Metagenome Family F019452

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F019452
Family Type	Metagenome
Number of Sequences	229
Average Sequence Length	42 residues
Representative Sequence	MTRQEIEQKMDELAREYHDTHDPEIPEEIYELARRLGEMEH
Number of Associated Samples	104
Number of Associated Scaffolds	229

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	41.41 %
% of genes near scaffold ends (potentially truncated)	23.58 %
% of genes from short scaffolds (< 2000 bps)	85.59 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (59.389 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (52.838 % of family members)
Environment Ontology (ENVO)	Unclassified (32.751 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (69.869 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.68
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 229 Family Scaffolds
PF04392	ABC_sub_bind	6.99
PF00072	Response_reg	2.18
PF04972	BON	1.75
PF13186	SPASM	0.87
PF02586	SRAP	0.87
PF07452	CHRD	0.44
PF13592	HTH_33	0.44
PF13488	Gly-zipper_Omp	0.44
PF02239	Cytochrom_D1	0.44
PF13602	ADH_zinc_N_2	0.44
PF01593	Amino_oxidase	0.44
PF00805	Pentapeptide	0.44
PF00011	HSP20	0.44
PF12686	DUF3800	0.44
PF14099	Polysacc_lyase	0.44
PF00872	Transposase_mut	0.44
PF08867	FRG	0.44
PF02265	S1-P1_nuclease	0.44
PF13229	Beta_helix	0.44
PF02735	Ku	0.44
PF00691	OmpA	0.44
PF13751	DDE_Tnp_1_6	0.44
PF13738	Pyr_redox_3	0.44
PF06689	zf-C4_ClpX	0.44
PF04026	SpoVG	0.44
PF03070	TENA_THI-4	0.44
PF05448	AXE1	0.44
PF00753	Lactamase_B	0.44
PF09594	GT87	0.44

COG ID	Name	Functional Category	% Frequency in 229 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	6.99
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	0.87
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.44
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	0.44
COG1357	Uncharacterized conserved protein YjbI, contains pentapeptide repeats	Function unknown [S]	0.44
COG1506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase	Amino acid transport and metabolism [E]	0.44
COG2088	DNA- and RNA-binding protein SpoVG, cell septation regulator	Transcription [K]	0.44
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.44
COG3458	Cephalosporin-C deacetylase or related acetyl esterase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.44

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
All Organisms	root	All Organisms	40.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
cellular organisms	root	All Organisms → cellular organisms	40.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	40.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.42 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.75 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	1.75 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	1.75 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.31 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.87 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	6.11 %
unclassified Nitrospirae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae	1.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.75 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.31 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.87 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.87 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.44 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.44 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.44 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.44 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6.11 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.75 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.87 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.44 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.44 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.44 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.44 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.44 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.44 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	6.11 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.87 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	0.44 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	0.44 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.44 %
unclassified candidate division NC10	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10	0.44 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.44 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.44 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.44 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.44 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.11 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.87 %
candidate division NC10 bacterium CSP1-5	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5	0.44 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.44 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.44 %
Oscillatoriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales	0.44 %
Verrucomicrobia subdivision 3	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3	0.44 %
Hoeflea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea	0.44 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.44 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.44 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.11 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.87 %
Gomontiellaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Gomontiellaceae	0.44 %
unclassified Hoeflea	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea	0.44 %
unclassified Verrucomicrobia subdivision 3	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3	0.44 %
candidate division NC10 bacterium CSP1-5	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5	0.44 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.44 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.44 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.44 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.44 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.11 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.87 %
Verrucomicrobia subdivision 3 bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium	0.44 %
Hoeflea sp. EC-HK425	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. EC-HK425	0.44 %
Crinalium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Gomontiellaceae → Crinalium	0.44 %
candidate division NC10 bacterium CSP1-5	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5	0.44 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.44 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.44 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.44 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.44 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.39 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	6.11 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1.75 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.87 %
Crinalium epipsammum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Gomontiellaceae → Crinalium → Crinalium epipsammum	0.44 %
Verrucomicrobia subdivision 3 bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium	0.44 %
Hoeflea sp. EC-HK425	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. EC-HK425	0.44 %
candidate division NC10 bacterium CSP1-5	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5	0.44 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.44 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.44 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.44 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.44 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.44 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100458063	Not Available	778	Open in IMG/M
3300000550\|F24TB_10773413	Not Available	1297	Open in IMG/M
3300000550\|F24TB_11801457	Not Available	1128	Open in IMG/M
3300000559\|F14TC_100266465	Not Available	619	Open in IMG/M
3300000596\|KanNP_Total_noBrdU_T14TCDRAFT_1021061	Not Available	709	Open in IMG/M
3300000955\|JGI1027J12803_100338772	Not Available	1083	Open in IMG/M
3300000955\|JGI1027J12803_105318039	Not Available	1398	Open in IMG/M
3300002090\|JGI24806J26614_1010001	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1505	Open in IMG/M
3300002100\|JGI24809J26612_1012144	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1749	Open in IMG/M
3300002899\|JGIcombinedJ43975_10032436	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5	855	Open in IMG/M
3300002899\|JGIcombinedJ43975_10035977	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300004052\|Ga0055490_10055529	All Organisms → cellular organisms → Bacteria	1043	Open in IMG/M
3300005159\|Ga0066808_1041354	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	503	Open in IMG/M
3300005164\|Ga0066815_10011594	Not Available	1101	Open in IMG/M
3300005276\|Ga0065717_1014606	Not Available	536	Open in IMG/M
3300005289\|Ga0065704_10174935	Not Available	1267	Open in IMG/M
3300005289\|Ga0065704_10861381	Not Available	506	Open in IMG/M
3300005294\|Ga0065705_10052809	Not Available	1204	Open in IMG/M
3300005294\|Ga0065705_10291866	Not Available	1073	Open in IMG/M
3300005294\|Ga0065705_11145931	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	507	Open in IMG/M
3300005295\|Ga0065707_10140461	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1780	Open in IMG/M
3300005295\|Ga0065707_11023884	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300005467\|Ga0070706_100406269	All Organisms → cellular organisms → Bacteria	1268	Open in IMG/M
3300005549\|Ga0070704_101225520	Not Available	685	Open in IMG/M
3300005764\|Ga0066903_100383971	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	2298	Open in IMG/M
3300005981\|Ga0081538_10271996	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300006049\|Ga0075417_10026573	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2361	Open in IMG/M
3300006049\|Ga0075417_10027212	All Organisms → cellular organisms → Bacteria	2338	Open in IMG/M
3300006049\|Ga0075417_10039382	Not Available	1998	Open in IMG/M
3300006049\|Ga0075417_10068777	All Organisms → cellular organisms → Bacteria	1564	Open in IMG/M
3300006049\|Ga0075417_10076478	Not Available	1488	Open in IMG/M
3300006049\|Ga0075417_10086344	Not Available	1407	Open in IMG/M
3300006049\|Ga0075417_10131729	All Organisms → cellular organisms → Bacteria	1153	Open in IMG/M
3300006049\|Ga0075417_10181775	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	990	Open in IMG/M
3300006049\|Ga0075417_10258403	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	836	Open in IMG/M
3300006049\|Ga0075417_10278229	Not Available	807	Open in IMG/M
3300006049\|Ga0075417_10363572	Not Available	711	Open in IMG/M
3300006049\|Ga0075417_10429617	All Organisms → cellular organisms → Bacteria	656	Open in IMG/M
3300006797\|Ga0066659_10365698	Not Available	1124	Open in IMG/M
3300006797\|Ga0066659_11750503	Not Available	525	Open in IMG/M
3300006844\|Ga0075428_100031409	All Organisms → cellular organisms → Bacteria	5871	Open in IMG/M
3300006844\|Ga0075428_100469889	Not Available	1346	Open in IMG/M
3300006844\|Ga0075428_100520007	Not Available	1273	Open in IMG/M
3300006844\|Ga0075428_100803861	Not Available	999	Open in IMG/M
3300006844\|Ga0075428_101102458	Not Available	838	Open in IMG/M
3300006845\|Ga0075421_100176602	Not Available	2657	Open in IMG/M
3300006845\|Ga0075421_100204809	All Organisms → cellular organisms → Bacteria	2440	Open in IMG/M
3300006845\|Ga0075421_100358131	Not Available	1761	Open in IMG/M
3300006845\|Ga0075421_100431834	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1576	Open in IMG/M
3300006845\|Ga0075421_100641066	Not Available	1243	Open in IMG/M
3300006845\|Ga0075421_100865204	Not Available	1034	Open in IMG/M
3300006845\|Ga0075421_101276514	Not Available	814	Open in IMG/M
3300006845\|Ga0075421_101630061	Not Available	700	Open in IMG/M
3300006845\|Ga0075421_101846683	Not Available	649	Open in IMG/M
3300006845\|Ga0075421_102241236	Not Available	575	Open in IMG/M
3300006846\|Ga0075430_100024446	All Organisms → cellular organisms → Bacteria	5140	Open in IMG/M
3300006847\|Ga0075431_100373212	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1431	Open in IMG/M
3300006847\|Ga0075431_101103968	Not Available	758	Open in IMG/M
3300006847\|Ga0075431_101311796	Not Available	685	Open in IMG/M
3300006847\|Ga0075431_101366047	Not Available	668	Open in IMG/M
3300006847\|Ga0075431_101372292	Not Available	667	Open in IMG/M
3300006847\|Ga0075431_101550675	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300006847\|Ga0075431_102019930	Not Available	532	Open in IMG/M
3300006852\|Ga0075433_10089014	All Organisms → cellular organisms → Bacteria	2728	Open in IMG/M
3300006852\|Ga0075433_10191523	All Organisms → cellular organisms → Bacteria	1819	Open in IMG/M
3300006852\|Ga0075433_10206022	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1748	Open in IMG/M
3300006852\|Ga0075433_10321719	Not Available	1368	Open in IMG/M
3300006852\|Ga0075433_10327726	All Organisms → cellular organisms → Bacteria	1354	Open in IMG/M
3300006852\|Ga0075433_10332022	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300006852\|Ga0075433_10552278	Not Available	1012	Open in IMG/M
3300006852\|Ga0075433_10940391	Not Available	753	Open in IMG/M
3300006852\|Ga0075433_10980100	Not Available	737	Open in IMG/M
3300006852\|Ga0075433_11193576	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Gomontiellaceae → Crinalium → Crinalium epipsammum	660	Open in IMG/M
3300006852\|Ga0075433_11405976	Not Available	603	Open in IMG/M
3300006853\|Ga0075420_100330276	All Organisms → cellular organisms → Bacteria	1321	Open in IMG/M
3300006854\|Ga0075425_100680897	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300006871\|Ga0075434_100496476	All Organisms → cellular organisms → Bacteria	1241	Open in IMG/M
3300006871\|Ga0075434_100601742	All Organisms → cellular organisms → Bacteria	1118	Open in IMG/M
3300006871\|Ga0075434_102001839	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300006871\|Ga0075434_102620027	Not Available	505	Open in IMG/M
3300006880\|Ga0075429_100379609	All Organisms → cellular organisms → Bacteria	1237	Open in IMG/M
3300006880\|Ga0075429_100522273	Not Available	1040	Open in IMG/M
3300006880\|Ga0075429_100559270	All Organisms → cellular organisms → Bacteria	1002	Open in IMG/M
3300006880\|Ga0075429_101015875	Not Available	725	Open in IMG/M
3300006880\|Ga0075429_101291011	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	637	Open in IMG/M
3300006880\|Ga0075429_101749672	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300006903\|Ga0075426_10977239	Not Available	640	Open in IMG/M
3300006903\|Ga0075426_11247952	Not Available	564	Open in IMG/M
3300006904\|Ga0075424_100212270	All Organisms → cellular organisms → Bacteria	2057	Open in IMG/M
3300006904\|Ga0075424_100313500	Not Available	1670	Open in IMG/M
3300006904\|Ga0075424_100347761	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1579	Open in IMG/M
3300006904\|Ga0075424_101001839	All Organisms → cellular organisms → Bacteria	891	Open in IMG/M
3300006904\|Ga0075424_101178159	Not Available	816	Open in IMG/M
3300006904\|Ga0075424_101394397	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300006904\|Ga0075424_101623077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. EC-HK425	685	Open in IMG/M
3300006914\|Ga0075436_100623065	Not Available	796	Open in IMG/M
3300006914\|Ga0075436_101012665	Not Available	624	Open in IMG/M
3300006969\|Ga0075419_10022718	All Organisms → cellular organisms → Bacteria	3882	Open in IMG/M
3300006969\|Ga0075419_10410911	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	929	Open in IMG/M
3300006969\|Ga0075419_10785504	Not Available	680	Open in IMG/M
3300006969\|Ga0075419_10898659	Not Available	639	Open in IMG/M
3300007076\|Ga0075435_100081560	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2657	Open in IMG/M
3300007076\|Ga0075435_100782381	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300009012\|Ga0066710_100143907	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3301	Open in IMG/M
3300009012\|Ga0066710_104096584	Not Available	545	Open in IMG/M
3300009094\|Ga0111539_11053972	Not Available	945	Open in IMG/M
3300009094\|Ga0111539_13492309	Not Available	505	Open in IMG/M
3300009100\|Ga0075418_10537991	All Organisms → cellular organisms → Bacteria	1255	Open in IMG/M
3300009100\|Ga0075418_10581804	Not Available	1204	Open in IMG/M
3300009100\|Ga0075418_10996355	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300009100\|Ga0075418_11829716	Not Available	661	Open in IMG/M
3300009100\|Ga0075418_12910492	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300009100\|Ga0075418_12982662	Not Available	516	Open in IMG/M
3300009137\|Ga0066709_103158015	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	601	Open in IMG/M
3300009143\|Ga0099792_10737058	Not Available	640	Open in IMG/M
3300009147\|Ga0114129_10246242	All Organisms → cellular organisms → Bacteria	2401	Open in IMG/M
3300009147\|Ga0114129_10571363	Not Available	1468	Open in IMG/M
3300009147\|Ga0114129_10964027	Not Available	1076	Open in IMG/M
3300009147\|Ga0114129_11388791	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	867	Open in IMG/M
3300009147\|Ga0114129_11447695	Not Available	846	Open in IMG/M
3300009147\|Ga0114129_11591195	Not Available	800	Open in IMG/M
3300009147\|Ga0114129_11732344	Not Available	762	Open in IMG/M
3300009147\|Ga0114129_12063922	Not Available	688	Open in IMG/M
3300009147\|Ga0114129_12728557	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300009147\|Ga0114129_13214962	Not Available	531	Open in IMG/M
3300009147\|Ga0114129_13447234	Not Available	507	Open in IMG/M
3300009156\|Ga0111538_12696986	Not Available	623	Open in IMG/M
3300009157\|Ga0105092_10094636	All Organisms → cellular organisms → Bacteria	1634	Open in IMG/M
3300009157\|Ga0105092_10303982	Not Available	900	Open in IMG/M
3300009157\|Ga0105092_10344706	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300009157\|Ga0105092_10749918	Not Available	570	Open in IMG/M
3300009162\|Ga0075423_10103823	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2975	Open in IMG/M
3300009162\|Ga0075423_10451314	Not Available	1351	Open in IMG/M
3300009162\|Ga0075423_10478220	Not Available	1310	Open in IMG/M
3300009162\|Ga0075423_10757676	All Organisms → cellular organisms → Bacteria	1026	Open in IMG/M
3300009162\|Ga0075423_11130893	All Organisms → cellular organisms → Bacteria	834	Open in IMG/M
3300009168\|Ga0105104_10082476	All Organisms → cellular organisms → Bacteria	1732	Open in IMG/M
3300009610\|Ga0105340_1484672	Not Available	553	Open in IMG/M
3300009801\|Ga0105056_1044740	Not Available	608	Open in IMG/M
3300010048\|Ga0126373_12037491	Not Available	636	Open in IMG/M
3300011405\|Ga0137340_1021532	Not Available	1183	Open in IMG/M
3300012159\|Ga0137344_1034327	Not Available	867	Open in IMG/M
3300012202\|Ga0137363_10840395	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300012208\|Ga0137376_10074900	All Organisms → cellular organisms → Bacteria	2826	Open in IMG/M
3300012209\|Ga0137379_10766719	Not Available	870	Open in IMG/M
3300012211\|Ga0137377_10980157	Not Available	776	Open in IMG/M
3300012349\|Ga0137387_10727845	Not Available	718	Open in IMG/M
3300012350\|Ga0137372_10257104	Not Available	1371	Open in IMG/M
3300012354\|Ga0137366_10833339	Not Available	654	Open in IMG/M
3300012359\|Ga0137385_11019068	Not Available	682	Open in IMG/M
3300012362\|Ga0137361_10672506	Not Available	947	Open in IMG/M
3300012362\|Ga0137361_11274314	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	659	Open in IMG/M
3300012532\|Ga0137373_10305047	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1264	Open in IMG/M
3300012685\|Ga0137397_10007244	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	7712	Open in IMG/M
3300012685\|Ga0137397_10088217	Not Available	2262	Open in IMG/M
3300012685\|Ga0137397_10265910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1278	Open in IMG/M
3300012922\|Ga0137394_10053260	All Organisms → cellular organisms → Bacteria → Proteobacteria	3346	Open in IMG/M
3300012922\|Ga0137394_10327812	Not Available	1308	Open in IMG/M
3300012929\|Ga0137404_10230414	Not Available	1582	Open in IMG/M
3300012929\|Ga0137404_10258350	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium	1497	Open in IMG/M
3300012929\|Ga0137404_12010954	Not Available	539	Open in IMG/M
3300012930\|Ga0137407_10371125	Not Available	1321	Open in IMG/M
3300012930\|Ga0137407_11646132	Not Available	611	Open in IMG/M
3300012986\|Ga0164304_10641115	Not Available	799	Open in IMG/M
3300012989\|Ga0164305_10207304	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1383	Open in IMG/M
3300015371\|Ga0132258_10091572	All Organisms → cellular organisms → Bacteria	7132	Open in IMG/M
3300015372\|Ga0132256_101445728	Not Available	799	Open in IMG/M
3300016270\|Ga0182036_10857663	Not Available	743	Open in IMG/M
3300016357\|Ga0182032_10774346	All Organisms → cellular organisms → Bacteria	810	Open in IMG/M
3300016357\|Ga0182032_11037044	Not Available	702	Open in IMG/M
3300016371\|Ga0182034_11331867	Not Available	627	Open in IMG/M
3300016387\|Ga0182040_10549613	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	929	Open in IMG/M
3300016422\|Ga0182039_10564872	Not Available	990	Open in IMG/M
3300018052\|Ga0184638_1022424	All Organisms → cellular organisms → Bacteria	2242	Open in IMG/M
3300018052\|Ga0184638_1156154	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300018052\|Ga0184638_1186031	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300018052\|Ga0184638_1243349	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	622	Open in IMG/M
3300018053\|Ga0184626_10197076	Not Available	854	Open in IMG/M
3300018075\|Ga0184632_10026285	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2479	Open in IMG/M
3300018075\|Ga0184632_10163964	Not Available	980	Open in IMG/M
3300018078\|Ga0184612_10139998	Not Available	1266	Open in IMG/M
3300018081\|Ga0184625_10129707	Not Available	1313	Open in IMG/M
3300018081\|Ga0184625_10326636	Not Available	799	Open in IMG/M
3300018081\|Ga0184625_10521778	Not Available	596	Open in IMG/M
3300019789\|Ga0137408_1159027	Not Available	1879	Open in IMG/M
3300021344\|Ga0193719_10266802	Not Available	722	Open in IMG/M
3300022756\|Ga0222622_10201537	Not Available	1321	Open in IMG/M
3300025910\|Ga0207684_10214588	All Organisms → cellular organisms → Bacteria	1660	Open in IMG/M
3300025972\|Ga0207668_11084371	Not Available	718	Open in IMG/M
3300027722\|Ga0209819_10201102	Not Available	694	Open in IMG/M
3300027873\|Ga0209814_10013744	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3221	Open in IMG/M
3300027873\|Ga0209814_10022442	All Organisms → cellular organisms → Bacteria	2569	Open in IMG/M
3300027873\|Ga0209814_10064417	Not Available	1536	Open in IMG/M
3300027873\|Ga0209814_10069318	All Organisms → cellular organisms → Bacteria	1481	Open in IMG/M
3300027873\|Ga0209814_10090155	Not Available	1296	Open in IMG/M
3300027873\|Ga0209814_10093169	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1275	Open in IMG/M
3300027873\|Ga0209814_10169380	Not Available	939	Open in IMG/M
3300027873\|Ga0209814_10208460	Not Available	845	Open in IMG/M
3300027873\|Ga0209814_10275361	Not Available	731	Open in IMG/M
3300027873\|Ga0209814_10290958	Not Available	711	Open in IMG/M
3300027880\|Ga0209481_10020937	Not Available	2894	Open in IMG/M
3300027880\|Ga0209481_10027554	Not Available	2553	Open in IMG/M
3300027880\|Ga0209481_10039412	Not Available	2165	Open in IMG/M
3300027880\|Ga0209481_10054184	All Organisms → cellular organisms → Bacteria	1865	Open in IMG/M
3300027880\|Ga0209481_10207169	Not Available	981	Open in IMG/M
3300027907\|Ga0207428_10623486	Not Available	776	Open in IMG/M
3300027909\|Ga0209382_10017681	All Organisms → cellular organisms → Bacteria	8675	Open in IMG/M
3300027909\|Ga0209382_10085104	All Organisms → cellular organisms → Bacteria	3721	Open in IMG/M
3300027909\|Ga0209382_10179580	All Organisms → cellular organisms → Bacteria	2436	Open in IMG/M
3300027909\|Ga0209382_10244276	All Organisms → cellular organisms → Bacteria	2041	Open in IMG/M
3300027909\|Ga0209382_11880738	Not Available	579	Open in IMG/M
3300028889\|Ga0247827_11193033	Not Available	527	Open in IMG/M
3300031562\|Ga0310886_10982221	Not Available	540	Open in IMG/M
3300031719\|Ga0306917_10345971	All Organisms → cellular organisms → Bacteria	1155	Open in IMG/M
3300031720\|Ga0307469_10586365	Not Available	994	Open in IMG/M
3300031720\|Ga0307469_12114591	Not Available	547	Open in IMG/M
3300031740\|Ga0307468_100026586	All Organisms → cellular organisms → Bacteria	2675	Open in IMG/M
3300031820\|Ga0307473_11243762	Not Available	555	Open in IMG/M
3300031879\|Ga0306919_11378066	Not Available	533	Open in IMG/M
3300031942\|Ga0310916_11692691	Not Available	512	Open in IMG/M
3300031947\|Ga0310909_10646819	Not Available	881	Open in IMG/M
3300032003\|Ga0310897_10259013	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300032180\|Ga0307471_100463654	Not Available	1409	Open in IMG/M
3300032180\|Ga0307471_101183572	Not Available	929	Open in IMG/M
3300032770\|Ga0335085_11353287	Not Available	749	Open in IMG/M
3300034115\|Ga0364945_0045484	Not Available	1215	Open in IMG/M
3300034354\|Ga0364943_0193821	Not Available	745	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	55.90%
Environmental	Environmental	44.10%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	55.90%
Terrestrial	Environmental → Terrestrial	34.50%
Aquatic	Environmental → Aquatic	9.61%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	53.71%
Soil	Environmental → Terrestrial → Soil	33.62%
Sediment	Environmental → Aquatic → Sediment	6.55%
Freshwater	Environmental → Aquatic → Freshwater	2.62%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.75%
Floodplain	Environmental → Terrestrial → Floodplain	0.87%
Marine	Environmental → Aquatic → Marine	0.44%
Roots	Host-Associated → Plants → Roots	0.44%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	52.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	29.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.55%
Loam	Environmental → Terrestrial → Soil → Loam	3.49%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.62%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.75%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.87%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.87%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.44%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.44%
Sand	Environmental → Terrestrial → Soil → Sand	0.44%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.44%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	52.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.03%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.55%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.49%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.62%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.75%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.31%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.31%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.87%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.87%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.44%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.44%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.44%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.44%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.44%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	52.84%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.48%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.93%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.62%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.62%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	2.18%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.18%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.75%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.31%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.31%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.87%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.87%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.87%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.44%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.44%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.44%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.44%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.44%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.44%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.44%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.44%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000596	Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002090	Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA	Environmental	Open in IMG/M
3300002100	Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA	Environmental	Open in IMG/M
3300002899	Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)	Environmental	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300005159	Soil and rhizosphere microbial communities from Laval, Canada - mgLPB	Environmental	Open in IMG/M
3300005164	Soil and rhizosphere microbial communities from Laval, Canada - mgLAC	Environmental	Open in IMG/M
3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5	Host-Associated	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009801	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300011405	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2	Environmental	Open in IMG/M
3300012159	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1004580632	3300000364	Soil	VTREEIEQRMDELAREYRDTHDPEIPKEIYRLARQLMEMDH*RDDSQ
F24TB_107734132	3300000550	Soil	MTREEIGQKLDALARENCDTHDPGIPEEIYELARRLREVED*
F24TB_118014573	3300000550	Soil	MAWVRQEIEEKLEKLTREYGDTHDPENPDQIFELPRRLGEMDHVFPY*
F14TC_1002664652	3300000559	Soil	QKMDELAREYHETHDPEIPEQILELARXXREMEH*
KanNP_Total_noBrdU_T14TCDRAFT_10210612	3300000596	Soil	MTCQEIEEKMDELAREYHDTHDPEIPEEIFELVRRLREMDH*
JGI1027J12803_1003387721	3300000955	Soil	VTREEIEQKMDALAREYHETKDPEILAEIFKLARRLREMEH*
JGI1027J12803_1053180394	3300000955	Soil	VTRQEIEQEMDELAREYHETHDPEIPEEIFELARQ
JGI24806J26614_10100012	3300002090	Soil	VTRQEIEQKMDELAREYHDTHDPEIPEEIFELARRLREMDY*
JGI24809J26612_10121443	3300002100	Soil	MTREEIEQKMDELAREYHDTHDPEIPEEIFELARRLREMDH*
JGIcombinedJ43975_100324361	3300002899	Soil	VTRQEIEQEMDELAREYHETHDPEIPEEIFELARQLREMEH*
JGIcombinedJ43975_100359771	3300002899	Soil	MTREEIGQKLDALXRENCDTHDPGIPEEIYELARRLREVED*
Ga0055490_100555292	3300004052	Natural And Restored Wetlands	MIYATTVTRKEIEQKMDELAWEYHETHDQDIPDQIWRLARQLRELDH*
Ga0066808_10413542	3300005159	Soil	VTRQEIEQKMDELAREYHETRDPEIPEEIYELVRRLGEMEH*
Ga0066815_100115941	3300005164	Soil	VTRQEIEQKMDELAREYHDTHDPEIPEEIFELARRLREMEH*
Ga0065717_10146062	3300005276	Arabidopsis Rhizosphere	MTRQEIEQKMEALAREYYETHDPEIPKEIFEVARRLREMDH*RAR
Ga0065704_101749352	3300005289	Switchgrass Rhizosphere	MTREKIGQKLDALARENCDTHHPGIPEEIYELARRLREVED*
Ga0065704_108613812	3300005289	Switchgrass Rhizosphere	MTRQEIEQKMDELAREYHKTHDPEIIEEVYRLARQLRYLDH*
Ga0065705_100528093	3300005294	Switchgrass Rhizosphere	MTRQEIEQKMDELAREYHEIHDPEIPEEIFELARRLREMDH*
Ga0065705_102918661	3300005294	Switchgrass Rhizosphere	MTREKIGQKLDALARENCDTHDPGIPEEIYELARRLREVED*
Ga0065705_111459311	3300005294	Switchgrass Rhizosphere	MTRQEIEQKMDELAREYHETRDPEIPEEIYELVRRLGEMEH*
Ga0065707_101404614	3300005295	Switchgrass Rhizosphere	MTRQEIEQKMDELAREYRDTHDPEIPEEIFELARLQEMDH*
Ga0065707_110238842	3300005295	Switchgrass Rhizosphere	VTRQEIEQKMDELAREYHETHDPEIPEEIFELARRLKEMEH*
Ga0070706_1004062695	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MTRKEIEKRMDELAREFAKTHDREIAEEIFELARRLGKTEH*
Ga0070704_1012255202	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	VTRQEIEQKMDELAREYRDTHDPEIPEEIFELARRLKEMEH*
Ga0066903_1003839714	3300005764	Tropical Forest Soil	MTRKEVEQNMDELAREYHDTHDPEIPEEIFELARRA*
Ga0081538_102719962	3300005981	Tabebuia Heterophylla Rhizosphere	MTREEIEQKMDELAWEYHEMHNPEIREEIYRLARQLKEFDH*
Ga0075417_100265734	3300006049	Populus Rhizosphere	MTRHEIEQKMDELAREYRETHDPEIPEEIFELARRLKEMEH*
Ga0075417_100272122	3300006049	Populus Rhizosphere	VTRQEIEQKMDALAREYHETHDPEIPDEIYELARRLKEMEH*
Ga0075417_100393822	3300006049	Populus Rhizosphere	MTRQEIEKKMDALAREYHENEDPDIPEEIFELARRLKEMDH*
Ga0075417_100687772	3300006049	Populus Rhizosphere	VTRQEIEQKVDALAREFAEARNPEIPEEIYRLARQLREMKKQ*
Ga0075417_100764784	3300006049	Populus Rhizosphere	TRQEIEQKMDALAREYHETHDPEIPEKIFELARRLREMDH*
Ga0075417_100863442	3300006049	Populus Rhizosphere	MTRQEIEQKMDELGREYRDTQDSEIPDKMFKLGSQLRELDH*
Ga0075417_101317291	3300006049	Populus Rhizosphere	MTRKEIEQKMDALAREYHDTHDSEIPEEIYRLARQLGEMEH*
Ga0075417_101817753	3300006049	Populus Rhizosphere	PVTRQEIEQKMDELAREYRETHDAEIPEEIYELARWLRELDH*
Ga0075417_102584032	3300006049	Populus Rhizosphere	VTRQEIEQKMDELAREYHDTHDPEIPEEIYRLARQLMEMNR*
Ga0075417_102782293	3300006049	Populus Rhizosphere	MTRQEIEQKMGELAREYHETHDPEIPEEIFELARRLKGMEH*
Ga0075417_103635722	3300006049	Populus Rhizosphere	VTRQEIEQKMDELAREYRDTHDPEIPEEIFELAMRLREMDH*
Ga0075417_104296172	3300006049	Populus Rhizosphere	VVKPGDMPSPITRQEIEQKMDELAREYRETHDPEIPEKIYRLARQLKELDH*
Ga0066659_103656982	3300006797	Soil	MADLTRQEIEQKMDALAREYHDTRDPEIPEEIYRLARQLGEMEH*
Ga0066659_117505031	3300006797	Soil	QEIEQRMDELAREYHDIHEREIPEEIYRLARQLGEMEH*
Ga0075428_1000314095	3300006844	Populus Rhizosphere	MTRQEIEQKMDELAREYYDTHDPEIPEEIFELARRLKGMEH*
Ga0075428_1004698892	3300006844	Populus Rhizosphere	VTREEIEQKMDELAREYRDTHDPEIPEEIFELAGRLKEMGH*
Ga0075428_1005200072	3300006844	Populus Rhizosphere	MTRDKIGQKLDALARENCDTHDPGIPEEIYELARRLREVED*
Ga0075428_1008038611	3300006844	Populus Rhizosphere	MTRKEIEQKMDALAREYHDTHDSEIPEEIYRLACQLGEMEH*
Ga0075428_1011024581	3300006844	Populus Rhizosphere	MTRQEIEQRMDELARKYRDTRDREIPEEIFELARQLGEMEH*
Ga0075421_1001766022	3300006845	Populus Rhizosphere	VGNAVVVTRQEIEKKMDALAREYHENEDPDIPEEILELARRLKEMDH*
Ga0075421_1002048093	3300006845	Populus Rhizosphere	MTRQEIEQKMDELAREYHDTHDPEIPEEIYELAMRLKEMDH*
Ga0075421_1003581314	3300006845	Populus Rhizosphere	MTRQEIEQKMDALAREYHETHDPEIPEKIFELARRLREMDH*
Ga0075421_1004318343	3300006845	Populus Rhizosphere	MQSPVTRQEIEQKMDELAREYRETHDPEIPEEIYELARWLRELDH*
Ga0075421_1006410661	3300006845	Populus Rhizosphere	MTREEIGQKLDALARENCDTHDPGIPEEIYELARRL
Ga0075421_1008652042	3300006845	Populus Rhizosphere	MDVMTRQEIEERMDELAREYHENKDPEIPEEIYRLARLLEELDH*
Ga0075421_1012765141	3300006845	Populus Rhizosphere	MTRQEIEQKMDALAREYHETHDPEIPEEIFELATRLRELDH*
Ga0075421_1016300611	3300006845	Populus Rhizosphere	MTPQEIEQKMDALAREYRETHDPEIPEEILELARRLREMDH*
Ga0075421_1018466832	3300006845	Populus Rhizosphere	MTRQEIEQKMDELAREYRDTHDPEIPEEIFELAGRLKEMGH*
Ga0075421_1022412361	3300006845	Populus Rhizosphere	MTRQDIEQKMDELAREYHEIHDPEIPEEILELARRLREMEH*
Ga0075430_1000244469	3300006846	Populus Rhizosphere	TRQEIEQKMDELAREYHDTHDPEIPEEIYRLARQLMEMNR*
Ga0075431_1003732122	3300006847	Populus Rhizosphere	VTRQEIEQKMDELAREYHDTHDPEIPEEIYRLARQLMEMDH*
Ga0075431_1011039681	3300006847	Populus Rhizosphere	VTREEIEQRMDELARKYRDTRDREIPEQIFELARRLKEMEH*
Ga0075431_1013117961	3300006847	Populus Rhizosphere	VTRQEIEQKMDELAREYHDSHDPEILDEIYSLARRLREMEH*
Ga0075431_1013660472	3300006847	Populus Rhizosphere	MTRQEIEQKMDELARQYRDTHDPEIPAEIFELARRLKVMEH*
Ga0075431_1013722921	3300006847	Populus Rhizosphere	MALPVTRQEIEQKMDELAREYRDTHDPEIPEEIFELAGRLKEMGH*
Ga0075431_1015506753	3300006847	Populus Rhizosphere	MDVMTRQEIEQRMDELAREYHDTHDPEILEEIYELARRLREMDH*
Ga0075431_1020199301	3300006847	Populus Rhizosphere	MEQKMDELAREYRDTHDPEIPEEIFELARRLREMEH*
Ga0075433_100890145	3300006852	Populus Rhizosphere	MISRTRQEIEQRMDELAREYRDTHDPEIPEEIYRLARQLKELDH*
Ga0075433_101915235	3300006852	Populus Rhizosphere	MRRHFMTRQEIEQKMDELAREYRDTQDSEIPDKMFKLGSQLRELDH*
Ga0075433_102060221	3300006852	Populus Rhizosphere	VTREEIEQKMDESAREYHENKDPEILAEIFKLARRLKEIEH*
Ga0075433_103217192	3300006852	Populus Rhizosphere	MTRQEIEQRMDELAREYRDTHDPEIPAEIFELARRLKVMEH*
Ga0075433_103277263	3300006852	Populus Rhizosphere	VTREEIEQRMDELAREYHDTHDPEIPEEIFELARRLKVMEH*
Ga0075433_103320221	3300006852	Populus Rhizosphere	VTREEIEQKMDELAREYHETHDPEIPEEIFELARRLREMEH*
Ga0075433_105522783	3300006852	Populus Rhizosphere	MTRQEIEQKMDELAREYHEIHDPEIPEEILELARRLREMEH*
Ga0075433_109403912	3300006852	Populus Rhizosphere	MPFSSEIKKMDELAREYRETHDPTIPEKIYRLARQLKELDH*
Ga0075433_109801001	3300006852	Populus Rhizosphere	MTREEIEKQMDQLAREYHDTHDPEIPEKIFELARR
Ga0075433_111935761	3300006852	Populus Rhizosphere	VPVTREEIEQKMDELAREYRDTHDPEIPEEIYRLARQLREMEH*
Ga0075433_114059761	3300006852	Populus Rhizosphere	MTRQEIEQKMDELAREYHDTRDPEIPEEIFELAGRLKEMGH*
Ga0075420_1003302764	3300006853	Populus Rhizosphere	AIMTAKEIEQKMDKLAREYRDTHDTEIPEEIFELARGLKEMEH*
Ga0075425_1006808972	3300006854	Populus Rhizosphere	MKRQEIEKQMDKLAREYHENKDPEILAEIFELARRLNQLEH*
Ga0075434_1004964763	3300006871	Populus Rhizosphere	MTRQEIEQKMDELAREYRDTHDPEIPEEIFELARRLREMDH*
Ga0075434_1006017423	3300006871	Populus Rhizosphere	MDVMTRQEIEQRMDELAREYHENKDPEIPEEIYELARRLREMDH*
Ga0075434_1020018392	3300006871	Populus Rhizosphere	MPFSSEIKKMEELAREYRETHDPTIPEKIYRLARQLKELDH
Ga0075434_1026200271	3300006871	Populus Rhizosphere	IEQKMDELAREYRDTHDPEIPEEIFELAGRLKEMGH*
Ga0075429_1003796092	3300006880	Populus Rhizosphere	MTRQEIEQKMDELAREYRDTQDSEIPDKMFKLGSQLRELDH*
Ga0075429_1005222731	3300006880	Populus Rhizosphere	VTREEIEQRMDELAREYRENKDPEILAEIFKLARRLKEMDH*
Ga0075429_1005592702	3300006880	Populus Rhizosphere	VTRQEIEQKMDELAREYRDTHDPEIPAEIYRLARQLKELDH*
Ga0075429_1010158752	3300006880	Populus Rhizosphere	VTRREIEQRMDELARKYRDTRDREIPEEIFELARQLGEMEH*
Ga0075429_1012910111	3300006880	Populus Rhizosphere	EIEQKMDELAREYHENHDPEIPGEIFELARRLKEMEH*
Ga0075429_1017496722	3300006880	Populus Rhizosphere	VTRQEIEQKMDDDTGDPEIPEEIFELARRLKEMEH*
Ga0075426_109772392	3300006903	Populus Rhizosphere	MTRQEIEEKMEALAREYHDTHDPEIPEQILELARRLRA
Ga0075426_112479522	3300006903	Populus Rhizosphere	VGNAVVVTRQEIEKKMDELAPEYHENEDPDIPEEIFELARRLKEMDH*
Ga0075424_1002122703	3300006904	Populus Rhizosphere	TRQEIEQKMDELAREYRDTHDPEIPEEIYSLARQLREMAC*
Ga0075424_1003135002	3300006904	Populus Rhizosphere	MTRQEIEQRKDELAREYRDTHDPEIPAEIFELARRLKVMEH*
Ga0075424_1003477613	3300006904	Populus Rhizosphere	MTRQEIQQEMDELAREYHDTHDPEIPEEIYRLARQLMEMDH*
Ga0075424_1010018391	3300006904	Populus Rhizosphere	MISRTRQEIEQRMDELAREYRDTHDPEIPEEIYRLARQLRELDH*
Ga0075424_1011781591	3300006904	Populus Rhizosphere	VTRQEIEQKMDELAREYHDTHDPEIPEEIFELARVLHSQNQDSE*
Ga0075424_1013943972	3300006904	Populus Rhizosphere	MPFSSEIKKMEELAREYRETHDPTIPEKIYRLARQLKELDH*
Ga0075424_1016230771	3300006904	Populus Rhizosphere	VTRQEIEQKMDELAREYHETKDPEILAEIFKLARRLKEIEH*
Ga0075436_1006230651	3300006914	Populus Rhizosphere	VTREEIEQRMDELAREYHDTHDPEIPEEIYRLARQLKELDH*
Ga0075436_1010126652	3300006914	Populus Rhizosphere	VGNAVVVTRQEIEKKMDALAREYHENEDPDIPEEILELARRL
Ga0075419_100227185	3300006969	Populus Rhizosphere	MRRHFMTRQEIEQKMDELGREYRDTQDSEIPDKMFKLGSQLRELDH*
Ga0075419_104109111	3300006969	Populus Rhizosphere	VTRQEIEQKMDELAREYHVTHDSEIPEEIFELARRLKEMEH*
Ga0075419_107855041	3300006969	Populus Rhizosphere	MTRKEKEKKMDALAREYHDTHDSEIPEEIYRLARQLGEMEH*
Ga0075419_108986591	3300006969	Populus Rhizosphere	MTRQEIEQRMDELAREYCDTHDPEIPEEIFELARRLKEMEH*
Ga0075435_1000815601	3300007076	Populus Rhizosphere	PMTRQEIEQKMDALAREYHETHDPEIPEKIFELARRLREMDH*
Ga0075435_1007823813	3300007076	Populus Rhizosphere	MDVMTRQEIEQGMDELAREYHENKDPEIPEEIYELARRLREMDH*
Ga0066710_1001439073	3300009012	Grasslands Soil	MTRQEIEQKMDELAREYHDTRDPEIPEEIYRLARQLGEMENG
Ga0066710_1040965841	3300009012	Grasslands Soil	MTRQEIEQRMDELAREYHDIHKPEIPEEIYRLARQLGEMEH
Ga0111539_110539721	3300009094	Populus Rhizosphere	MTRQEIEQKMDELAQEYHDTHDPEIPEEIFELARRLREMEH*
Ga0111539_134923092	3300009094	Populus Rhizosphere	MTREEIEQKMDELAREYYDTHDPEIPEEIFELARRLKGMEH*
Ga0075418_105379913	3300009100	Populus Rhizosphere	MTRQEIEQKMDELAREYHENKDPEILAEIFKLARRLKEIEH
Ga0075418_105818041	3300009100	Populus Rhizosphere	IEQKMGELAREYHETHDPEIPEEIFELARRLKGMEH*
Ga0075418_109963552	3300009100	Populus Rhizosphere	AVPMTRQEIQQEMDELAREYHDTHDPETPEKIYELARQARSAIR*
Ga0075418_118297161	3300009100	Populus Rhizosphere	TATLMTRQEIKQRMDELAREYHENKDPENLAEIFKLARQLKEMEH*
Ga0075418_129104922	3300009100	Populus Rhizosphere	VTRQEIEQKIDELAREYYDTHDPEIPEEILELARRLREM
Ga0075418_129826622	3300009100	Populus Rhizosphere	MTMICRAMTRQEIEQKMDELAREYHDTYDPEIPEEIFELARRLREMEH*
Ga0066709_1031580151	3300009137	Grasslands Soil	MTRQEIEQKMDELAREYHDTRDPEIPEEIYRLARQLGEMENG*
Ga0099792_107370581	3300009143	Vadose Zone Soil	SDTVTRQVIEQKMDELAREYHETHDPEIPDEIFELARRLKEMEH*
Ga0114129_102462421	3300009147	Populus Rhizosphere	SMARQEIEQKMDALAREYHETHDPEIPKEIYRLARQLMEMDH*
Ga0114129_105713631	3300009147	Populus Rhizosphere	MTRQEIEQKMDELAREYRETHDPEIPEEIYELARRLKEMEH*
Ga0114129_109640271	3300009147	Populus Rhizosphere	TGPKPVTRQEIEQKMDELAREYRDTHDPEIPAEIYRLARQLKELDH*
Ga0114129_113887912	3300009147	Populus Rhizosphere	TRQEIEQKMDELAREYHDTHDPEIPEEIYRLARQLMEMDH*
Ga0114129_114476951	3300009147	Populus Rhizosphere	MQKPMTRQEIEQKMDELAREYHDTPDAEILAELFELARWLKELEH*
Ga0114129_115911952	3300009147	Populus Rhizosphere	MTREEIEKQMDQLAREYHDTHDPEIPEKIFELARRFGEMDH*
Ga0114129_117323441	3300009147	Populus Rhizosphere	MTRQEIEQRMDELAREYCDTHDPEIPAEIFELARRLKEMEH*
Ga0114129_120639221	3300009147	Populus Rhizosphere	MTRQEIEQRMDELAREYHEIHDPEIPEEIFELARRLREMDH*
Ga0114129_127285571	3300009147	Populus Rhizosphere	EIEQKMDQLAREYRDTHDPEVIEEIYELARRLKETTTA*
Ga0114129_132149621	3300009147	Populus Rhizosphere	VTRQEIEQKMDELAREYRVTHDPEIPEEIFELARRLREMEH*
Ga0114129_134472341	3300009147	Populus Rhizosphere	IEQKMDELAREYRENHDPEITEEIYKLARQLRELDH*
Ga0111538_126969862	3300009156	Populus Rhizosphere	MTRQEIEKKMDALAREYHENEDPDIPEEILELARRLKEMDH*
Ga0105092_100946361	3300009157	Freshwater Sediment	CVKIKSVDRAMTREEIGQKLDALAREYDDTDGPEIPEEIYELARRLGEMEH*
Ga0105092_103039822	3300009157	Freshwater Sediment	MTRQEIQQKIDELAREFAESHAPEISEEIYELAG*
Ga0105092_103447062	3300009157	Freshwater Sediment	VTRQEIEEKMDELAREYHETHDPEIPEEIFELVRRLREMDH*
Ga0105092_107499182	3300009157	Freshwater Sediment	MTREEIEQRMDELAREFAKTHDPEIRDKIYRLARQLKELDH*
Ga0075423_101038231	3300009162	Populus Rhizosphere	MTRQEIGQRMDELAREYRDTHDPEIPAEIFELARRLKVMEH*
Ga0075423_104513142	3300009162	Populus Rhizosphere	MTRQEIEQKMDELAREYRENHDPEIPEEIYRLARLLEELDH*
Ga0075423_104782202	3300009162	Populus Rhizosphere	VTRQEIQQKMDELAREYHDTHDPEIPEEIFELARRLREMEH*
Ga0075423_107576763	3300009162	Populus Rhizosphere	MTRQEIKQRMDELAREYHENKDPENLAEIFKLARQLKEMEH*
Ga0075423_111308933	3300009162	Populus Rhizosphere	SLLAGTPMTRQEIEQKMDELAREYRDTHDPEIPEEIYELARRLREMEH*
Ga0105104_100824762	3300009168	Freshwater Sediment	MTRKEIGEKSDALARENYGTDDPEIPEEIYELARRLREMEH*
Ga0105340_14846722	3300009610	Soil	MTRHEIEQKMDELAREYHATHDPEIPEQIFELASRLKEMEH
Ga0105056_10447401	3300009801	Groundwater Sand	RQEIEQTMDELAREDHDTHDPEIPEEIYELARRLREMEH*
Ga0126373_120374911	3300010048	Tropical Forest Soil	MTREEIEQKTDELARKYVETHDPEIPCEIYRLARQLEELDH*
Ga0137340_10215324	3300011405	Soil	ASTRQEIEQTMDALAREFAETHAPEMPEEIYRLARQLGEMKKQ*
Ga0137344_10343272	3300012159	Soil	MTRQEIEQKMDELAREYCETHDPEIPEEIFELARRLREMDH*
Ga0137363_108403952	3300012202	Vadose Zone Soil	MLKALPVTREEVEQKMDELAREYHNTHDPKIREEIFELTRRLKEMEH*
Ga0137362_106577741	3300012205	Vadose Zone Soil	MLKALPVTREEVEQKMDELAWEYHNTHDPKIREEIFE
Ga0137376_100749002	3300012208	Vadose Zone Soil	MISMTRQEIEQRMDELAREYHDIHEPEIPEEIYRLARQLGEMEH*
Ga0137379_107667192	3300012209	Vadose Zone Soil	MTRKEIERKMDALTREYHDTHDPEIPEEIYRLARQLGEMEH*
Ga0137377_109801572	3300012211	Vadose Zone Soil	MTRQEIEQTMDELAREYHDTHDPAIPEEIYELARRLKEMEH*
Ga0137387_107278452	3300012349	Vadose Zone Soil	RQAMTRKEIERKMDALTREYHDTHDPEIPEEIYRLARQLGEMEH*
Ga0137372_102571042	3300012350	Vadose Zone Soil	VIRQEIEQKMDELAREYRDTHDPEIPEEIFDWLGG*
Ga0137366_108333392	3300012354	Vadose Zone Soil	PVTRQEIEQKMDELAREYCDEIYELAKRLGEMGH*
Ga0137385_110190681	3300012359	Vadose Zone Soil	MAGDMQTPMTRQEIEQKMDELPREYHETRDPEIPEEIYELVRRLGEMEH*
Ga0137361_106725061	3300012362	Vadose Zone Soil	RKMLKALPVTREEVEQKMDELAREYHNTHDPKIREEIFELTRRLKEMEH*
Ga0137361_112743141	3300012362	Vadose Zone Soil	MTREKIEKRMDALAREFAKTHDREIAEEIFELARRLKEMEH*
Ga0137373_103050471	3300012532	Vadose Zone Soil	MTRQEIEQKMDALAREYRDTHDPEIPEEIFELARRLGEMDH*
Ga0137397_100072443	3300012685	Vadose Zone Soil	MQSGVTREEIERKMDELARKYVDTHDPEIPEEIFELASRLKGMEY*
Ga0137397_100882173	3300012685	Vadose Zone Soil	MKERFSFGQAMTREEIEQKMDELAREYHDTHDPEIPEEIYELARRLGEMEH*
Ga0137397_102659102	3300012685	Vadose Zone Soil	VTRQEIEQKMDELAREYRDTHDPEIPEEIFELARWLKEMEH*
Ga0137394_100532603	3300012922	Vadose Zone Soil	MARQEIEQKMDELAREYHDTHDAEIPEEIFELARRLKEMEH*
Ga0137394_103278123	3300012922	Vadose Zone Soil	VTRQEIEQKMDALAREYYDTHDPEIPEEIYRLARLLEELDH*
Ga0137404_102304143	3300012929	Vadose Zone Soil	MINMTRHEIEQKMDALAREYHETHDPEIPEEIFELARRLREMEH*
Ga0137404_102583501	3300012929	Vadose Zone Soil	MARQEIEQKMDELAREYHDTHDAEIPEEIFELARRLREMEH*
Ga0137404_120109541	3300012929	Vadose Zone Soil	QKMDELAREYHDTHDKEVPEEIFELARRLKEMEH*
Ga0137407_103711253	3300012930	Vadose Zone Soil	VTRQEIEQKMDELAREYHDTHDPEIPEEIYELARLLGEMDH*
Ga0137407_116461321	3300012930	Vadose Zone Soil	MDVMTRQEIEQRMDELARKYHDTRDPEIPEEIFELA
Ga0164304_106411152	3300012986	Soil	MTRQEIEQKTDELAREYHETRDPEIPEEIYELVRRLGEMEH*
Ga0164305_102073042	3300012989	Soil	MIFRAPGPMTREEIEKRMDALARELTKTHDWEIAEEIFELARRLGKTEH*
Ga0132258_100915722	3300015371	Arabidopsis Rhizosphere	MTRQEIEQRMDELAREYYDTHDREIPEEIFELARQLKEMAY*
Ga0132256_1014457282	3300015372	Arabidopsis Rhizosphere	MTRQEIAQKMDVLAREYYETHDPEIPEEIFELPRPLRKMDH*
Ga0182036_108576631	3300016270	Soil	MTREEIKKRMDELAREFAKTHDREIAEEIYELARRLKAMEH
Ga0182032_107743462	3300016357	Soil	VELHEGKSTMTREEIEQRMDELAREFAKTHDREIAEEIYDLARRLKAMEH
Ga0182032_110370442	3300016357	Soil	MTREEIKKRMDELAREFAKTHDREIAEEIYELARRLKAMEL
Ga0182034_113318673	3300016371	Soil	MTREEIEKRMDDLAREYAKTHDREIAEEIFELARRLKETVH
Ga0182040_105496131	3300016387	Soil	MTREEIEKRMDALAREFAKTHDREIAEEIYELDRRLK
Ga0182039_105648722	3300016422	Soil	EGKSTMTREEIEQRMDELAREFAKTHDREIAEEIYELARRLKAMEH
Ga0184638_10224243	3300018052	Groundwater Sediment	MTRQEIEQKMDELAREYCETHDPEIPEEIFELARRLREMDH
Ga0184638_11561542	3300018052	Groundwater Sediment	MTRQEIRAKDGRALAREFAETHDPEIPEEIYELARRLGEMEH
Ga0184638_11860311	3300018052	Groundwater Sediment	MTRQEIEQKMDALAREYHDTRDPEIPEEIYRLARQLGEMEH
Ga0184638_12433493	3300018052	Groundwater Sediment	VTRREIEQKMDELVREYHDTHDPEIPEEIYRLARQLGELDH
Ga0184626_101970761	3300018053	Groundwater Sediment	VLGRGQGRLYAEPMTRQEIEQKMDELAREYHDTHDPEIPEEIYRLARQLREMDH
Ga0184632_100262854	3300018075	Groundwater Sediment	LIRGQGRYADPVTRQKMEQKMDALAREFAKTHDPEVREGIYELARRLREMEH
Ga0184632_101639641	3300018075	Groundwater Sediment	MQCPMIRHEIEQKMGELAREYHDTHDPEIPEEIYELARRL
Ga0184612_101399983	3300018078	Groundwater Sediment	MQCPMIRQEIEQRMDELEYHDTHDPEMPEEIYRLATQLREMEH
Ga0184625_101297072	3300018081	Groundwater Sediment	MTRQEIEQKMDELAREYHDTHDPEIPEEIYELARRLGEMEH
Ga0184625_103266362	3300018081	Groundwater Sediment	MQCPMIRHEIEQKMDELAREYHDTQDPKIPEEIYELARRLREMEH
Ga0184625_105217781	3300018081	Groundwater Sediment	VICRAVTREEIEQRMDELEYHDTHDPEIPEEIYRLATQLREMEH
Ga0137408_11590274	3300019789	Vadose Zone Soil	MKERFSFGQAMTREEIEQKMDELAREYHDTHDPEIPEEIYELARRLGEMEH
Ga0193719_102668021	3300021344	Soil	VTITISNSMTWQEIEQKMDALAREYHDTHDPEIPEEIFELARRLREMEH
Ga0222622_102015372	3300022756	Groundwater Sediment	MSSEKTREEIEQKMDALAREYHDTHDPEIPEEIFELARRLREMDH
Ga0207684_102145885	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MTRKEIEKRMDELAREFAKTHDREIAEEIFELARRLGKTEH
Ga0207668_110843712	3300025972	Switchgrass Rhizosphere	VTRQEIEQKIDELAREYRDTHDPEIPEKIFELARRLREMDH
Ga0209819_102011022	3300027722	Freshwater Sediment	VTRQEIEEKMDELAREYHETHDPEIPEEIFELVRRLREMDH
Ga0209814_100137447	3300027873	Populus Rhizosphere	IEQKMDALAREYHETHDPEIPEKIFELARRLREMDH
Ga0209814_100224423	3300027873	Populus Rhizosphere	MTPQEIEQKMDALAREYRETHDPEIPEEILELARRLREMDH
Ga0209814_100644171	3300027873	Populus Rhizosphere	MTRQEIEQKMDELAREYYDTHDPEIPEEIFELARRLK
Ga0209814_100693181	3300027873	Populus Rhizosphere	MTRHEIEQKMDELAREYRETHDPEIPEEIFELARRLKEMEH
Ga0209814_100901553	3300027873	Populus Rhizosphere	MTRQEIEKKMDALAREYHENEDPDIPEEIFELARRLKEMDH
Ga0209814_100931691	3300027873	Populus Rhizosphere	MQSPVTRQEIEQKMDELAREYRETHDAEIPEEIYELARWLRELDH
Ga0209814_101693802	3300027873	Populus Rhizosphere	VTRQEIEQKMDELAREYRVTHDPEIPEEIFELARRLREMEH
Ga0209814_102084601	3300027873	Populus Rhizosphere	MTRQEIEQKMGELAREYHETHDPEIPEEIFELARRLKGMEH
Ga0209814_102753611	3300027873	Populus Rhizosphere	MTRKEIEQKMDALAREYHDTHDSEIPEEIYRLARQLGEMEH
Ga0209814_102909581	3300027873	Populus Rhizosphere	MTRQEIEQRMDELAREYCDTHDPEIPAEIFELARRLKEMEH
Ga0209481_100209371	3300027880	Populus Rhizosphere	VGNAVVVTRQEIEKKMDALAREYHENEDPDIPEEILEL
Ga0209481_100275543	3300027880	Populus Rhizosphere	MTRQEIEQKMDALAREYHETHDPEIPEKIFELARRLREMDH
Ga0209481_100394121	3300027880	Populus Rhizosphere	RPAKRTVGNAVVVTRQEIEKKMDALAREYHENEDPDIPEEIFELARRLKEMDH
Ga0209481_100541842	3300027880	Populus Rhizosphere	MTRQEIEQKMDELGREYRDTQDSEIPDKMFKLGSQLRELDH
Ga0209481_102071692	3300027880	Populus Rhizosphere	MTRQEIEQKMDELAREYYDTHDPEIPEEIFELARRLKGMEH
Ga0207428_106234862	3300027907	Populus Rhizosphere	IEQKMDELAREYRDTQDSEIPDKMFKLGSQLRELDH
Ga0209382_1001768116	3300027909	Populus Rhizosphere	MQSPVTRQEIEQKMDELAREYRETHDPEIPEEIYELARWLRELDH
Ga0209382_100851044	3300027909	Populus Rhizosphere	MRRHFMTRQEIEQKMDELGREYRDTQDSEIPDKMFKLGSQLRELDH
Ga0209382_101795803	3300027909	Populus Rhizosphere	MTRQEIEQKMDELAREYHDTHDPEIPEEIYELAMRLKEMDH
Ga0209382_102442764	3300027909	Populus Rhizosphere	VVKPGDMPSPITRQEIEQKMDELAREYRETHDPEIPEKIYRLARQLKELDH
Ga0209382_118807381	3300027909	Populus Rhizosphere	RQEIEQKMDELAREYRETHDPEIPEEIYRLARLLEELDH
Ga0247827_111930331	3300028889	Soil	MTRQEIEQRMDTVAREYHDTHDPEIPEEIFELARQLREMD
Ga0310886_109822212	3300031562	Soil	MTRQEIEQKMEALAREYYETHDPEIPKEIFEVARRLREMDH
Ga0306917_103459711	3300031719	Soil	MTREEIEQRMDELAREFAKTHDREIAEEIYELARRLKAMEH
Ga0307469_105863651	3300031720	Hardwood Forest Soil	MTREKIGQKLDALAREICDTHDPGIPEEIYELARRLREV
Ga0307469_121145911	3300031720	Hardwood Forest Soil	VTRQEIEQKMDELAREYRDTHDPEIPEEIFELARRLKEMEH
Ga0307468_1000265862	3300031740	Hardwood Forest Soil	MTREKIGQKLDALARENCDTHDPGIPEEIYELARRLREVED
Ga0307473_112437622	3300031820	Hardwood Forest Soil	VTRQEIEQKMDELAREYHDTHDPEIPEEIFELARRLREMEH
Ga0306919_113780662	3300031879	Soil	KARARPAMTREEIEKRMDDLAREYAKTHDREIAEEIYELARRLKAMEH
Ga0306923_118507182	3300031910	Soil	MTREEIVQRMDELAREFAKTHDPEIAEEIYRLAGVVAWQVH
Ga0310916_116926911	3300031942	Soil	VELHEGKSTMTREEIEQRMDELAREFAKTHDREIAEEIYELARRLKAMEH
Ga0310909_106468191	3300031947	Soil	RARPAMTREEIEKRMDDLAREYAKTHDREIAEEIYELARRLKAMEH
Ga0310897_102590133	3300032003	Soil	MTRQEIEQRMDELAREYYDTHDREIPEEIFELARQLKEMAY
Ga0307471_1004636543	3300032180	Hardwood Forest Soil	QEIEQRMDELAREYHDTHDPDIPEEIFELARRLKEMEH
Ga0307471_1011835722	3300032180	Hardwood Forest Soil	MTREEIEKWMDELAREFAKTHDREIAEEIFELARRLGKTEH
Ga0335085_113532873	3300032770	Soil	MIREEIGKKMDELAREFAKTHDREIAEEIFELARRLKETVH
Ga0364945_0045484_493_618	3300034115	Sediment	MTRQEIEQKMDELAREYHATHDPEIPEQIFELASRLKEMEH
Ga0364943_0193821_168_293	3300034354	Sediment	VTRQEIEQKMDELAREYHDTHDPEIPEEIYELARQLGEMHH

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F019452

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences