATERLGAYEPLNHTNEAGVKLGFHF
Ga0307472_10152396413300032205Hardwood Forest SoilISASPVNDEAATFTVNSITVQQQLGAYEPLNRTNEFTVKLGFHF
Ga0326726_1033314113300033433Peat SoilNYETTTFTVNGITARQQLGFYEPVNKTNEFVVKLGFRF
Ga0364927_0005197_2341_25203300034148SedimentMTRRWSLEPEYIHWNVSASPVNFETATFTVNRISVRQQLGFYEPLNTTNEFVMKLGFRF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.