NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019322

Metagenome / Metatranscriptome Family F019322

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019322
Family Type Metagenome / Metatranscriptome
Number of Sequences 230
Average Sequence Length 39 residues
Representative Sequence VIIRYADSFAAATSTTGSPTITVAGGYRVYQWTSSGSITF
Number of Associated Samples 156
Number of Associated Scaffolds 230

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 9.72 %
% of genes near scaffold ends (potentially truncated) 83.48 %
% of genes from short scaffolds (< 2000 bps) 76.96 %
Associated GOLD sequencing projects 143
AlphaFold2 3D model prediction Yes
3D model pTM-score0.72

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (46.087 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(22.174 % of family members)
Environment Ontology (ENVO) Unclassified
(70.870 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(63.043 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 27.94%    Coil/Unstructured: 72.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.72
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.30.5.11: Galactose mutarotase-liked2g3ma12g3m0.65
d.144.1.6: Protein kinase-like (PK-like)d3tm0a_3tm00.64
d.144.1.0: Protein kinase-like (PK-like)d6vxua_6vxu0.64
d.95.2.1: Homing endonucleasesd3eh8a13eh80.63
d.68.2.0: EPT/RTPC-liked5u4ha15u4h0.62


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 230 Family Scaffolds
PF00041fn3 3.48
PF01833TIG 1.74
PF00768Peptidase_S11 1.74
PF13385Laminin_G_3 1.30
PF01391Collagen 1.30
PF00415RCC1 1.30
PF01171ATP_bind_3 0.87
PF13481AAA_25 0.43
PF13489Methyltransf_23 0.43
PF05226CHASE2 0.43
PF00383dCMP_cyt_deam_1 0.43
PF137592OG-FeII_Oxy_5 0.43
PF03819MazG 0.43
PF09374PG_binding_3 0.43
PF11351GTA_holin_3TM 0.43
PF06048DUF927 0.43
PF13692Glyco_trans_1_4 0.43
PF12224Amidoligase_2 0.43
PF00004AAA 0.43
PF13884Peptidase_S74 0.43
PF07719TPR_2 0.43
PF00454PI3_PI4_kinase 0.43
PF12236Head-tail_con 0.43
PF13649Methyltransf_25 0.43
PF13539Peptidase_M15_4 0.43
PF04550Phage_holin_3_2 0.43
PF12708Pectate_lyase_3 0.43
PF01370Epimerase 0.43
PF11651P22_CoatProtein 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 230 Family Scaffolds
COG5184Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteinsCell cycle control, cell division, chromosome partitioning [D] 2.61
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.74
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.87
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.87
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.87
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.87
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.87
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.87
COG4252Extracytoplasmic sensor domain CHASE2 (specificity unknown)Signal transduction mechanisms [T] 0.43
COG5519Predicted ATPase domain of Cch-like helicases, DUF927 familyGeneral function prediction only [R] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.91 %
UnclassifiedrootN/A46.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10067942All Organisms → Viruses → Predicted Viral1133Open in IMG/M
3300001842|RCM30_1099968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300001843|RCM34_1049539All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300002363|B570J29624_104807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300002835|B570J40625_100974377Not Available727Open in IMG/M
3300003394|JGI25907J50239_1045416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage904Open in IMG/M
3300004763|Ga0007746_1369574Not Available769Open in IMG/M
3300005528|Ga0068872_10159911Not Available1307Open in IMG/M
3300005528|Ga0068872_10630371Not Available567Open in IMG/M
3300005581|Ga0049081_10010369All Organisms → Viruses → Predicted Viral3529Open in IMG/M
3300005581|Ga0049081_10235282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300005581|Ga0049081_10273961Not Available587Open in IMG/M
3300005581|Ga0049081_10349628Not Available501Open in IMG/M
3300005583|Ga0049085_10043806All Organisms → Viruses → Predicted Viral1627Open in IMG/M
3300005758|Ga0078117_1110419Not Available2242Open in IMG/M
3300006484|Ga0070744_10014004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2378Open in IMG/M
3300006484|Ga0070744_10017153Not Available2149Open in IMG/M
3300006484|Ga0070744_10135148Not Available709Open in IMG/M
3300006802|Ga0070749_10225252Not Available1068Open in IMG/M
3300006805|Ga0075464_10432592Not Available802Open in IMG/M
3300007538|Ga0099851_1226889All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300007541|Ga0099848_1036714Not Available2021Open in IMG/M
3300007559|Ga0102828_1087756Not Available750Open in IMG/M
3300007559|Ga0102828_1176663Not Available542Open in IMG/M
3300007559|Ga0102828_1184395Not Available531Open in IMG/M
3300007973|Ga0105746_1095536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage972Open in IMG/M
3300008266|Ga0114363_1210504Not Available587Open in IMG/M
3300008448|Ga0114876_1209764Not Available648Open in IMG/M
3300008448|Ga0114876_1238421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300008450|Ga0114880_1084714All Organisms → Viruses → Predicted Viral1257Open in IMG/M
3300008450|Ga0114880_1132862Not Available919Open in IMG/M
3300009026|Ga0102829_1037763Not Available1426Open in IMG/M
3300009151|Ga0114962_10478778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300009152|Ga0114980_10202504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1167Open in IMG/M
3300009152|Ga0114980_10486995Not Available703Open in IMG/M
3300009158|Ga0114977_10245616Not Available1035Open in IMG/M
3300009158|Ga0114977_10492105Not Available672Open in IMG/M
3300009159|Ga0114978_10384803All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300009159|Ga0114978_10410624Not Available809Open in IMG/M
3300009160|Ga0114981_10202644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1088Open in IMG/M
3300009161|Ga0114966_10097648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1980Open in IMG/M
3300009161|Ga0114966_10132303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1641Open in IMG/M
3300009161|Ga0114966_10238307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1130Open in IMG/M
3300009163|Ga0114970_10338063Not Available849Open in IMG/M
3300009164|Ga0114975_10096290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1714Open in IMG/M
3300009164|Ga0114975_10100570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1672Open in IMG/M
3300009164|Ga0114975_10197294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1138Open in IMG/M
3300009180|Ga0114979_10093266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1864Open in IMG/M
3300009180|Ga0114979_10172660Not Available1318Open in IMG/M
3300009180|Ga0114979_10241768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1083Open in IMG/M
3300009180|Ga0114979_10323448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300009180|Ga0114979_10764864Not Available543Open in IMG/M
3300009181|Ga0114969_10161248All Organisms → Viruses → Predicted Viral1401Open in IMG/M
3300009184|Ga0114976_10452787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300009185|Ga0114971_10025780Not Available3783Open in IMG/M
3300009185|Ga0114971_10790526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300010157|Ga0114964_10183233Not Available1010Open in IMG/M
3300010160|Ga0114967_10064931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2231Open in IMG/M
3300010160|Ga0114967_10157735Not Available1254Open in IMG/M
3300010318|Ga0136656_1154028Not Available785Open in IMG/M
3300010334|Ga0136644_10611657Not Available598Open in IMG/M
3300010354|Ga0129333_10106705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2586Open in IMG/M
3300010354|Ga0129333_10129694All Organisms → Viruses → Predicted Viral2319Open in IMG/M
3300010370|Ga0129336_10266113Not Available960Open in IMG/M
3300010885|Ga0133913_10775184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2502Open in IMG/M
3300010885|Ga0133913_10822458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2419Open in IMG/M
3300010885|Ga0133913_10866722Not Available2348Open in IMG/M
3300010885|Ga0133913_11810164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1528Open in IMG/M
3300010885|Ga0133913_12303373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1322Open in IMG/M
3300010885|Ga0133913_12449014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1274Open in IMG/M
3300012012|Ga0153799_1069583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300012013|Ga0153805_1025295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1010Open in IMG/M
3300012013|Ga0153805_1088350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300012663|Ga0157203_1017452All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300012665|Ga0157210_1020496Not Available1072Open in IMG/M
3300012920|Ga0160423_10524309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300013004|Ga0164293_11064357Not Available501Open in IMG/M
3300013005|Ga0164292_10655124Not Available674Open in IMG/M
3300013006|Ga0164294_10333583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1047Open in IMG/M
3300013372|Ga0177922_10521961Not Available725Open in IMG/M
3300013372|Ga0177922_10771407Not Available510Open in IMG/M
3300015050|Ga0181338_1004757All Organisms → Viruses → Predicted Viral2314Open in IMG/M
3300017700|Ga0181339_1012295Not Available992Open in IMG/M
3300017700|Ga0181339_1013903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage926Open in IMG/M
3300017700|Ga0181339_1032013All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales576Open in IMG/M
3300017701|Ga0181364_1016947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1210Open in IMG/M
3300017716|Ga0181350_1003034All Organisms → cellular organisms → Bacteria → Proteobacteria4875Open in IMG/M
3300017716|Ga0181350_1141195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300017716|Ga0181350_1150679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300017747|Ga0181352_1106485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage766Open in IMG/M
3300017761|Ga0181356_1117911Not Available850Open in IMG/M
3300017766|Ga0181343_1046205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1288Open in IMG/M
3300017766|Ga0181343_1111547Not Available772Open in IMG/M
3300017774|Ga0181358_1235517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300017777|Ga0181357_1000677Not Available13040Open in IMG/M
3300017777|Ga0181357_1014654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3123Open in IMG/M
3300017780|Ga0181346_1283688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300017784|Ga0181348_1086838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1235Open in IMG/M
3300017785|Ga0181355_1031365All Organisms → Viruses → Predicted Viral2293Open in IMG/M
3300017785|Ga0181355_1247326Not Available685Open in IMG/M
3300017785|Ga0181355_1319885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300017785|Ga0181355_1361048Not Available532Open in IMG/M
3300017785|Ga0181355_1367927Not Available525Open in IMG/M
3300018036|Ga0181600_10209899Not Available1032Open in IMG/M
3300018424|Ga0181591_11053849Not Available550Open in IMG/M
3300020141|Ga0211732_1509202All Organisms → Viruses → Predicted Viral1378Open in IMG/M
3300020151|Ga0211736_10523735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300020151|Ga0211736_10610375Not Available525Open in IMG/M
3300020159|Ga0211734_11286458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga alba751Open in IMG/M
3300020161|Ga0211726_10360064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1089Open in IMG/M
3300020162|Ga0211735_10066365Not Available932Open in IMG/M
3300020196|Ga0194124_10124250Not Available1426Open in IMG/M
3300020205|Ga0211731_10154055All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon783Open in IMG/M
3300020533|Ga0208364_1056875Not Available504Open in IMG/M
3300021519|Ga0194048_10146090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300021962|Ga0222713_10691110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300022179|Ga0181353_1098402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300022198|Ga0196905_1133234Not Available646Open in IMG/M
3300022407|Ga0181351_1086521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1238Open in IMG/M
3300022752|Ga0214917_10424751Not Available539Open in IMG/M
3300022927|Ga0255769_10270574Not Available705Open in IMG/M
3300023179|Ga0214923_10137547Not Available1556Open in IMG/M
3300023184|Ga0214919_10231096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1348Open in IMG/M
3300024346|Ga0244775_10182953Not Available1762Open in IMG/M
3300024346|Ga0244775_11534825Not Available508Open in IMG/M
3300024348|Ga0244776_10364533Not Available968Open in IMG/M
3300024495|Ga0255164_1032423Not Available856Open in IMG/M
3300025416|Ga0208877_1046297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300025595|Ga0208248_1013969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1947Open in IMG/M
3300025616|Ga0208613_1134857Not Available554Open in IMG/M
3300025687|Ga0208019_1186212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300025715|Ga0209310_1048513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1452Open in IMG/M
3300027621|Ga0208951_1093001Not Available829Open in IMG/M
3300027631|Ga0208133_1007206All Organisms → cellular organisms → Bacteria → Proteobacteria3175Open in IMG/M
3300027631|Ga0208133_1011870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2365Open in IMG/M
3300027631|Ga0208133_1075965Not Available794Open in IMG/M
3300027649|Ga0208960_1116266Not Available703Open in IMG/M
3300027659|Ga0208975_1000533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18103Open in IMG/M
3300027679|Ga0209769_1017393All Organisms → Viruses → Predicted Viral2554Open in IMG/M
3300027697|Ga0209033_1059294All Organisms → Viruses → Predicted Viral1348Open in IMG/M
3300027712|Ga0209499_1170375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300027712|Ga0209499_1319261Not Available521Open in IMG/M
3300027732|Ga0209442_1053519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1732Open in IMG/M
3300027746|Ga0209597_1385586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300027747|Ga0209189_1411611Not Available500Open in IMG/M
3300027759|Ga0209296_1151201All Organisms → Viruses → Predicted Viral1044Open in IMG/M
3300027759|Ga0209296_1397099Not Available517Open in IMG/M
3300027763|Ga0209088_10177732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage923Open in IMG/M
3300027763|Ga0209088_10332257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300027770|Ga0209086_10054355Not Available2229Open in IMG/M
3300027772|Ga0209768_10085530Not Available1578Open in IMG/M
3300027782|Ga0209500_10197235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage911Open in IMG/M
3300027785|Ga0209246_10305308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300027793|Ga0209972_10246640Not Available807Open in IMG/M
3300027797|Ga0209107_10238299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage880Open in IMG/M
3300027798|Ga0209353_10362218All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300027805|Ga0209229_10013392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3488Open in IMG/M
3300027808|Ga0209354_10220653Not Available766Open in IMG/M
3300027808|Ga0209354_10267029All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300027808|Ga0209354_10444187Not Available500Open in IMG/M
3300027896|Ga0209777_10491519Not Available906Open in IMG/M
3300027899|Ga0209668_10496596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage809Open in IMG/M
3300027899|Ga0209668_11021186Not Available557Open in IMG/M
3300027963|Ga0209400_1028113Not Available3170Open in IMG/M
3300027963|Ga0209400_1160507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage969Open in IMG/M
3300028025|Ga0247723_1166198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300028394|Ga0304730_1160302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300028394|Ga0304730_1226290Not Available689Open in IMG/M
3300028394|Ga0304730_1330780Not Available513Open in IMG/M
3300031857|Ga0315909_10541119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300031999|Ga0315274_11944959Not Available531Open in IMG/M
3300032050|Ga0315906_10497507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1032Open in IMG/M
3300032116|Ga0315903_10737499Not Available730Open in IMG/M
3300032118|Ga0315277_11677779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300032164|Ga0315283_12290167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300033981|Ga0334982_0000093Not Available48844Open in IMG/M
3300033981|Ga0334982_0000880Not Available18883Open in IMG/M
3300033981|Ga0334982_0013593All Organisms → Viruses → Predicted Viral4800Open in IMG/M
3300033992|Ga0334992_0000029All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage144450Open in IMG/M
3300033992|Ga0334992_0333570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage700Open in IMG/M
3300033993|Ga0334994_0031472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3434Open in IMG/M
3300033994|Ga0334996_0265361Not Available874Open in IMG/M
3300033996|Ga0334979_0002114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14507Open in IMG/M
3300034012|Ga0334986_0000667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage30168Open in IMG/M
3300034013|Ga0334991_0139074All Organisms → Viruses → Predicted Viral1119Open in IMG/M
3300034019|Ga0334998_0182792All Organisms → Viruses → Predicted Viral1316Open in IMG/M
3300034022|Ga0335005_0022229All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae4436Open in IMG/M
3300034022|Ga0335005_0203811All Organisms → cellular organisms → Bacteria → Proteobacteria1225Open in IMG/M
3300034023|Ga0335021_0408995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
3300034062|Ga0334995_0003523Not Available16002Open in IMG/M
3300034062|Ga0334995_0025474All Organisms → cellular organisms → Bacteria5182Open in IMG/M
3300034062|Ga0334995_0030478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4642Open in IMG/M
3300034062|Ga0334995_0186066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1460Open in IMG/M
3300034062|Ga0334995_0632618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300034073|Ga0310130_0006583All Organisms → Viruses → Predicted Viral4400Open in IMG/M
3300034082|Ga0335020_0067796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1848Open in IMG/M
3300034082|Ga0335020_0103096Not Available1454Open in IMG/M
3300034092|Ga0335010_0442904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300034093|Ga0335012_0403258Not Available668Open in IMG/M
3300034106|Ga0335036_0005173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes11057Open in IMG/M
3300034106|Ga0335036_0012902Not Available6830Open in IMG/M
3300034106|Ga0335036_0148360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1672Open in IMG/M
3300034106|Ga0335036_0306159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1054Open in IMG/M
3300034106|Ga0335036_0465291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300034106|Ga0335036_0581960Not Available683Open in IMG/M
3300034108|Ga0335050_0078444All Organisms → Viruses → Predicted Viral1970Open in IMG/M
3300034108|Ga0335050_0078807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1964Open in IMG/M
3300034108|Ga0335050_0414168Not Available601Open in IMG/M
3300034111|Ga0335063_0368923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage736Open in IMG/M
3300034117|Ga0335033_0605652Not Available509Open in IMG/M
3300034118|Ga0335053_0533983Not Available686Open in IMG/M
3300034121|Ga0335058_0206805All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1146Open in IMG/M
3300034122|Ga0335060_0026858Not Available3767Open in IMG/M
3300034200|Ga0335065_0455447Not Available774Open in IMG/M
3300034284|Ga0335013_0682281Not Available589Open in IMG/M
3300034355|Ga0335039_0455353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake22.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater21.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake16.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.35%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.48%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.91%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.17%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.74%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.74%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.74%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.30%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.30%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.30%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.30%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.87%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.87%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.43%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.43%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.43%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.43%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.43%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.43%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.43%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.43%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.43%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001842Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2bEnvironmentalOpen in IMG/M
3300001843Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2bEnvironmentalOpen in IMG/M
3300002363Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004763Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020533Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022927Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaGEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024495Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300024507Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300025416Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025595Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes)EnvironmentalOpen in IMG/M
3300025616Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025715Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)EngineeredOpen in IMG/M
3300027135Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028286Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1006794213300001282FreshwaterVIRYSDSFPLASSTTGSPTITTAGGFRTYKFTGSGSITF*
RCM30_109996813300001842Marine PlanktonVVIRYADTSPAATSTTGSPTDTVTGGYRIYKWTSSGSITF*
RCM34_104953933300001843Marine PlanktonRYADSFAAAASTTGSPTVTVAGGYRVYSFTASGSITF*
B570J29624_10480733300002363FreshwaterVILRYPDTNAAATSITGSPTVTVAGGYRVYKWTSSGSITF*
B570J29032_10927417013300002408FreshwaterIVIVRYSDSYAAAVSTTGSPSVSVSGGFRTYTFTGSGSITW*
B570J40625_10097437733300002835FreshwaterIVRYSDSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF*
JGI25907J50239_104541633300003394Freshwater LakeGIVILRYPDTFIAATSTTGSPTITVAGGFRVYKWTSSGSITF*
Ga0007746_136957413300004763Freshwater LakeLLSYPSAYPAATSTTGSPSVLVSGGLRVYKFTSSGSITF*
Ga0068872_1015991143300005528Freshwater LakeVIVRYSDSYAAAVSTTGSPTYTVSGGYRVYKFTGSGSITW*
Ga0068872_1063037123300005528Freshwater LakeVILRYPDTFRAATSTTGSPTIAVAGGFRVYQFTANGSITF*
Ga0049081_1001036933300005581Freshwater LenticRYADSYAAATSTTGSPTITVSGGYRTYKFTASGSITF*
Ga0049081_1023528213300005581Freshwater LenticVIIRYADTYIAATSTTGSPTITVAGGYRVYKWTASGSITF*
Ga0049081_1027396113300005581Freshwater LenticRYPSNQPAVTSTTGSPTVTVAGGYRHYIFTSSGTLTW*
Ga0049081_1034962823300005581Freshwater LenticGIVIIRYADTYAAATTTTGSPTITVAGGYRVYKWTGSGTITF*
Ga0049085_1004380613300005583Freshwater LenticYPDTFIAATSTTGSPTITVAGGFRVYQYTANGSITF*
Ga0078117_111041913300005758Lake WaterIVAIRYPSTYPAATSTTGTVNVYVSGGYRTYVWTSSGTITF*
Ga0070744_1001400413300006484EstuarineVVIIRYPDSYPLATSAPGAGVSTTGGYRIYQWTSSGSITF*
Ga0070744_1001715313300006484EstuarineEIRYSDSFGPAVSTTGSPTTSTNGGYRYYIFTSSGSIRF*
Ga0070744_1013514823300006484EstuarineIRYPDSYSAASSTTGSPTITVAGGYRTYKFTTSGSITF*
Ga0070749_1022525213300006802AqueousNGGSGVVIIRYPDTYAIAYTTGSPSYTVSGGYRIYRYTSSGSIIF*
Ga0075464_1043259243300006805AqueousRYPDTFIAATSTTGSPTITVAGGFRVYKFTANGSITF*
Ga0099851_122688913300007538AqueousDTFDAAAATTGSPTITVSGGYRIYTFTASGSITF*
Ga0099848_103671413300007541AqueousYADTFAAAASTTGSPTVTVAGGYRVYKFTGSGSITW*
Ga0102828_108775613300007559EstuarineQGVVAIQYPDTYPLATSTTGSPTITNPTGYRVYTWTSSGSITF*
Ga0102828_117666313300007559EstuarineIIRYADSYAAAASTTGSPTVTVAGGYRVYSWTGSGTITF*
Ga0102828_118439533300007559EstuarineIKYADTYPAATSTTGSPTISVSDGFRTYTFTSSGSITF*
Ga0105746_109553633300007973Estuary WaterIVIIRYADTFAAATATTGSPTITVAGGYRVYKWTTVGSGSITF*
Ga0114340_103016413300008107Freshwater, PlanktonVIIRYSDAFAAAASTTGSPTVTVSGGFRTYTFNGSGSITW*
Ga0114346_119358513300008113Freshwater, PlanktonYSDAFAAAASTTGSPTVTVSGGFRTYTFNGSGSITW*
Ga0114363_121050433300008266Freshwater, PlanktonIRYPDTFIAAASTTGSPTITVAGGFRVYRFTASGSITF*
Ga0114876_120976413300008448Freshwater LakeSDTYAAATSTTGSPTITTAGGYRVYKYTSSGSITF*
Ga0114876_123842123300008448Freshwater LakeADSFAAATATTGSPTITVAGGYRIYKWTSSGSITF*
Ga0114880_108471413300008450Freshwater LakeGSNGIAGIVAIKYADSFAPATATTGSPTITVANGFRVYEWTSSGSITF*
Ga0114880_113286233300008450Freshwater LakeRYADTFPAATSTTGSPATVTSGGYRYYTWTGSGSVTF*
Ga0102829_103776323300009026EstuarineGGSGVVIIRYPDTYPAATSTSGSPTVTVTGGYRIYRFTATGTITL*
Ga0114962_1047877823300009151Freshwater LakeGGSGIVIIRYEDSYAAATTTGSPNVTVAGGYRVYKFTNSGSIIF*
Ga0114980_1020250433300009152Freshwater LakeGGSGIVIIRYADSYAAATTTGSPNVTVAGGYRVYKFTNSGSIIF*
Ga0114980_1048699523300009152Freshwater LakeVIIRYADVYTAASNTTGSPNVTVTGGYRVYQFNSSGSITF*
Ga0114977_1024561623300009158Freshwater LakeVIFRYADTYPAAVSTTGSPTITVAGGYRVYKYTSSGSITF*
Ga0114977_1049210513300009158Freshwater LakeDTYAAATTTTGSPTITTAGGYIIYKWTSSGSITF*
Ga0114978_1038480313300009159Freshwater LakeSGIVIIRYADTYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF*
Ga0114978_1041062433300009159Freshwater LakeVVVIRYADTFAAAITTGSPTVTVSGGYRTYRFTGSGSIEF*
Ga0114981_1020264443300009160Freshwater LakeVVIRYVDSFDAATATTGSPTITVAGGYRVYKFTGSGSITF*
Ga0114966_1009764833300009161Freshwater LakeILRYPDTFRAATSTTGSPTITVAGGFRVYQFTASGSITF*
Ga0114966_1013230313300009161Freshwater LakeIRYADTSAAATATTGSPTITVAGGYRVYQWTSSGSITF*
Ga0114966_1023830713300009161Freshwater LakeTNQGGSGVVIIRYADSFAVASATGSPTITVAGGYRYYKFTTSGTITF*
Ga0114970_1033806343300009163Freshwater LakeVIIRYVNTYDAATGTTGSPTITNTGGYRYYTFNDTGTITF*
Ga0114975_1009629023300009164Freshwater LakeIVIIRYSDAYVAATSTTGSPTITTAGGYRVYQWTSSGSITF*
Ga0114975_1010057013300009164Freshwater LakeIVIIRYPDSYLAATSTTGSPTITVTGGYRIYTWTGSGSITI*
Ga0114975_1019729413300009164Freshwater LakeYADSYAAATSTTGSPTITVTGGYRIYKWTSSGSITF*
Ga0114979_1009326623300009180Freshwater LakeYADTYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF*
Ga0114979_1017266033300009180Freshwater LakeSGIVIIRYADTYPAATSTTGSPTITTAGGYRVYQWTTSGSITF*
Ga0114979_1024176813300009180Freshwater LakeGIVIIRYADSYTAASNTTGSPNVTVSGGYRVYQFTSSGSITF*
Ga0114979_1032344813300009180Freshwater LakeVVVIRYADSTPAATVVTGSPTVTVSGGYRIYTWTSSGSITI*
Ga0114979_1076486413300009180Freshwater LakeRYADTYAAATATTGSPTITVAGGYRTYKFTGDGSITF*
Ga0114969_1016124843300009181Freshwater LakeGIVIIRYADTFPAATANTGSPTITVAGGYRVYKWTTVGNGSITF*
Ga0114969_1037342843300009181Freshwater LakeGIVIIRYANTFTKTPTTTGSPSTVNTGGYIYYTWTGNGSIVF*
Ga0114976_1045278713300009184Freshwater LakeIIRYADTYPAATSTTGSPTITTGGGYRVYQWTSSGSITF*
Ga0114971_1002578073300009185Freshwater LakeGGSGIVIIRYADTYAAATSTTGSPDITVAGGYRVYKWTTVGTWSITF*
Ga0114971_1079052613300009185Freshwater LakeDTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF*
Ga0114964_1018323333300010157Freshwater LakeIRYSDSYAAASATTGSPTITITNGYRYYAFTSSGSITF*
Ga0114967_1006493113300010160Freshwater LakeGGSGIVIIRYADTYPAATATTGSPTITVAGGYRVYSWASSGSLTL*
Ga0114967_1015773533300010160Freshwater LakeVILRYPDTFRAATSTTGSPTITVAGGFRVYQFTASGSITF*
Ga0136656_115402833300010318Freshwater To Marine Saline GradientSSKPEATSTTGSPTVSVANGYRVYKWTGSGSITF*
Ga0136644_1061165713300010334Freshwater LakeYADSYAAATSTTGSPTITVAGGYRVYKFTDNGTITF*
Ga0129333_1010670513300010354Freshwater To Marine Saline GradientDTYDAAVSTTGSPTITVAGGYRVYKWTGSGSITF*
Ga0129333_1012969413300010354Freshwater To Marine Saline GradientDTFTAAASTTGSPTITVSGGYRIYKWTGSGSITF*
Ga0129336_1026611313300010370Freshwater To Marine Saline GradientIIRYADSYAAATSTTGSPTITVSGGYRIYQWTGNGSITF*
Ga0133913_1077518433300010885Freshwater LakeVIIRYSNIYPEAASATGTYTITIKDGYRIYRWTSSGSITF*
Ga0133913_1082245863300010885Freshwater LakeGIVIIRYPDTFALATSSTGSPTITTANGWRLYVWTASGTITI*
Ga0133913_1086672213300010885Freshwater LakeDSYAAATSTTGSPTITVAGGYRVYKFTDNGTITF*
Ga0133913_1181016413300010885Freshwater LakeGIVIIRYPDTYDAASATTGSPTVTVTGGYRIYKWTSSGSITF*
Ga0133913_1230337333300010885Freshwater LakeIIRYADTFTAATSTTGSPTTIVTGGYRYYKFTSSGSITF*
Ga0133913_1244901433300010885Freshwater LakeIVIIRYADTYDAATSTTGSPSIVVSGGYRTYTFTSSGSITF*
Ga0153799_106958313300012012FreshwaterVIIRYADSFAAATSTTGSPTITVAGGYRVYQWTSSGSITF*
Ga0153805_102529523300012013Surface IceIVIIRYSDAYALATSTTGSPLITTTGGYNIYKFTTSGSITF*
Ga0153805_108835023300012013Surface IceDTSAAATATTGSPTITVAGGYRVYKFTSSGSITF*
Ga0157203_101745213300012663FreshwaterIRYPDSNPAATATTGSPTITVSGGYRIYQWTASGSITF*
Ga0157210_102049643300012665FreshwaterIILRHLDSLPAASATTGSPTITVAGGYRIYQFTASGSITF*
Ga0160423_1052430913300012920Surface SeawaterVVIFRYNDAFGTLTSTTGSPTITTSGGYRYYKYTGSGGVTI*
Ga0164293_1106435713300013004FreshwaterILQYPDSYAAATTSGSPNVTVSGGYRTYRFWQSGTITF*
Ga0164292_1065512413300013005FreshwaterYPDTFAAATSTTGSPTITVTGGYRIYKYTGSGTFTF*
Ga0164294_1033358323300013006FreshwaterIRYPDSYAAATATTGSPTITVAGGYRIYAWTSSGSITF*
Ga0177922_1052196133300013372FreshwaterVIIRYADTFSAASSTTGSPTITVTGGYRYYTWTGSGSITF*
Ga0177922_1077140713300013372FreshwaterADTYSAATATTGSPTITVTGGYRVYKWTGNGTITF*
Ga0181338_100475753300015050Freshwater LakeRYADTFAAATSTTGSPTITVAGGYRVYQWTSSGSITF*
Ga0181339_101229513300017700Freshwater LakeYSDAYDAATSTTGSPTITTSGGFRYYTFTATGTITF
Ga0181339_101390323300017700Freshwater LakeIVIIRYADTYGAATSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0181339_103201333300017700Freshwater LakeIVILRYPDTFRAATSTTGSPTITVAGGFRVYQFTANGSITF
Ga0181364_101694713300017701Freshwater LakeIVVIRYADSFPAASATTGSPTITVAGGYRVYKWTSSGSVTF
Ga0181350_100303483300017716Freshwater LakeIIRYADTYNAASSTTGSPTIAVTGGYRIYTFTGTGSITF
Ga0181350_114119513300017716Freshwater LakeYPDTFIAATSTTGSPTITVAGGFRVYQFTANGSITF
Ga0181350_115067913300017716Freshwater LakeSGIVIIRYADSFAAASATTGSPTITVAGGYRIYQWTSSGSITF
Ga0181352_110648523300017747Freshwater LakeVIIRYADSFAAAVSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0181356_111791133300017761Freshwater LakeYADTYAAANATTGTPTITVAGGYRKYTWTGNGSITF
Ga0181343_104620533300017766Freshwater LakeRYPDSYVAATSTTGSPTITVAGGYRVYNFASSGSITF
Ga0181343_111154713300017766Freshwater LakeIVIIRYADTYPAATSTTGSPTITVSGGYRVYKFTGSGSITF
Ga0181358_123551723300017774Freshwater LakeVVIRYADTFAAATATTGSPTITVAGGYRVYQWTSSGSITF
Ga0181357_1000677153300017777Freshwater LakeVIIRYADTYGAATTTTGSPTITVAGGYRVYKWTGSGTITF
Ga0181357_101465413300017777Freshwater LakeGSGIVIIRYADTYDAATSTTGSPTITVAGGYRVYSWAGSGSITI
Ga0181346_128368823300017780Freshwater LakeGSGIVIIRYADTFAAAASSTGSPKITVSGGYRIHTWTSSGSITI
Ga0181348_108683833300017784Freshwater LakeRYADTFAAATSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0181355_103136513300017785Freshwater LakeYPDTFIAATSTTGSPTITVAGGFRVYKWTSSGSITF
Ga0181355_124732613300017785Freshwater LakeRYADTFTAAASTTGSPTITVSGGFRTYSWTGSGSITF
Ga0181355_131988513300017785Freshwater LakeIRYADTYNAATSTTGSPTITVAGGYRVYKWTASGSITF
Ga0181355_136104813300017785Freshwater LakeLIIRYGANYAAAQSTTGSPTITVAGGYRVYEWTGSGSITF
Ga0181355_136792733300017785Freshwater LakeGVVIIRYPDSFKLATSSTGSPTITTANGFRVYQWTSSGSITF
Ga0181600_1020989923300018036Salt MarshPEGLVAATSTTGSPDIFTAGGYKYYIFKQNGSITW
Ga0181591_1105384933300018424Salt MarshILRYPSSMGEVTSTVGSPTTTTSGGYIYYTFTGSGSITF
Ga0211732_150920213300020141FreshwaterIIRYADTYAAASSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0211736_1052373513300020151FreshwaterPVVDVAATSTTGSPTITVAGGYRVYKFTASGSITF
Ga0211736_1061037523300020151FreshwaterSGLVQIRYPDSYAAPNATTGSPSATTNTEYRTYTWTGNGSITF
Ga0211734_1128645823300020159FreshwaterRYADTFPAATSTTGNPVITVSGGYRIYKWISSGTITF
Ga0211726_1036006413300020161FreshwaterVILRYADTYPPLLGTTGSPTITVSGGYRIYKWTSTGSATI
Ga0211735_1006636513300020162FreshwaterYADSYSAASNTTGSPNVIIDGGYRIYVWTTSGTITF
Ga0194124_1012425063300020196Freshwater LakeGIVIIAYPDSYAAATSTTGSPTVVVSGGYRRYTFTGNGSITF
Ga0211731_1015405513300020205FreshwaterVIIRYADTYPVATSTTGSPTITTAGGYRVYQWTTSGSITF
Ga0208364_105687513300020533FreshwaterYPDTFAAATSTTGSPTVATSGGYRKYTFTGDGSITF
Ga0194048_1014609013300021519Anoxic Zone FreshwaterIRYADTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF
Ga0222713_1069111013300021962Estuarine WaterSGIVIIRYADTFAAATATTGSPTITVAGGYRVYQWTSSGSITF
Ga0181353_109840213300022179Freshwater LakeVVIIRYSSIYAPAASTSGSPTVTISGGYRIYQWTGNGSIKF
Ga0196905_113323413300022198AqueousSDTYPAATSTTGSPTITNTGGYRIYKFTGSGSITF
Ga0181351_108652113300022407Freshwater LakeYADSFAAATSTTGSPTITVTGGYRIYQWTSSGSITF
Ga0214917_1042475123300022752FreshwaterVIIRYSDTYAAATSTTGSPTITVSGGYRTYKFTDNGSITF
Ga0255769_1027057443300022927Salt MarshADSYAAATATTGSPTITVAGGYRVYSWAGSGTITF
Ga0214923_1013754733300023179FreshwaterGSGIVLIRYSDTYPAATSTTGSPSTITSGGYRYYKFTGDGSITF
Ga0214919_1023109633300023184FreshwaterIRYAVDYKAATATTGSPTVTVADGYRVYKWTSSGSITF
Ga0244775_1018295343300024346EstuarineLRYADTYSAAIATTGSPTYTTSGGYRVYTFTSSGSITF
Ga0244775_1121928313300024346EstuarineGIVSIRYSDSFTAAAATSGSPTYVVSGGFRTYTWTGDGSITF
Ga0244775_1153482523300024346EstuarineYPDAFPLATSTTGSPTVTNPTGYRVYTFTASGSITF
Ga0244776_1036453313300024348EstuarineYPDSWLAAASTTGSPTVTVSGGYRIYKFTASGSITF
Ga0255164_103242313300024495FreshwaterIRYPSSYDAASSTTGSPTYTVSGGYRIYQWTGSGSITF
Ga0255176_108586223300024507FreshwaterYPSSFPAATSTTGSPTVSTSSRPGYRVYTFTGSGSITF
Ga0208877_104629713300025416FreshwaterISYPNTYPAASSTTGSPSIVNTGGNRIYTWTSSGSITF
Ga0208248_101396913300025595FreshwaterVILSYPSLYPAATSTTGSPTITTASGYRIYTWTGNGSITF
Ga0208613_113485723300025616FreshwaterVIIRYPSGYAAASATTGSPTINVSGGYRTYIWTSSGSITF
Ga0208019_118621223300025687AqueousVVRYSDDYAAATTTGSPTYTVSGGFRIYKFTGSGSIRWG
Ga0209310_104851353300025715Anaerobic Digestor SludgeVVIIRYPDTYDAAIATTGSPTVTVTGGYRIYQWTASGSITF
Ga0255073_108172313300027135FreshwaterGRVILRYPDSFPAASATTGSPGVSVSGGYRIYNFSGTGSITL
Ga0208951_109300113300027621Freshwater LenticGIVIIRYLSGYDAAASTTGATVTVAGGYRIYQWANSGSITF
Ga0208133_100720613300027631EstuarineVIIRYADTYAAASSTTGSPTITTAGGYRVYQWTSSGSITF
Ga0208133_101187053300027631EstuarineIIRYPDSYPLATSAPGASVSTTGGYRIYQWTSSGSITF
Ga0208133_107596513300027631EstuarineIIRYLDTYLPASSTTGSPTYTVVNGYRVYKFTASGSITF
Ga0208960_111626613300027649Freshwater LenticVIIIRYPDTYLAATSTTGSPTVTVTGGYRIYKWTGSGSITI
Ga0208975_100053313300027659Freshwater LenticGIVIIRYADTYAAATTTTGSPTITVAGGYRVYKWTGSGTITF
Ga0209769_101739313300027679Freshwater LakeRYADTFPAATSTTGSPTITVSGGYRIYKWTSSGSITL
Ga0209033_105929413300027697Freshwater LakeRYPSTGNTNAASTTGSPSFVESGGYKYYKFTGTGSITF
Ga0209499_117037533300027712Freshwater LakeIRYSDSFSAASSTTGSPTITVAGGYRVYKFTDNGTITF
Ga0209499_131926123300027712Freshwater LakeIRYPDSYSAAASTTGSPTVTVTGGYRIYKWTGNGSITF
Ga0209442_105351913300027732Freshwater LakeGIVIVRYADTYPAATATTGSPTITTSGGFRIYVWTSSGSITI
Ga0209597_138558623300027746Freshwater LakeDTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF
Ga0209189_141161113300027747Freshwater LakeSDSYAAASATTGSPTITITNGYRYYAFTSSGSITF
Ga0209296_115120113300027759Freshwater LakeTYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF
Ga0209296_139709913300027759Freshwater LakeAGIVIVTYPDSYPAAASTTGSPTITVTNGFRYYAFTSSGSITF
Ga0209088_1017773223300027763Freshwater LakeVVIRYADSTPAATVVTGSPTVTVSGGYRIYTWTSSGSITI
Ga0209088_1033225713300027763Freshwater LakeLDTYAVASSTTGSPTITVAGGYRIYKFTSSGSITF
Ga0209086_1005435513300027770Freshwater LakeLDGYKAATSTTGSPNVIVSGGYRTYIWTSSGSITF
Ga0209768_1008553013300027772Freshwater LakeDTFDAALSTTGSPTITQTGGYRIYKWLSGTGSVTF
Ga0209500_1019723513300027782Freshwater LakeRYADTYPAATSTTGSPTITTGGGYRVYQWTSSGSITF
Ga0209246_1030530823300027785Freshwater LakeIVILRYADTFDAATATTGSPTITVAGGYRVYKFTSSGSITF
Ga0209972_1002176843300027793Freshwater LakeYADSYPAATTTGSPTVTVSGGFRVYVFNASGSITF
Ga0209972_1024664033300027793Freshwater LakeIRYADSFPAATSTTGSPTTVTSGGYRYYKWTGSGSITF
Ga0209107_1023829913300027797Freshwater And SedimentYADTYPAATATTGSPDITVAGGYRVYKWTTVGSWSVTF
Ga0209353_1036221813300027798Freshwater LakeVIIRYADSYPAATSTTGSPTITVSGGYRIYQWTSSGSITF
Ga0209229_1001339213300027805Freshwater And SedimentIVVIRYADTYGVATSTTGSPTVTTAGGYRVYKWTSSGSITF
Ga0209354_1022065333300027808Freshwater LakeYLATYNAATATTGSPTVTIINGYRIYTWSTTGSGSITF
Ga0209354_1026702913300027808Freshwater LakeYADTYDAAASTTGSPTITVAGGYRVYKFTSSGTITF
Ga0209354_1044418713300027808Freshwater LakeYADTYSAATATTGSPAITVSGGYRVYMFTSSGTITF
Ga0209777_1049151913300027896Freshwater Lake SedimentGVVIISYPDSYPAASATTGSPTITVAGGYRVYIWTSSGSITF
Ga0209668_1049659613300027899Freshwater Lake SedimentSGNGGSGGSGIVIIRYADTFAAATTTVGSPTITVAGGYRVYKFTGTGSITF
Ga0209668_1102118613300027899Freshwater Lake SedimentVRIQYSDTFSAAASTTGSPTYSVSGGLRIYTWYNNGSITW
Ga0209400_102811323300027963Freshwater LakeIKVPVTAVSTTGSPTVVNSGGFNYYKFTASGSITF
Ga0209400_116050713300027963Freshwater LakeVIIRYSDAYAAATATTGSPTITVAGGYRVYKWTTVGTWSITF
Ga0209299_104862543300027974Freshwater LakeGGSGIVIIRYASTYPAATSTTGSPATVVTGGYRYYTWTGSGSITL
Ga0247723_116619813300028025Deep Subsurface SedimentSGVVIIRYADSFAAATATTGSPTITVTGGYRIYQWNSSGSITF
Ga0256331_113399823300028286FreshwaterVIAYPSSFPAATSTTGSPTVSTSSRPGYRVYTFTGSGSITF
Ga0304730_116030223300028394Freshwater LakeIRYSDAYAAATATTGSPTITVAGGYRVYKWTTVGTWSITF
Ga0304730_122629013300028394Freshwater LakeIRYADTSAAATATTGSPTITVAGGYRVYQWTSSGSITF
Ga0304730_133078013300028394Freshwater LakeYPDAYSLATSTTGSPTVTTEGGYRIYTFTATGSIGW
Ga0315909_1054111913300031857FreshwaterSGTVIIRTANTDPVGTATGSPTITTAGGYRLYQWTAVGTWSITF
Ga0315274_1194495923300031999SedimentIRYADTFAAAASTTGSPTITVAGGYRVYNWTGSGSITF
Ga0315906_1049750723300032050FreshwaterGASGFVAIRYSDTYELARSTTGSPTITTSGGYRIYQWTGSGTIRF
Ga0315903_1073749923300032116FreshwaterLRYPDTFRAATSTTGSPTITVAGGFRVYQFTANGSITF
Ga0315277_1167777923300032118SedimentGSGIVIIRYADTYNAATSTTGSPTITVAGGYRVYKWTASGTITF
Ga0315283_1229016713300032164SedimentIRYADTYQAATSTTGSPTVTVAGGYRVYQWTASGTITF
Ga0334982_0000093_42806_429283300033981FreshwaterMIIRYLESYQAAVSTTGSPTVTTSGGYRIYTWTASGSITF
Ga0334982_0000880_2828_29473300033981FreshwaterMLIRYPDAYRPATTTGSPTITVSGGYRIYKFTGNGSITF
Ga0334982_0013593_2219_23443300033981FreshwaterVVIIRYPDSYAAATSTTGSPTITVSGGYRTYTFTGNGTITF
Ga0334992_0000029_135676_1357923300033992FreshwaterMRYPDAYLAATSTTGSPTITNPTGYRVYTFTASGSITF
Ga0334992_0333570_593_7003300033992FreshwaterADSYASATATTGSPNVTIAGGYRIYKWTSSGSITF
Ga0334994_0031472_2330_24523300033993FreshwaterMIIRYADTFTAAASTTGSPTITVSGGYRIYKWTGSGSITF
Ga0334996_0265361_357_4793300033994FreshwaterMIIRYPDSFSEAVATTGSPSVTVSGGYRIYQWTGSGSITF
Ga0334979_0002114_11783_119083300033996FreshwaterMVVIRYLDTYPAATSTTGSPSITTSGGYRIYQWTGSGSITI
Ga0334986_0000667_15485_156073300034012FreshwaterMIIRYEDIYPAAASTTGSPSVSVTGGYRIYTWTGSGSITF
Ga0334986_0078983_1111_12333300034012FreshwaterMIIRYSDAFAPATSTTGSPTYTVSGGNNIYVFNASGSITF
Ga0334991_0139074_994_11193300034013FreshwaterIVIIRYADSYPAATSTTGSPTITTAGGYRVYKWTSSGSITF
Ga0334998_0182792_3_1103300034019FreshwaterADTFAAATATTGSPTYTVAGGYRIYKFTGSGSITW
Ga0335005_0022229_2546_26713300034022FreshwaterMVIIRCSSSLPVLAGTTGSPTITVSGGYRIYKFTTSGSITF
Ga0335005_0203811_1_1143300034022FreshwaterRYADSTAEASSTTGSPTITVAGGYRVYKWTSSGSITF
Ga0335021_0408995_224_3463300034023FreshwaterMVIRYPDSIAAATSTTGSPTITVSGGYRIYSYTSTGTFVL
Ga0334995_0003523_11648_117643300034062FreshwaterMRYSDSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF
Ga0334995_0025474_588_7103300034062FreshwaterMIIRYPDSFSAAVATTGSPSVTVSGGYRIYQWTGSGSITF
Ga0334995_0030478_3276_33983300034062FreshwaterMIVRYADTYPAATATTGSPTITTSGGFRIYVWTSSGSITI
Ga0334995_0186066_1340_14593300034062FreshwaterMVRYSDAFAAAASTTGSPTVTVSGGYRVYTWTASGSITW
Ga0334995_0632618_399_5213300034062FreshwaterMIIRYSDAFEAASSTTGSPTITVSGGYRIYQWTSSGSITF
Ga0310130_0006583_2624_27493300034073Fracking WaterMVVIRYPSTLPLATSTTGSPTVTTSGGYRIYQWTSNGSITF
Ga0335020_0067796_444_5513300034082FreshwaterMDSYPAATSTTGSPTITVSGGYRIYKWITSGSITF
Ga0335020_0103096_511_6333300034082FreshwaterMIIRYADTFAAATSTTGSPTITTAGGYRVYQWTSSGSITF
Ga0335010_0442904_579_6983300034092FreshwaterILRYPDTNAAATSITGSPTVTVAGGYRVYKWTSSGSITF
Ga0335012_0403258_535_6663300034093FreshwaterSGFVAIRYSDTFPLATSTTGSPSITTAGGYRIYQWTSSGTITF
Ga0335029_0239554_370_4983300034102FreshwaterVIIAYPDSFPAAVSTTGSPTVSLVSRAGYRVYTFTGSGSITF
Ga0335036_0005173_10608_107303300034106FreshwaterMIIRYPDTYAAATSTTGSPTITTTGGYRIYKWTGNGSITF
Ga0335036_0012902_5080_52023300034106FreshwaterMIIRYADSFAAAASTTGSPTITVSGGFRTYLWTGNGSITF
Ga0335036_0148360_517_6393300034106FreshwaterMVIRYASSFAAALSTTGSPTVTVAGGYRVYTWTGSGSITF
Ga0335036_0306159_3_1313300034106FreshwaterGVVIIRYADTFPAATTTTGSPEVTTAGGFRIYRWTSSGSITF
Ga0335036_0465291_2_1093300034106FreshwaterPDTFSLAISTTGSPTVTNPTGYRVYTFTASGSITF
Ga0335036_0581960_107_2293300034106FreshwaterMIIRYADSAPAAASTTGSPTVTVAGGYRVYKWTGSGSITF
Ga0335050_0078444_2_1213300034108FreshwaterIIRYLDSYPAATSTTGSPTITVSGGYRIYQWTTSGSITF
Ga0335050_0078807_1837_19623300034108FreshwaterIVIIRYADTYPAATSTTGSPTITVAGGYRVYKWTSSGSITF
Ga0335050_0414168_2_1453300034108FreshwaterAGGGSGVVILRYPDSYALASSTTGTISTVQSGGYRYYTFTSSGSITF
Ga0335063_0368923_180_3023300034111FreshwaterMIIRYADTYAAATSTTGSPTITVAGGYRVYSWTGSGSITF
Ga0335033_0605652_395_5083300034117FreshwaterRYPDAYSLATSTTGSPTVTTAGGYRIYTFTSTGSIGW
Ga0335053_0533983_561_6863300034118FreshwaterIVIIRYPDTYPAAASYTGSPTITNPTGYRVYKFTGDGTITF
Ga0335056_0015577_3552_36773300034120FreshwaterMVIIRYPDNFVLASATTGSPTVSNPTGYRVYTFTSSGSITF
Ga0335058_0206805_1038_11453300034121FreshwaterVDSYPAATSTTGSPTITVSGGYRVYKYTSSGSITF
Ga0335060_0026858_3651_37673300034122FreshwaterVRYADSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF
Ga0335065_0455447_3_1163300034200FreshwaterIRYADKYLAAKSTTGATITVAGGYRVYTWTSSGTITF
Ga0335049_0009481_2603_27253300034272FreshwaterMIVRYPDTFPLASATTGSPTITNPTGYRVYTFTASGSITF
Ga0335013_0682281_3_1373300034284FreshwaterGGSGIVIIRHVDTFPLATTTGSVAVTSSGGYRTYKFTGNGSITF
Ga0335039_0455353_240_3653300034355FreshwaterMVIIRYADTFAAATSTTGSPTLTVTGGYRIYQWASSGSITF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.