NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019315

Metagenome / Metatranscriptome Family F019315

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019315
Family Type Metagenome / Metatranscriptome
Number of Sequences 230
Average Sequence Length 44 residues
Representative Sequence PLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAG
Number of Associated Samples 201
Number of Associated Scaffolds 230

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.17 %
% of genes near scaffold ends (potentially truncated) 97.83 %
% of genes from short scaffolds (< 2000 bps) 90.43 %
Associated GOLD sequencing projects 191
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.565 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.609 % of family members)
Environment Ontology (ENVO) Unclassified
(23.913 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.29%    β-sheet: 14.49%    Coil/Unstructured: 65.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 230 Family Scaffolds
PF00152tRNA-synt_2 10.43
PF13556HTH_30 6.52
PF00486Trans_reg_C 3.91
PF00128Alpha-amylase 3.48
PF01336tRNA_anti-codon 2.61
PF132794HBT_2 2.17
PF01741MscL 1.74
PF06445GyrI-like 1.74
PF01828Peptidase_A4 1.74
PF02687FtsX 1.74
PF08241Methyltransf_11 1.74
PF13676TIR_2 1.74
PF02771Acyl-CoA_dh_N 1.30
PF09660DUF2397 1.30
PF00582Usp 0.87
PF00571CBS 0.87
PF00892EamA 0.87
PF13560HTH_31 0.87
PF00406ADK 0.87
PF06689zf-C4_ClpX 0.87
PF02518HATPase_c 0.87
PF12840HTH_20 0.87
PF12697Abhydrolase_6 0.87
PF08240ADH_N 0.87
PF13231PMT_2 0.87
PF13669Glyoxalase_4 0.87
PF02515CoA_transf_3 0.87
PF00501AMP-binding 0.43
PF01614IclR 0.43
PF07728AAA_5 0.43
PF01443Viral_helicase1 0.43
PF16326ABC_tran_CTD 0.43
PF00440TetR_N 0.43
PF13472Lipase_GDSL_2 0.43
PF00903Glyoxalase 0.43
PF02625XdhC_CoxI 0.43
PF03729DUF308 0.43
PF00561Abhydrolase_1 0.43
PF10094DUF2332 0.43
PF08450SGL 0.43
PF00589Phage_integrase 0.43
PF01565FAD_binding_4 0.43
PF05988DUF899 0.43
PF12681Glyoxalase_2 0.43
PF08044DUF1707 0.43
PF07883Cupin_2 0.43
PF07730HisKA_3 0.43
PF13411MerR_1 0.43
PF07690MFS_1 0.43
PF02913FAD-oxidase_C 0.43
PF04185Phosphoesterase 0.43
PF03466LysR_substrate 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 230 Family Scaffolds
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 10.43
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 10.43
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 10.43
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 10.43
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 3.48
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 3.48
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 3.48
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 3.48
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 1.74
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.30
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.87
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.87
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.43
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.43
COG1975Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF familyPosttranslational modification, protein turnover, chaperones [O] 0.43
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.43
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.43
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.43
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.43
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.43
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.43
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.43
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.43
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.57 %
UnclassifiedrootN/A20.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2032320005|FACEOR_FY84VJD01DN3YBAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300002245|JGIcombinedJ26739_101874156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300004092|Ga0062389_103987789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300005177|Ga0066690_10808262All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300005339|Ga0070660_100084306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2497Open in IMG/M
3300005366|Ga0070659_100068331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2818Open in IMG/M
3300005435|Ga0070714_101017303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300005435|Ga0070714_101105664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia772Open in IMG/M
3300005435|Ga0070714_101478867All Organisms → cellular organisms → Bacteria → Terrabacteria group663Open in IMG/M
3300005446|Ga0066686_10030947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3122Open in IMG/M
3300005457|Ga0070662_100997474All Organisms → cellular organisms → Bacteria → Terrabacteria group717Open in IMG/M
3300005468|Ga0070707_101657804All Organisms → cellular organisms → Bacteria → Terrabacteria group606Open in IMG/M
3300005536|Ga0070697_100915966All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300005538|Ga0070731_10862894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300005547|Ga0070693_100037925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2690Open in IMG/M
3300005548|Ga0070665_100120328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2627Open in IMG/M
3300005587|Ga0066654_10251641All Organisms → cellular organisms → Bacteria → Terrabacteria group932Open in IMG/M
3300005610|Ga0070763_10202160All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300005764|Ga0066903_107771127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300005764|Ga0066903_108107045Not Available538Open in IMG/M
3300005843|Ga0068860_100624001Not Available1085Open in IMG/M
3300005921|Ga0070766_10243270Not Available1139Open in IMG/M
3300005921|Ga0070766_10317330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1004Open in IMG/M
3300006034|Ga0066656_10398391All Organisms → cellular organisms → Bacteria → Terrabacteria group891Open in IMG/M
3300006050|Ga0075028_100290350All Organisms → cellular organisms → Bacteria → Terrabacteria group909Open in IMG/M
3300006603|Ga0074064_11792528All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300006854|Ga0075425_100523960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1364Open in IMG/M
3300006914|Ga0075436_101478908All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009098|Ga0105245_12647581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300009143|Ga0099792_10953773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300009521|Ga0116222_1310147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300009522|Ga0116218_1266970All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300009523|Ga0116221_1287026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia712Open in IMG/M
3300009525|Ga0116220_10202279Not Available861Open in IMG/M
3300009683|Ga0116224_10284514Not Available787Open in IMG/M
3300009824|Ga0116219_10378367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300010333|Ga0134080_10326148All Organisms → cellular organisms → Bacteria → Terrabacteria group694Open in IMG/M
3300010360|Ga0126372_10296226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1419Open in IMG/M
3300010366|Ga0126379_11133442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia888Open in IMG/M
3300010373|Ga0134128_10529950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1313Open in IMG/M
3300010373|Ga0134128_10726990All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300010375|Ga0105239_10382052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1592Open in IMG/M
3300010379|Ga0136449_103644020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300010396|Ga0134126_10064965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4538Open in IMG/M
3300010397|Ga0134124_10418874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1278Open in IMG/M
3300010397|Ga0134124_11233882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia769Open in IMG/M
3300010401|Ga0134121_10319569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1380Open in IMG/M
3300010876|Ga0126361_10682725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300010880|Ga0126350_10997472Not Available703Open in IMG/M
3300011119|Ga0105246_11923030All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300012189|Ga0137388_11256408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria679Open in IMG/M
3300012211|Ga0137377_11775025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300012353|Ga0137367_10659791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia730Open in IMG/M
3300012357|Ga0137384_10418326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1106Open in IMG/M
3300012481|Ga0157320_1030688All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300012915|Ga0157302_10092012All Organisms → cellular organisms → Bacteria → Terrabacteria group941Open in IMG/M
3300012984|Ga0164309_11174731All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300012985|Ga0164308_12277353All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300013104|Ga0157370_10286359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1522Open in IMG/M
3300013105|Ga0157369_11274082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia749Open in IMG/M
3300013297|Ga0157378_11671594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300014154|Ga0134075_10043208Not Available1852Open in IMG/M
3300014201|Ga0181537_11217029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300014493|Ga0182016_10473586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300015242|Ga0137412_11003572All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300016270|Ga0182036_11008071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300016270|Ga0182036_11034096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300016270|Ga0182036_11928964Not Available501Open in IMG/M
3300016294|Ga0182041_11966328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300016341|Ga0182035_11857765Not Available546Open in IMG/M
3300016387|Ga0182040_10768067Not Available792Open in IMG/M
3300016422|Ga0182039_11811081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300017926|Ga0187807_1270270All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300017932|Ga0187814_10087568Not Available1145Open in IMG/M
3300017937|Ga0187809_10176191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales750Open in IMG/M
3300017942|Ga0187808_10535892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium544Open in IMG/M
3300017955|Ga0187817_10317985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium993Open in IMG/M
3300017959|Ga0187779_11191099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300017970|Ga0187783_10208739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1433Open in IMG/M
3300017970|Ga0187783_10345603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1083Open in IMG/M
3300017970|Ga0187783_11359874Not Available512Open in IMG/M
3300017972|Ga0187781_10081445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus2236Open in IMG/M
3300017972|Ga0187781_10445395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300017973|Ga0187780_10235488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1281Open in IMG/M
3300017973|Ga0187780_10740748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300017993|Ga0187823_10096050Not Available880Open in IMG/M
3300017995|Ga0187816_10417238Not Available598Open in IMG/M
3300018034|Ga0187863_10295217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia901Open in IMG/M
3300018042|Ga0187871_10071312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2041Open in IMG/M
3300018058|Ga0187766_10592946All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300018086|Ga0187769_10499855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium917Open in IMG/M
3300018090|Ga0187770_11124485All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300018482|Ga0066669_11026956All Organisms → cellular organisms → Bacteria → Terrabacteria group744Open in IMG/M
3300020076|Ga0206355_1247613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii908Open in IMG/M
3300020580|Ga0210403_10366234Not Available1179Open in IMG/M
3300020610|Ga0154015_1616901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300021170|Ga0210400_11443959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300021171|Ga0210405_10815885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. DC12714Open in IMG/M
3300021181|Ga0210388_10858739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia784Open in IMG/M
3300021403|Ga0210397_10307586All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300021406|Ga0210386_10519885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1029Open in IMG/M
3300021407|Ga0210383_11518019All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300021432|Ga0210384_10229440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1671Open in IMG/M
3300021477|Ga0210398_11221047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300021478|Ga0210402_10769464Not Available887Open in IMG/M
3300021478|Ga0210402_11920973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300021560|Ga0126371_12174400All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300022529|Ga0242668_1158044Not Available503Open in IMG/M
3300024288|Ga0179589_10192828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales888Open in IMG/M
3300024290|Ga0247667_1062059All Organisms → cellular organisms → Bacteria → Terrabacteria group691Open in IMG/M
3300024331|Ga0247668_1022130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1314Open in IMG/M
3300025898|Ga0207692_10033503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2479Open in IMG/M
3300025900|Ga0207710_10471251Not Available650Open in IMG/M
3300025910|Ga0207684_10086923Not Available2663Open in IMG/M
3300025912|Ga0207707_11223699All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300025922|Ga0207646_11151619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum681Open in IMG/M
3300025927|Ga0207687_10102174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2112Open in IMG/M
3300025928|Ga0207700_11281569Not Available653Open in IMG/M
3300025941|Ga0207711_11203527Not Available699Open in IMG/M
3300026041|Ga0207639_10142861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1996Open in IMG/M
3300026041|Ga0207639_11071708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300026095|Ga0207676_10046051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3373Open in IMG/M
3300026142|Ga0207698_10993277All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300026281|Ga0209863_10170316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300026326|Ga0209801_1317178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300027080|Ga0208237_1072329All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300027096|Ga0208099_1018543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia967Open in IMG/M
3300027096|Ga0208099_1045544All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300027158|Ga0208725_1017688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. USK101165Open in IMG/M
3300027166|Ga0208729_111659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300027334|Ga0209529_1007892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1729Open in IMG/M
3300027680|Ga0207826_1064437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1011Open in IMG/M
3300027703|Ga0207862_1086075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300027725|Ga0209178_1152432All Organisms → cellular organisms → Bacteria → Terrabacteria group799Open in IMG/M
3300027824|Ga0209040_10266336Not Available851Open in IMG/M
3300027854|Ga0209517_10012991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8751Open in IMG/M
3300027869|Ga0209579_10586244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300027895|Ga0209624_10295138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1079Open in IMG/M
3300027905|Ga0209415_10137879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2503Open in IMG/M
3300027905|Ga0209415_10711389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia717Open in IMG/M
3300028281|Ga0247689_1067851All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300028720|Ga0307317_10346742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300028759|Ga0302224_10242779All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300028773|Ga0302234_10150059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae1015Open in IMG/M
3300028884|Ga0307308_10366453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium690Open in IMG/M
3300028906|Ga0308309_11061822All Organisms → cellular organisms → Bacteria → Terrabacteria group701Open in IMG/M
3300029951|Ga0311371_10437840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1757Open in IMG/M
3300029999|Ga0311339_11765617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300030013|Ga0302178_10307021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium728Open in IMG/M
3300030494|Ga0310037_10308613All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300030617|Ga0311356_11824720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300030618|Ga0311354_10551591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1129Open in IMG/M
3300030677|Ga0302317_10291003All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300030730|Ga0307482_1060519Not Available948Open in IMG/M
3300031028|Ga0302180_10402649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300031170|Ga0307498_10132635All Organisms → cellular organisms → Bacteria → Terrabacteria group807Open in IMG/M
3300031233|Ga0302307_10053533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2150Open in IMG/M
3300031236|Ga0302324_102143499All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300031544|Ga0318534_10600662Not Available625Open in IMG/M
3300031546|Ga0318538_10375277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii769Open in IMG/M
3300031549|Ga0318571_10110705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300031549|Ga0318571_10206088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300031561|Ga0318528_10462579Not Available681Open in IMG/M
3300031572|Ga0318515_10094570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1562Open in IMG/M
3300031680|Ga0318574_10642425Not Available622Open in IMG/M
3300031681|Ga0318572_10154184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1328Open in IMG/M
3300031708|Ga0310686_100233994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium vinaceum500Open in IMG/M
3300031708|Ga0310686_102739469Not Available2250Open in IMG/M
3300031708|Ga0310686_106733244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300031708|Ga0310686_106910319Not Available521Open in IMG/M
3300031708|Ga0310686_113880783Not Available653Open in IMG/M
3300031708|Ga0310686_114312042Not Available667Open in IMG/M
3300031713|Ga0318496_10113539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1461Open in IMG/M
3300031718|Ga0307474_10390597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1082Open in IMG/M
3300031719|Ga0306917_10744000Not Available770Open in IMG/M
3300031723|Ga0318493_10043828Not Available2091Open in IMG/M
3300031723|Ga0318493_10802746Not Available530Open in IMG/M
3300031744|Ga0306918_10024256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3732Open in IMG/M
3300031747|Ga0318502_10986298All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031764|Ga0318535_10038328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1957Open in IMG/M
3300031769|Ga0318526_10274343Not Available690Open in IMG/M
3300031771|Ga0318546_10350557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1027Open in IMG/M
3300031782|Ga0318552_10032538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2399Open in IMG/M
3300031797|Ga0318550_10645278Not Available508Open in IMG/M
3300031799|Ga0318565_10377637Not Available687Open in IMG/M
3300031819|Ga0318568_10633877Not Available665Open in IMG/M
3300031831|Ga0318564_10053578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1758Open in IMG/M
3300031832|Ga0318499_10217070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum745Open in IMG/M
3300031846|Ga0318512_10406889All Organisms → cellular organisms → Bacteria → Terrabacteria group684Open in IMG/M
3300031846|Ga0318512_10750243Not Available502Open in IMG/M
3300031890|Ga0306925_11228854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300031894|Ga0318522_10126230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces958Open in IMG/M
3300031896|Ga0318551_10442246Not Available742Open in IMG/M
3300031910|Ga0306923_12121801Not Available566Open in IMG/M
3300031912|Ga0306921_11325046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300031912|Ga0306921_12256154All Organisms → cellular organisms → Bacteria → Terrabacteria group572Open in IMG/M
3300031941|Ga0310912_10648936Not Available820Open in IMG/M
3300031954|Ga0306926_10440382Not Available1606Open in IMG/M
3300032001|Ga0306922_10443294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum1388Open in IMG/M
3300032009|Ga0318563_10120352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum1397Open in IMG/M
3300032010|Ga0318569_10107329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300032039|Ga0318559_10040255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1916Open in IMG/M
3300032043|Ga0318556_10426545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300032044|Ga0318558_10263920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300032044|Ga0318558_10491390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300032065|Ga0318513_10132843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1181Open in IMG/M
3300032068|Ga0318553_10036391Not Available2382Open in IMG/M
3300032074|Ga0308173_11789515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300032076|Ga0306924_10691590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1146Open in IMG/M
3300032076|Ga0306924_12614045Not Available503Open in IMG/M
3300032089|Ga0318525_10468983All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300032090|Ga0318518_10313199Not Available805Open in IMG/M
3300032160|Ga0311301_11101053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1033Open in IMG/M
3300032174|Ga0307470_11338984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300032261|Ga0306920_103230025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300032770|Ga0335085_11196594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia808Open in IMG/M
3300032782|Ga0335082_11371882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300032783|Ga0335079_10940641All Organisms → cellular organisms → Bacteria → Terrabacteria group885Open in IMG/M
3300032805|Ga0335078_10149970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3299Open in IMG/M
3300032805|Ga0335078_11397136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300032828|Ga0335080_10345409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1606Open in IMG/M
3300032892|Ga0335081_11632471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M
3300032892|Ga0335081_11857204All Organisms → cellular organisms → Bacteria → Terrabacteria group649Open in IMG/M
3300032893|Ga0335069_10094948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3779Open in IMG/M
3300032896|Ga0335075_10327570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1688Open in IMG/M
3300032955|Ga0335076_10556212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1030Open in IMG/M
3300033134|Ga0335073_10928544Not Available912Open in IMG/M
3300033290|Ga0318519_10289202Not Available957Open in IMG/M
3300034163|Ga0370515_0333368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300034199|Ga0370514_075059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium857Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.22%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.04%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.04%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.30%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.30%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.30%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.87%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.87%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.43%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.43%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.43%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.43%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2032320005Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2-EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027166Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEORA_4406002032320005SoilVHHVRFTRADGMFTTQDRERAGLLAKRLGLTVELAG
JGIcombinedJ26739_10187415613300002245Forest SoilLIRQDGLARGGALHHIRFTRTEGSFGAGERERAALLAKRLGVTVELAG*
Ga0062389_10398778923300004092Bog Forest SoilRIRLVREDGLPLGGSLHRVRFTRADGAFSAQDRERTGLLAKRLGLTVELGS*
Ga0066690_1080826233300005177SoilGKRIRLVREEGLPLGGLLHHVRFTRADGMFTTQDRERAGLLAKRLGLTVELAG*
Ga0070660_10008430613300005339Corn RhizosphereREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0070659_10006833153300005366Corn RhizosphereLVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG*
Ga0070714_10101730313300005435Agricultural SoilPGGKRIRLVREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0070714_10110566413300005435Agricultural SoilGKRIRLVREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0070714_10147886713300005435Agricultural SoilKRIRLVREDGLPLGGSLHHVRFTRAEGTFTAQDRERAGLLAKRLGLVVELA*
Ga0066686_1003094743300005446SoilREDGLPLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAR*
Ga0070662_10099747433300005457Corn RhizosphereKRIRLVREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0070707_10165780433300005468Corn, Switchgrass And Miscanthus RhizosphereLPLGGLLHHVRFTCADGSFSAQDRERAGLLAKRLGLTVELSG*
Ga0070697_10091596613300005536Corn, Switchgrass And Miscanthus RhizosphereHEDGLPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG*
Ga0070731_1086289413300005538Surface SoilRADGLPNGGRLHHVRFCRAAGTFSAQDRERAALLAKRLGLTVELGQG*
Ga0070693_10003792513300005547Corn, Switchgrass And Miscanthus RhizosphereGGKRIRLVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG*
Ga0070665_10012032853300005548Switchgrass RhizosphereGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0066654_1025164133300005587SoilKRIRLVREDGLPLGGLLHHVRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0070763_1020216013300005610SoilGKRIRLVREDGLPLGGALHHVRFSRAAGTFSAQDRERAAPLASRLGLTVELAG*
Ga0066903_10777112713300005764Tropical Forest SoilLHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELRG*
Ga0066903_10810704523300005764Tropical Forest SoilHHIRFTRAGGAWSTQDRERAGLLAKRLGVSLELDS*
Ga0068860_10062400113300005843Switchgrass RhizosphereLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0070766_1024327033300005921SoilHVRFTRAEGSFGTGDRERAALLAKRLGVTVELAG*
Ga0070766_1031733013300005921SoilRLVRQDGLARGGALHHVRFSRAEGSFGAADRQRAALLAKRLGVTVELAG*
Ga0066656_1039839133300006034SoilGLPLGGLLHHVRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0075028_10029035033300006050WatershedsRIRLVREDGLPLGGSLHHVRFTRADGAFSGQDSERAGLLAKRLGLTVELAG*
Ga0074064_1179252813300006603SoilEDGLPLGGLLHHVRFSRADGAFSAQDRERAGLLAKRLGLTVELAG*
Ga0075425_10052396033300006854Populus RhizosphereEDGLPLGGSLHHVRFTRAEGTFTAQDRERAGLLAKRLGLAVELT*
Ga0075436_10147890823300006914Populus RhizosphereGLPLGGSLHHVGFTRAAGAFTAQESERASLLAKRLGVGLELGG*
Ga0105245_1264758123300009098Miscanthus RhizosphereREEGLPLGGLLHHVRFTRSGGAFTAQDRERAGLLAKRLGLTVELAD*
Ga0099792_1095377323300009143Vadose Zone SoilEEGLPLGGLLHHVSFTRAGGAFTAQDRERAGLLAKRLGLTVELAG*
Ga0116222_131014723300009521Peatlands SoilIRLVREDGPPLGGSLHHVRFTRADGAFSAQDRERASLLAKRLGLAVELAVTRHSP*
Ga0116218_126697013300009522Peatlands SoilGSLHHVRFTRADGAFSGQDRERAGLLAKRHGLAVELAT*
Ga0116221_128702623300009523Peatlands SoilKDGLPLGGSLHHVRFTRAEGTFSAQDRERAGLLAKRLGLTVELAS*
Ga0116220_1020227913300009525Peatlands SoilGGRLHQVRFTRAAGAFSGQDRERAGLLAKRLGLAVELASGAAGSR*
Ga0116224_1028451413300009683Peatlands SoilRLVRAGGLARGGELHHVRFTRAEGAFAASDHERAGLLGKRLGLTLELAAVSG*
Ga0116219_1037836713300009824Peatlands SoilHVRFTRAEGAFAASDHERAGLLGKRLGLTLELAAVSG*
Ga0134080_1032614813300010333Grasslands SoilPLGGLLHHVRFTRAGAAFSAQDRERAGLLAKRLGLTVELAG*
Ga0126372_1029622633300010360Tropical Forest SoilIRLVREHALPLGGALHHIRFTCAAGAFSAQDRERAGLLAHRLGLTVELAG*
Ga0126379_1113344223300010366Tropical Forest SoilREDGLPLGGGLHHIRFTRAAGAFSTQDRKRAGLLAEHLGLAVELAGTAPT*
Ga0134128_1052995013300010373Terrestrial SoilEDGLPLGGLLHHVCFSRADGSFTAQDRQRAGLLAKRLGLTVELAG*
Ga0134128_1072699033300010373Terrestrial SoilGLPLGGALHHVSFTRTAEEFSAQDRERAGLLAKRLGVGLELGG*
Ga0105239_1038205233300010375Corn RhizosphereLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0136449_10364402023300010379Peatlands SoilIRLVREDGLPLGGSLHHIRFTRADGAFSTHDKERAGLLAKRLGLTVELASP*
Ga0134126_1006496513300010396Terrestrial SoilEDGLPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG*
Ga0134124_1041887413300010397Terrestrial SoilLHHVSFTRTAEEFSAQDRERAGLLAKRLGVGLELGG*
Ga0134124_1123388223300010397Terrestrial SoilVREEGLPLGGLLHHVRFTRSGGAFTTQDRQRAGLLAKRLGLTVELAG*
Ga0134121_1031956933300010401Terrestrial SoilGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG*
Ga0126361_1068272513300010876Boreal Forest SoilGKRIKLVHQDGLPPGGALHHVRFTRAARSFSSQEREHAGLLARHIGLTVELAG*
Ga0126350_1099747213300010880Boreal Forest SoilRRDGLARGGALHHLRFTRAAGRFGAGDRERARILAKRLGVTVELAG*
Ga0105246_1192303033300011119Miscanthus RhizosphereVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG*
Ga0137388_1125640813300012189Vadose Zone SoilEGLPLGGLLHHVGFTRSGGAFTTQNRERAGLLAKRLGLTVELAS*
Ga0137377_1177502523300012211Vadose Zone SoilVRQDGLPLGGALHHVRFARADGAFSAQDRERAALLAKRLGLTVELAR*
Ga0137367_1065979123300012353Vadose Zone SoilGKRIRLVREDGLPLGGLLHHVRFTRADGAFSAQDQERAGLLAKRLGLTVELAG*
Ga0137384_1041832613300012357Vadose Zone SoilVRQDGLPFGGALHHVRFARADGAFGAQDRERAALLAKRLGLTVELAG*
Ga0157320_103068833300012481Arabidopsis RhizosphereLVREDGLPLGGSLHHVRFTRAEGTFGAQDRERAGLLAKRLGLAVELA*
Ga0157302_1009201233300012915SoilEDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLTKRLGLTVELAG*
Ga0164309_1117473113300012984SoilLPLGGGLHHICFTRTAGEFGAQDRERAGLLAKRLGVAVELDG*
Ga0164308_1227735313300012985SoilLGGSLHHIGFSRAAGPFTAQESERASLLAKRLGVGLELGG*
Ga0157370_1028635933300013104Corn RhizosphereVREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0157369_1127408213300013105Corn RhizosphereDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG*
Ga0157378_1167159413300013297Miscanthus RhizosphereVREDGLPLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAG*
Ga0134075_1004320813300014154Grasslands SoilHVRFTRADGGFSSQDRERAGLLAKRLGLTVELAR*
Ga0181537_1121702913300014201BogRIRLVREDGLPLGGALHHVRFTRVTGSFSTEERERANLLAKRLGLTVELSAEPG*
Ga0182016_1047358613300014493BogPLGGVLHRIRFTRTAGAVSAQDAEHAGLLAKRLGLMVDLAG*
Ga0137412_1100357213300015242Vadose Zone SoilGLPLGGLLHHVRFTRSGGAFTTQDRERAGLLAKRLGLTVELAG*
Ga0182036_1100807113300016270SoilLLHHVRFTRTDGTFGAGDQERAALLAKRLGVVVELAS
Ga0182036_1103409623300016270SoilDGLPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG
Ga0182036_1192896413300016270SoilALHHVRFTRTDGTLGTGGTERAALLAKRLGLAVELAS
Ga0182041_1196632813300016294SoilRIKLVRADGLPLGGALHHVRFTRAGAAFTTGDRERAGLLAKHLGVTVELGG
Ga0182035_1185776513300016341SoilRLVREDGLPLGGAVHHLRFARVHGTFTAQDRRRSDLLAKRLDLTIELK
Ga0182040_1076806713300016387SoilGALHHVRFTRTDGTLGTGGTERAALLAKRLGLAVELAS
Ga0182039_1181108123300016422SoilLPLGGSRHHVSFTRAEGTLGCQDRERAGLLAKRLGVTVELAGLAGER
Ga0187807_127027013300017926Freshwater SedimentAGGLPRGGALHHVRFTRAEGAFAASDHERAGLLGKRLGLTVELAS
Ga0187814_1008756813300017932Freshwater SedimentGLLLGGAVHHIRFARVRGTFSAQDRERAGLLAKRLGLTIELAD
Ga0187809_1017619123300017937Freshwater SedimentGALHHVRFTRATGGYSPRDRQRAAGLAASLGLSVELAG
Ga0187808_1053589213300017942Freshwater SedimentKRIKLVRADGLPLGGALHHVRFTRAAGTFSTQDRQRADLLARRLGLTVELAG
Ga0187817_1031798523300017955Freshwater SedimentLVRADGLPLGGALHHVRFTRAAGTFSTQDRQRADLLARRLGLTVELAG
Ga0187779_1119109923300017959Tropical PeatlandDGLPLGGALHHVRFTRGTFTAQDRQRAGLLAKRLGLTVELAG
Ga0187783_1020873913300017970Tropical PeatlandHHVRFTRTSGPFTDTERDRAHLLAKRLGVTLELAG
Ga0187783_1034560323300017970Tropical PeatlandRIRLLHRDGLPLGGALHHVRFTRASGAFSDEEQDRALLLAKRLGVTLELAS
Ga0187783_1135987423300017970Tropical PeatlandALHHVRFARAAGAFTAQESERAGLLAKRLGLAVELAG
Ga0187781_1008144513300017972Tropical PeatlandPGGKRIRLARRDGLPLGGAVHHIRFARLHGAFSARDRQRAGLLATRLGLTVELAG
Ga0187781_1044539523300017972Tropical PeatlandRLRLVRADGMPLGGALYRIRFTRTAGAFGTRERERADLLAKRLGLTVELAG
Ga0187780_1023548823300017973Tropical PeatlandIRLVREHGLPLGGALHHVGFARGTFTAQDRQRAGLLAKRLGLTVELAG
Ga0187780_1074074823300017973Tropical PeatlandVHEDSLPLGGALHHIRFARTKGSFSAQDGERADLLARRLGLTVELAWLEPR
Ga0187823_1009605013300017993Freshwater SedimentLRLVREAGLPRGGALHHVRFTRAEGTFGTSETERAALLAKRLGVTIELAC
Ga0187816_1041723813300017995Freshwater SedimentLRLVRAGGLPRGGALHHVRFTRAEGAFAASDHERAGLLGKRLGLTVELAS
Ga0187863_1029521713300018034PeatlandIRLVHEDGLPLGGALHRIRFTRAEDAFSTQDKERAGLLAKRLSLMVDLAG
Ga0187871_1007131233300018042PeatlandKRIRLVHQDGLPLGGALHHIGFSRAAGAFSTQDKERADLLAKRLGLMVDLAG
Ga0187766_1059294613300018058Tropical PeatlandGGTLHRVRFTRAEGAFSAQDTGRAALLAKRLGLTVELAS
Ga0187769_1049985513300018086Tropical PeatlandVARQDGLPLVGAVQHIRFARAQGAFSARDRERAGLLATRLGLTVELADQG
Ga0187770_1112448523300018090Tropical PeatlandRLVREGGLPRGGALHHVRFTRAEGTFGSSDTERAALLAKRLGLTVELAS
Ga0066669_1102695633300018482Grasslands SoilGKRIRLVREEGLPLGGLLHHVRFTCADGSFSAQDRERAGLLAKRLGLTVELAG
Ga0206355_124761313300020076Corn, Switchgrass And Miscanthus RhizosphereHQDGLPLGGALHHVCFAREAGVFSVRDRQRAGLLAERLGLTVELAG
Ga0210403_1036623413300020580SoilRLRLVREDGLARGGVLHHIRFARTEGSFGASDTERAALLAKRLGVTIELAC
Ga0154015_161690123300020610Corn, Switchgrass And Miscanthus RhizosphereLVHHDGLPLGGTLHHVRFTREAGVFSVRDRQRAGLLAERLGLTVELAG
Ga0210400_1144395913300021170SoilLPNGGRLHHVRFTRAAGTFSAQDRERAGLLAKRLGLAVELAPGTAGSP
Ga0210405_1081588523300021171SoilGAVHHLRFTRAARAFTARDCQRTGLLASGLGLRVELAS
Ga0210388_1085873923300021181SoilDGLPLGGALHHIRFARVAGAFSSQDRDRADLLAKHLGLTVELAR
Ga0210397_1030758613300021403SoilRGGALHHVRFSRAEGSFGAADRERAALLAKRLGVTVELAG
Ga0210386_1051988513300021406SoilNGGRLHHVGFTRAAGTFSAQDRERAGLLAKRLGLAVELAPGTAGSP
Ga0210383_1151801913300021407SoilLHHIRFARAEGTFGASDTERAALLAKRLGVTIELAC
Ga0210384_1022944013300021432SoilREDGLPLGGALHHVRFTRVTGAFSTRDRERAGLLARQLGLTLELAG
Ga0210398_1122104713300021477SoilEDGLPNGGRLHHVRFTRAAGAFSAQDRERAGLLAKRLGLAVELASGTAASP
Ga0210402_1076946423300021478SoilGLLHHIGFTRADGAFTTQDRQRAGLLAKRLGLTVELAG
Ga0210402_1192097323300021478SoilGGALHHLRFARATGAFSTQDRERADLLAKPLGLTVELTE
Ga0126371_1217440023300021560Tropical Forest SoilPHGGALHHIRFTRAAGTYGAQDEERAALLAKRLGLAVELAS
Ga0242668_115804413300022529SoilARGGALHHVRFTRAEGSFGAADRERADLLAKRLGVTVELAG
Ga0179589_1019282843300024288Vadose Zone SoilGGLLHHVGFTRAGGAFTAQDRERAGLLAKRLGLTVELAG
Ga0247667_106205913300024290SoilHHVCFSRADGSFTAQDRQRAGLLAKRLGLTVELAG
Ga0247668_102213023300024331SoilGLLHHVCFSRADGSFTAQDRQRAGLLAKRLGLTVELAG
Ga0207692_1003350333300025898Corn, Switchgrass And Miscanthus RhizosphereKRIRLVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG
Ga0207710_1047125113300025900Switchgrass RhizosphereGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG
Ga0207684_1008692333300025910Corn, Switchgrass And Miscanthus RhizosphereRLVRQDGLARGGTLHHIRFARAEGSFGAGDRERASLLAKRLGVMVELAG
Ga0207707_1122369923300025912Corn RhizosphereRLVHEDGLPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG
Ga0207646_1115161923300025922Corn, Switchgrass And Miscanthus RhizosphereDDLPLGGALHHVRFSRAAGTFSAQDRERAAPLARRLGLTVELAG
Ga0207687_1010217433300025927Miscanthus RhizosphereEEGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG
Ga0207700_1128156913300025928Corn, Switchgrass And Miscanthus RhizosphereDGLPLGGALHHVGFSRAAGAFTAPDRERAARLASRLGLTVELAG
Ga0207711_1120352713300025941Switchgrass RhizosphereRIRLVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG
Ga0207639_1014286113300026041Corn RhizosphereGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG
Ga0207639_1107170833300026041Corn RhizosphereLPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG
Ga0207676_1004605113300026095Switchgrass RhizosphereLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG
Ga0207698_1099327713300026142Corn RhizosphereLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG
Ga0209863_1017031613300026281Prmafrost SoilDGLPLGGGLHHLRFTRAAGAFTAQDAECAGLAAKHLGLTLELAG
Ga0209801_131717813300026326SoilKRIRLVREEGLPLGGLLHHVCFTRAGGAFTTQDRERAGLLAKRLGLTVELAG
Ga0208237_107232923300027080Forest SoilGALHHVRFSRAEGSFGAADRERAALLAKRLGVTVELAG
Ga0208099_101854313300027096Forest SoilLVRQDGLPLGGALHHVGFTRTSGAFSAQERDRAHLLAKRLGLALELAG
Ga0208099_104554413300027096Forest SoilGLPRGGALHHVRFARAAGTFTAGDRERAGLLAKRLGVRVELAV
Ga0208725_101768813300027158Forest SoilPHGGALHHIRFARAQGTFSERDRDRAGPLARRLGLTVDLAGGLPPA
Ga0208729_11165913300027166Forest SoilALHHIRFTRASGAFSTQECERARLLSKRLGLTLELAD
Ga0209529_100789213300027334Forest SoilLVRQDGLPLGGAPHHLRFTRTPGAFSAQERDRAHLLAKRLGLTLELAG
Ga0207826_106443713300027680Tropical Forest SoilGLPLGGAMHHIRFARVHGRFSAQDRQRAGLLAKRLGLTIELAD
Ga0207862_108607513300027703Tropical Forest SoilKRIRLVREDGLPLGGAMHHIRFARVHGRFSAQDRQRAGLLAKRLGLTIELAD
Ga0209178_115243233300027725Agricultural SoilREDGLPLGGLLHHVRFGRVDGSFSAQDRQRAGLLAKRLGLTVELAG
Ga0209040_1026633633300027824Bog Forest SoilEDGLARGGVLHHIRFARAEGTFGASDTKRAALLAKRLGVTIELTC
Ga0209517_1001299113300027854Peatlands SoilGLPLGGSLHHVRFTRADGAFSGQDSERAGLLAKRLGLAVELAS
Ga0209579_1058624413300027869Surface SoilRADGLPNGGRLHHVRFCRAAGTFSAQDRERAALLAKRLGLTVELGQG
Ga0209624_1029513823300027895Forest SoilRDGLARGGALHHVRFTRTEGSFGAGDRERAALLAKRLGVTVELAG
Ga0209415_1013787933300027905Peatlands SoilDGPPLGGSLHHVRFTRADGAFSAQDRERASLLAKRLGLAVELAVTRHSP
Ga0209415_1071138913300027905Peatlands SoilREDGLPLGGSLHYVRFTRTDGAFSGQDSERAGLLAKRLGLTVELARP
Ga0247689_106785113300028281SoilALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG
Ga0307317_1034674213300028720SoilGGKRIRLVREDGLPLGGLLHHVRFTRANGAFSAQDRERAGLLAKRLGLTVELAG
Ga0302224_1024277923300028759PalsaLGGALHHIRFSRAAAAFSTQDKERAGLLAKRLGLMVDLDG
Ga0302234_1015005913300028773PalsaLHRIRFTRVAGAFSTQDTERAGLLAKRLGLMVDLAG
Ga0307308_1036645313300028884SoilLGGLLHHIRFSRADGAFSAQDRQRAGLLAKRLGLTVELAG
Ga0308309_1106182213300028906SoilVREDGLPLGGSLHHVRFPRTEGAFGAQDRERAGLLAKRLGLAVELAG
Ga0311371_1043784013300029951PalsaRLVREDGLAREDGLARGGALHHIRFTRAEGTFGASDRERAALLAKRLGLRVELAG
Ga0311339_1176561713300029999PalsaALHHIRFTRAAGAFSTHDTERSGLLAKRLGLMVDLAG
Ga0302178_1030702113300030013PalsaLVREDGLPRGGALHHVRFARTHGAFSAADSGRVAEGAKRLGLTIELAQ
Ga0310037_1030861323300030494Peatlands SoilLPLGGSLHHVRFTRADGAFSGQDRERAGLLAKRLGLAVELAS
Ga0311356_1182472023300030617PalsaLPDGLPLGGALHHVRFTRAAGAFSTQDKQRAGLLAKRLGLTVDLSG
Ga0311354_1055159113300030618PalsaGGALHHIRFTRAAGAFSTGEKERTGLLAKRLGLRVELAS
Ga0302317_1029100323300030677PalsaLHHIRFSRAAAAFSTQDKERAGLLAKRLGLMVDLDG
Ga0307482_106051933300030730Hardwood Forest SoilARGGVLHHIRFARTEGSFGASDAERAALLAKRLGVTIELAC
Ga0302180_1040264913300031028PalsaKRIRLVREDGLPLGGALHHIRFTRGAGAFSTQDKDRAGLLAKRLGVMVDLAG
Ga0307498_1013263513300031170SoilHHVRFTRAGGAFSAPDRERAALLAKRLGLTVELAD
Ga0302307_1005353313300031233PalsaGLPLGGALHRIRFTRVAGAFSTQDTERAGLLAKRLGLMVDLAG
Ga0302324_10214349923300031236PalsaEAGLPLGGALHHLRFARVTGAFSAQERERADLLAKRLGLTVELAG
Ga0318534_1060066223300031544SoilSLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG
Ga0318538_1037527723300031546SoilFGGAMHHVRFARAAGAFSSQDRERADLLARRLGLTVELAG
Ga0318571_1011070513300031549SoilDGVPRGGLLHHVRFTREDGTFGAGDQDRAALLAKRLGVTVELAG
Ga0318571_1020608813300031549SoilGLPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG
Ga0318528_1046257913300031561SoilDGLPLGGAVHHLRFARVHGTFTAQDRRRSDLLAKRLDLTIELK
Ga0318515_1009457033300031572SoilLLHHVRFTRTDGTFGAGDQERAALLAKRLGVTVELAG
Ga0318574_1064242513300031680SoilRLVREDGLPLGGAVHHLRFARVHGTFTAQDRRRSDLLAKRLGLTIELK
Ga0318572_1015418423300031681SoilPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG
Ga0310686_10023399413300031708SoilRLVRQNGLARGGALHHVRFTRAEGSFGAGDRERAALLAKRLGVTVELAR
Ga0310686_10273946913300031708SoilRGGALHHVRFSRAEGSFGAADRERADLLAKRLGVTVELAG
Ga0310686_10673324413300031708SoilQDGLARGGALHHVRFSRAEGRFGAAERERADLLAKRLGVTVELAG
Ga0310686_10691031913300031708SoilHHVRFTRAEGAFGASDRERAALLAKRLGLTVELAD
Ga0310686_11388078323300031708SoilPHGGALHHIRFARVHGTFTDRDRDRASLLAKRLGTTVDLAALA
Ga0310686_11431204223300031708SoilGKRIRLVREDGLPLGGALHHVRFSRAAGTFSAQDRERAAPLASRLGLTVELAG
Ga0318496_1011353913300031713SoilGGAVHHLRFARVHGTFTAQDRRRSDLLAKRLGLTIELK
Ga0307474_1039059713300031718Hardwood Forest SoilGGALHHVRFSRAEGSFGAADRERAALLAKRLGVTVELAG
Ga0306917_1074400013300031719SoilLHHVRFTRTDGTFGAGDQERAALLAKRLGVTVELAG
Ga0318493_1004382813300031723SoilGLPLGGALHHVRFTRAGGSFGVQDRERAGLLAKRLGLTVQLA
Ga0318493_1080274613300031723SoilGGALHHVRFTRTDGTFGTGDTERAALLAKRLGLAVELAT
Ga0306918_1002425663300031744SoilVREDGLPLGGALHHVRFTRAAGAFSAQDRERAGLLAKRLGLGLELAASA
Ga0318502_1098629813300031747SoilPRGGALHHVRFTRAEGTFGAGDTERAPLLAKRLGLAVELTS
Ga0318535_1003832813300031764SoilALHHVRFTRAAAAFSTDDRERAGLLAGHLGLTVELAG
Ga0318526_1027434313300031769SoilLLHHVRFTREDGTFGAGDQDRAALLAKRLGVTVELAG
Ga0318546_1035055713300031771SoilIRLVREDGLPLGGVLHHVRFTRAEGTFSVQDRERAGLLAKRLGVTVELAG
Ga0318552_1003253813300031782SoilTRSDGTFGAQDRERAGLLAKRLGVTVELAGLAGER
Ga0318550_1064527813300031797SoilIRLVREDGLPLGGAVHHIGFARVHGTFSTQDRQRAGLLAKRLGLAIELAG
Ga0318565_1037763713300031799SoilVREDGLARGGALHHVRFTRTDGTFGTGDTERAALLAKRLGLAVELAT
Ga0318568_1063387723300031819SoilGALHHVRFTRADGTFGAGDQERAALLAKRLGVTIDLAG
Ga0318564_1005357813300031831SoilLHHVRFTRAAAAFSTDDRERAGLLAGHLGLTVELAG
Ga0318499_1021707013300031832SoilLVREDGLPLGGSLHHVSFTRAEGTFGAQDRERAGLLAKRLGVTVELAGLAGER
Ga0318512_1040688933300031846SoilALHHVRFTRAGGSFGVQDRERAGLLAKRLGLTVQLA
Ga0318512_1075024323300031846SoilIKLVRADGLPLGGALHRVRFTRAAAAFSTRDRERAGLLAVPLGLTVELGG
Ga0306925_1122885413300031890SoilGALHHVRFTRAAGAFSAQDRERASLLAKRLGLAVELAG
Ga0318522_1012623033300031894SoilGGKRIRLVREDGLPLDGAVHHLRFARVHGTFTAQDRRRSDLLAKRLGLTIELK
Ga0318551_1044224613300031896SoilALHHVRFTRADGTFSVGDRERAALLAKRLGVVVELAS
Ga0306923_1212180113300031910SoilGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG
Ga0306921_1132504613300031912SoilKRIKLVRADGLPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG
Ga0306921_1225615433300031912SoilGKRIRLVREDGLPLGGALHHVRFTRVGDSFGVQDRERAGLLAKRLGLTVELAR
Ga0310912_1064893613300031941SoilRLVREDGLARGGALHHVRFTRTDGTFGTGDTERAALLAKRLGVTVELAG
Ga0306926_1044038213300031954SoilEDGLPRGGALHHLRFTRAEGTFGAGDQERAALLAKRLGLRIDLAG
Ga0306922_1044329413300032001SoilRLVREDGLPLGGSLHHVSFTRAEGTFGAQDRERAGLLAKRLGVTVELAGLAGER
Ga0318563_1012035213300032009SoilRIRLVREDGLPLGGSLHHVSFTRAEGTFGAQDRERAGLLAKRVGVTVELAGLARER
Ga0318569_1010732913300032010SoilLPPGGAVHHLRFARVHGTFTARDRRRSDLLAKRLGLTIELK
Ga0318559_1004025533300032039SoilLVREDGLPLGGALHHIRFTRAAAAFSTDDRERAGLLAGHLGLTVELAG
Ga0318556_1042654513300032043SoilLVREDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG
Ga0318558_1026392033300032044SoilHHVRFSRAAGSFSTEDRERAASLASRLGLTVQLAG
Ga0318558_1049139013300032044SoilLGGALHHICFTRAAAAFSTDDRERAGLLAGHLGLTVELAG
Ga0318513_1013284333300032065SoilIRLVREGGLPRGGALHHVRFTRADGTFSVGDRERAALLAKRLGVVVELAS
Ga0318553_1003639113300032068SoilGLLHHVRFTRTDGTFGAGDQERAALLAKRLGVTVELAG
Ga0308173_1178951513300032074SoilRLVREDGLPLGGSLHHVRFTRAEGTFTAQDRERAGLLAKRLGLAVELA
Ga0306924_1069159023300032076SoilLPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG
Ga0306924_1261404523300032076SoilEGLRGGAVRRVRFTRARGAFGAQDRERAALLAKRLGLTLELG
Ga0318525_1046898313300032089SoilALHHVRFTRAEGTFGAGDTERAPLLAKRLGLAVELTS
Ga0318518_1031319933300032090SoilAVHHIGFARVHGTFSTQDRQRAGLLAKRLGLAIELAG
Ga0311301_1110105313300032160Peatlands SoilRLVREDGLPLGGSLHHVRFTRADGAFSGQDSERAGLLAKRLGLTVELARS
Ga0307470_1133898413300032174Hardwood Forest SoilPLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAG
Ga0306920_10323002513300032261SoilRLVRKDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG
Ga0335085_1119659423300032770SoilKRIRLVREDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGVTVELAG
Ga0335082_1137188213300032782SoilKRIRLVREDGLPLGGSLHHVRFTRAEGAFGAQDRERAGLLAKRLGLTVEAAG
Ga0335079_1094064123300032783SoilIREDGLPLGGSLHHVRFSRAEGAFGAQDRERAGLLAKRLGLTVDLA
Ga0335078_1014997083300032805SoilGGALHHIRFTRAAGAFSARDLERASLLAKRLGLDVELAG
Ga0335078_1139713613300032805SoilGKRIRLVREDGLPLGGSLHHVRFTRAEGTFSAQERERAGLLAKRLGVTVELAG
Ga0335080_1034540933300032828SoilVREEGLPLGGSLHHVRFTRADGAFGAQDRERAGLLAKRLGLTVELAR
Ga0335081_1163247113300032892SoilVREDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGVTVELAG
Ga0335081_1185720413300032892SoilPLGGVLHHVRFTRAGGAFSAQDRERAALLAKRLGLTVELAASTGP
Ga0335069_1009494843300032893SoilGGSLHHVRFTRTEGAFSAQDRERAGLLAKRLGLAVELAD
Ga0335075_1032757013300032896SoilEDGLPRGGALHHVRFTRAEGTFGASDHERTALLAKRLGLTVELAG
Ga0335076_1055621213300032955SoilLRLVRAEGLPLGGALHHVRFSRSAGAFSAADRERTAELASRLGVTVELAG
Ga0335073_1092854423300033134SoilLGGALHHIRFARAAGAFSSQEREHADPLAKRLGLTVELAG
Ga0318519_1028920233300033290SoilLARGGALHHVRFTRTDGTFGTGDTERAALLAKRLGLAVELAS
Ga0370515_0333368_3_1253300034163Untreated Peat SoilLGGALHHIRFARAAGAFSTQDKERAGLLAKRLGLMVDLAD
Ga0370514_075059_2_1213300034199Untreated Peat SoilGGALHHVRFTRAARSFSSQEREHAGPLARHIGLTVELAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.