Basic Information | |
---|---|
Family ID | F019315 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 230 |
Average Sequence Length | 44 residues |
Representative Sequence | PLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAG |
Number of Associated Samples | 201 |
Number of Associated Scaffolds | 230 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.17 % |
% of genes near scaffold ends (potentially truncated) | 97.83 % |
% of genes from short scaffolds (< 2000 bps) | 90.43 % |
Associated GOLD sequencing projects | 191 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.565 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.609 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.913 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 14.49% Coil/Unstructured: 65.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 230 Family Scaffolds |
---|---|---|
PF00152 | tRNA-synt_2 | 10.43 |
PF13556 | HTH_30 | 6.52 |
PF00486 | Trans_reg_C | 3.91 |
PF00128 | Alpha-amylase | 3.48 |
PF01336 | tRNA_anti-codon | 2.61 |
PF13279 | 4HBT_2 | 2.17 |
PF01741 | MscL | 1.74 |
PF06445 | GyrI-like | 1.74 |
PF01828 | Peptidase_A4 | 1.74 |
PF02687 | FtsX | 1.74 |
PF08241 | Methyltransf_11 | 1.74 |
PF13676 | TIR_2 | 1.74 |
PF02771 | Acyl-CoA_dh_N | 1.30 |
PF09660 | DUF2397 | 1.30 |
PF00582 | Usp | 0.87 |
PF00571 | CBS | 0.87 |
PF00892 | EamA | 0.87 |
PF13560 | HTH_31 | 0.87 |
PF00406 | ADK | 0.87 |
PF06689 | zf-C4_ClpX | 0.87 |
PF02518 | HATPase_c | 0.87 |
PF12840 | HTH_20 | 0.87 |
PF12697 | Abhydrolase_6 | 0.87 |
PF08240 | ADH_N | 0.87 |
PF13231 | PMT_2 | 0.87 |
PF13669 | Glyoxalase_4 | 0.87 |
PF02515 | CoA_transf_3 | 0.87 |
PF00501 | AMP-binding | 0.43 |
PF01614 | IclR | 0.43 |
PF07728 | AAA_5 | 0.43 |
PF01443 | Viral_helicase1 | 0.43 |
PF16326 | ABC_tran_CTD | 0.43 |
PF00440 | TetR_N | 0.43 |
PF13472 | Lipase_GDSL_2 | 0.43 |
PF00903 | Glyoxalase | 0.43 |
PF02625 | XdhC_CoxI | 0.43 |
PF03729 | DUF308 | 0.43 |
PF00561 | Abhydrolase_1 | 0.43 |
PF10094 | DUF2332 | 0.43 |
PF08450 | SGL | 0.43 |
PF00589 | Phage_integrase | 0.43 |
PF01565 | FAD_binding_4 | 0.43 |
PF05988 | DUF899 | 0.43 |
PF12681 | Glyoxalase_2 | 0.43 |
PF08044 | DUF1707 | 0.43 |
PF07883 | Cupin_2 | 0.43 |
PF07730 | HisKA_3 | 0.43 |
PF13411 | MerR_1 | 0.43 |
PF07690 | MFS_1 | 0.43 |
PF02913 | FAD-oxidase_C | 0.43 |
PF04185 | Phosphoesterase | 0.43 |
PF03466 | LysR_substrate | 0.43 |
COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
---|---|---|---|
COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 10.43 |
COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 10.43 |
COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 10.43 |
COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 10.43 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 3.48 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 3.48 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 3.48 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 3.48 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.30 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.87 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.87 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.43 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.43 |
COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.43 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.43 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.43 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.43 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.43 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.43 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.43 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.57 % |
Unclassified | root | N/A | 20.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2032320005|FACEOR_FY84VJD01DN3YB | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101874156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300004092|Ga0062389_103987789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
3300005177|Ga0066690_10808262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
3300005339|Ga0070660_100084306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2497 | Open in IMG/M |
3300005366|Ga0070659_100068331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2818 | Open in IMG/M |
3300005435|Ga0070714_101017303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 806 | Open in IMG/M |
3300005435|Ga0070714_101105664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
3300005435|Ga0070714_101478867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
3300005446|Ga0066686_10030947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3122 | Open in IMG/M |
3300005457|Ga0070662_100997474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 717 | Open in IMG/M |
3300005468|Ga0070707_101657804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
3300005536|Ga0070697_100915966 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300005538|Ga0070731_10862894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300005547|Ga0070693_100037925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2690 | Open in IMG/M |
3300005548|Ga0070665_100120328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2627 | Open in IMG/M |
3300005587|Ga0066654_10251641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 932 | Open in IMG/M |
3300005610|Ga0070763_10202160 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300005764|Ga0066903_107771127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
3300005764|Ga0066903_108107045 | Not Available | 538 | Open in IMG/M |
3300005843|Ga0068860_100624001 | Not Available | 1085 | Open in IMG/M |
3300005921|Ga0070766_10243270 | Not Available | 1139 | Open in IMG/M |
3300005921|Ga0070766_10317330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1004 | Open in IMG/M |
3300006034|Ga0066656_10398391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 891 | Open in IMG/M |
3300006050|Ga0075028_100290350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 909 | Open in IMG/M |
3300006603|Ga0074064_11792528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
3300006854|Ga0075425_100523960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1364 | Open in IMG/M |
3300006914|Ga0075436_101478908 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300009098|Ga0105245_12647581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
3300009143|Ga0099792_10953773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300009521|Ga0116222_1310147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
3300009522|Ga0116218_1266970 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300009523|Ga0116221_1287026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
3300009525|Ga0116220_10202279 | Not Available | 861 | Open in IMG/M |
3300009683|Ga0116224_10284514 | Not Available | 787 | Open in IMG/M |
3300009824|Ga0116219_10378367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
3300010333|Ga0134080_10326148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 694 | Open in IMG/M |
3300010360|Ga0126372_10296226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1419 | Open in IMG/M |
3300010366|Ga0126379_11133442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 888 | Open in IMG/M |
3300010373|Ga0134128_10529950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1313 | Open in IMG/M |
3300010373|Ga0134128_10726990 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300010375|Ga0105239_10382052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1592 | Open in IMG/M |
3300010379|Ga0136449_103644020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300010396|Ga0134126_10064965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4538 | Open in IMG/M |
3300010397|Ga0134124_10418874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1278 | Open in IMG/M |
3300010397|Ga0134124_11233882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
3300010401|Ga0134121_10319569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1380 | Open in IMG/M |
3300010876|Ga0126361_10682725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
3300010880|Ga0126350_10997472 | Not Available | 703 | Open in IMG/M |
3300011119|Ga0105246_11923030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300012189|Ga0137388_11256408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria | 679 | Open in IMG/M |
3300012211|Ga0137377_11775025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
3300012353|Ga0137367_10659791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
3300012357|Ga0137384_10418326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1106 | Open in IMG/M |
3300012481|Ga0157320_1030688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
3300012915|Ga0157302_10092012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 941 | Open in IMG/M |
3300012984|Ga0164309_11174731 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012985|Ga0164308_12277353 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300013104|Ga0157370_10286359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1522 | Open in IMG/M |
3300013105|Ga0157369_11274082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
3300013297|Ga0157378_11671594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
3300014154|Ga0134075_10043208 | Not Available | 1852 | Open in IMG/M |
3300014201|Ga0181537_11217029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
3300014493|Ga0182016_10473586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
3300015242|Ga0137412_11003572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
3300016270|Ga0182036_11008071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
3300016270|Ga0182036_11034096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
3300016270|Ga0182036_11928964 | Not Available | 501 | Open in IMG/M |
3300016294|Ga0182041_11966328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300016341|Ga0182035_11857765 | Not Available | 546 | Open in IMG/M |
3300016387|Ga0182040_10768067 | Not Available | 792 | Open in IMG/M |
3300016422|Ga0182039_11811081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300017926|Ga0187807_1270270 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300017932|Ga0187814_10087568 | Not Available | 1145 | Open in IMG/M |
3300017937|Ga0187809_10176191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales | 750 | Open in IMG/M |
3300017942|Ga0187808_10535892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
3300017955|Ga0187817_10317985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 993 | Open in IMG/M |
3300017959|Ga0187779_11191099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300017970|Ga0187783_10208739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1433 | Open in IMG/M |
3300017970|Ga0187783_10345603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1083 | Open in IMG/M |
3300017970|Ga0187783_11359874 | Not Available | 512 | Open in IMG/M |
3300017972|Ga0187781_10081445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 2236 | Open in IMG/M |
3300017972|Ga0187781_10445395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
3300017973|Ga0187780_10235488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
3300017973|Ga0187780_10740748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
3300017993|Ga0187823_10096050 | Not Available | 880 | Open in IMG/M |
3300017995|Ga0187816_10417238 | Not Available | 598 | Open in IMG/M |
3300018034|Ga0187863_10295217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 901 | Open in IMG/M |
3300018042|Ga0187871_10071312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2041 | Open in IMG/M |
3300018058|Ga0187766_10592946 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300018086|Ga0187769_10499855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
3300018090|Ga0187770_11124485 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300018482|Ga0066669_11026956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 744 | Open in IMG/M |
3300020076|Ga0206355_1247613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 908 | Open in IMG/M |
3300020580|Ga0210403_10366234 | Not Available | 1179 | Open in IMG/M |
3300020610|Ga0154015_1616901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300021170|Ga0210400_11443959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
3300021171|Ga0210405_10815885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. DC12 | 714 | Open in IMG/M |
3300021181|Ga0210388_10858739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
3300021403|Ga0210397_10307586 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300021406|Ga0210386_10519885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1029 | Open in IMG/M |
3300021407|Ga0210383_11518019 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300021432|Ga0210384_10229440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1671 | Open in IMG/M |
3300021477|Ga0210398_11221047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
3300021478|Ga0210402_10769464 | Not Available | 887 | Open in IMG/M |
3300021478|Ga0210402_11920973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300021560|Ga0126371_12174400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
3300022529|Ga0242668_1158044 | Not Available | 503 | Open in IMG/M |
3300024288|Ga0179589_10192828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 888 | Open in IMG/M |
3300024290|Ga0247667_1062059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 691 | Open in IMG/M |
3300024331|Ga0247668_1022130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1314 | Open in IMG/M |
3300025898|Ga0207692_10033503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2479 | Open in IMG/M |
3300025900|Ga0207710_10471251 | Not Available | 650 | Open in IMG/M |
3300025910|Ga0207684_10086923 | Not Available | 2663 | Open in IMG/M |
3300025912|Ga0207707_11223699 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300025922|Ga0207646_11151619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum | 681 | Open in IMG/M |
3300025927|Ga0207687_10102174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2112 | Open in IMG/M |
3300025928|Ga0207700_11281569 | Not Available | 653 | Open in IMG/M |
3300025941|Ga0207711_11203527 | Not Available | 699 | Open in IMG/M |
3300026041|Ga0207639_10142861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1996 | Open in IMG/M |
3300026041|Ga0207639_11071708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
3300026095|Ga0207676_10046051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3373 | Open in IMG/M |
3300026142|Ga0207698_10993277 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300026281|Ga0209863_10170316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
3300026326|Ga0209801_1317178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
3300027080|Ga0208237_1072329 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300027096|Ga0208099_1018543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 967 | Open in IMG/M |
3300027096|Ga0208099_1045544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
3300027158|Ga0208725_1017688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. USK10 | 1165 | Open in IMG/M |
3300027166|Ga0208729_111659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300027334|Ga0209529_1007892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1729 | Open in IMG/M |
3300027680|Ga0207826_1064437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1011 | Open in IMG/M |
3300027703|Ga0207862_1086075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
3300027725|Ga0209178_1152432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
3300027824|Ga0209040_10266336 | Not Available | 851 | Open in IMG/M |
3300027854|Ga0209517_10012991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8751 | Open in IMG/M |
3300027869|Ga0209579_10586244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
3300027895|Ga0209624_10295138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1079 | Open in IMG/M |
3300027905|Ga0209415_10137879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2503 | Open in IMG/M |
3300027905|Ga0209415_10711389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
3300028281|Ga0247689_1067851 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300028720|Ga0307317_10346742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
3300028759|Ga0302224_10242779 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300028773|Ga0302234_10150059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 1015 | Open in IMG/M |
3300028884|Ga0307308_10366453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 690 | Open in IMG/M |
3300028906|Ga0308309_11061822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
3300029951|Ga0311371_10437840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1757 | Open in IMG/M |
3300029999|Ga0311339_11765617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
3300030013|Ga0302178_10307021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 728 | Open in IMG/M |
3300030494|Ga0310037_10308613 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300030617|Ga0311356_11824720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
3300030618|Ga0311354_10551591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1129 | Open in IMG/M |
3300030677|Ga0302317_10291003 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300030730|Ga0307482_1060519 | Not Available | 948 | Open in IMG/M |
3300031028|Ga0302180_10402649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
3300031170|Ga0307498_10132635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 807 | Open in IMG/M |
3300031233|Ga0302307_10053533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2150 | Open in IMG/M |
3300031236|Ga0302324_102143499 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300031544|Ga0318534_10600662 | Not Available | 625 | Open in IMG/M |
3300031546|Ga0318538_10375277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 769 | Open in IMG/M |
3300031549|Ga0318571_10110705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
3300031549|Ga0318571_10206088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
3300031561|Ga0318528_10462579 | Not Available | 681 | Open in IMG/M |
3300031572|Ga0318515_10094570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
3300031680|Ga0318574_10642425 | Not Available | 622 | Open in IMG/M |
3300031681|Ga0318572_10154184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1328 | Open in IMG/M |
3300031708|Ga0310686_100233994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium vinaceum | 500 | Open in IMG/M |
3300031708|Ga0310686_102739469 | Not Available | 2250 | Open in IMG/M |
3300031708|Ga0310686_106733244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300031708|Ga0310686_106910319 | Not Available | 521 | Open in IMG/M |
3300031708|Ga0310686_113880783 | Not Available | 653 | Open in IMG/M |
3300031708|Ga0310686_114312042 | Not Available | 667 | Open in IMG/M |
3300031713|Ga0318496_10113539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1461 | Open in IMG/M |
3300031718|Ga0307474_10390597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
3300031719|Ga0306917_10744000 | Not Available | 770 | Open in IMG/M |
3300031723|Ga0318493_10043828 | Not Available | 2091 | Open in IMG/M |
3300031723|Ga0318493_10802746 | Not Available | 530 | Open in IMG/M |
3300031744|Ga0306918_10024256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3732 | Open in IMG/M |
3300031747|Ga0318502_10986298 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031764|Ga0318535_10038328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1957 | Open in IMG/M |
3300031769|Ga0318526_10274343 | Not Available | 690 | Open in IMG/M |
3300031771|Ga0318546_10350557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1027 | Open in IMG/M |
3300031782|Ga0318552_10032538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2399 | Open in IMG/M |
3300031797|Ga0318550_10645278 | Not Available | 508 | Open in IMG/M |
3300031799|Ga0318565_10377637 | Not Available | 687 | Open in IMG/M |
3300031819|Ga0318568_10633877 | Not Available | 665 | Open in IMG/M |
3300031831|Ga0318564_10053578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1758 | Open in IMG/M |
3300031832|Ga0318499_10217070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum | 745 | Open in IMG/M |
3300031846|Ga0318512_10406889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
3300031846|Ga0318512_10750243 | Not Available | 502 | Open in IMG/M |
3300031890|Ga0306925_11228854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300031894|Ga0318522_10126230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 958 | Open in IMG/M |
3300031896|Ga0318551_10442246 | Not Available | 742 | Open in IMG/M |
3300031910|Ga0306923_12121801 | Not Available | 566 | Open in IMG/M |
3300031912|Ga0306921_11325046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
3300031912|Ga0306921_12256154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
3300031941|Ga0310912_10648936 | Not Available | 820 | Open in IMG/M |
3300031954|Ga0306926_10440382 | Not Available | 1606 | Open in IMG/M |
3300032001|Ga0306922_10443294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum | 1388 | Open in IMG/M |
3300032009|Ga0318563_10120352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium aurantiacum | 1397 | Open in IMG/M |
3300032010|Ga0318569_10107329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
3300032039|Ga0318559_10040255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1916 | Open in IMG/M |
3300032043|Ga0318556_10426545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
3300032044|Ga0318558_10263920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
3300032044|Ga0318558_10491390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
3300032065|Ga0318513_10132843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1181 | Open in IMG/M |
3300032068|Ga0318553_10036391 | Not Available | 2382 | Open in IMG/M |
3300032074|Ga0308173_11789515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
3300032076|Ga0306924_10691590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
3300032076|Ga0306924_12614045 | Not Available | 503 | Open in IMG/M |
3300032089|Ga0318525_10468983 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300032090|Ga0318518_10313199 | Not Available | 805 | Open in IMG/M |
3300032160|Ga0311301_11101053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1033 | Open in IMG/M |
3300032174|Ga0307470_11338984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
3300032261|Ga0306920_103230025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
3300032770|Ga0335085_11196594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
3300032782|Ga0335082_11371882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
3300032783|Ga0335079_10940641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 885 | Open in IMG/M |
3300032805|Ga0335078_10149970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3299 | Open in IMG/M |
3300032805|Ga0335078_11397136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
3300032828|Ga0335080_10345409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1606 | Open in IMG/M |
3300032892|Ga0335081_11632471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
3300032892|Ga0335081_11857204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 649 | Open in IMG/M |
3300032893|Ga0335069_10094948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3779 | Open in IMG/M |
3300032896|Ga0335075_10327570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
3300032955|Ga0335076_10556212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1030 | Open in IMG/M |
3300033134|Ga0335073_10928544 | Not Available | 912 | Open in IMG/M |
3300033290|Ga0318519_10289202 | Not Available | 957 | Open in IMG/M |
3300034163|Ga0370515_0333368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
3300034199|Ga0370514_075059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 857 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.22% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.22% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.78% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.04% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.04% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.30% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.30% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.30% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.87% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.87% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.43% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.43% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
3300027166 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF033 (SPAdes) | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACEORA_440600 | 2032320005 | Soil | VHHVRFTRADGMFTTQDRERAGLLAKRLGLTVELAG |
JGIcombinedJ26739_1018741561 | 3300002245 | Forest Soil | LIRQDGLARGGALHHIRFTRTEGSFGAGERERAALLAKRLGVTVELAG* |
Ga0062389_1039877892 | 3300004092 | Bog Forest Soil | RIRLVREDGLPLGGSLHRVRFTRADGAFSAQDRERTGLLAKRLGLTVELGS* |
Ga0066690_108082623 | 3300005177 | Soil | GKRIRLVREEGLPLGGLLHHVRFTRADGMFTTQDRERAGLLAKRLGLTVELAG* |
Ga0070660_1000843061 | 3300005339 | Corn Rhizosphere | REDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0070659_1000683315 | 3300005366 | Corn Rhizosphere | LVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG* |
Ga0070714_1010173031 | 3300005435 | Agricultural Soil | PGGKRIRLVREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0070714_1011056641 | 3300005435 | Agricultural Soil | GKRIRLVREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0070714_1014788671 | 3300005435 | Agricultural Soil | KRIRLVREDGLPLGGSLHHVRFTRAEGTFTAQDRERAGLLAKRLGLVVELA* |
Ga0066686_100309474 | 3300005446 | Soil | REDGLPLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAR* |
Ga0070662_1009974743 | 3300005457 | Corn Rhizosphere | KRIRLVREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0070707_1016578043 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LPLGGLLHHVRFTCADGSFSAQDRERAGLLAKRLGLTVELSG* |
Ga0070697_1009159661 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HEDGLPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG* |
Ga0070731_108628941 | 3300005538 | Surface Soil | RADGLPNGGRLHHVRFCRAAGTFSAQDRERAALLAKRLGLTVELGQG* |
Ga0070693_1000379251 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GGKRIRLVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG* |
Ga0070665_1001203285 | 3300005548 | Switchgrass Rhizosphere | GLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0066654_102516413 | 3300005587 | Soil | KRIRLVREDGLPLGGLLHHVRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0070763_102021601 | 3300005610 | Soil | GKRIRLVREDGLPLGGALHHVRFSRAAGTFSAQDRERAAPLASRLGLTVELAG* |
Ga0066903_1077711271 | 3300005764 | Tropical Forest Soil | LHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELRG* |
Ga0066903_1081070452 | 3300005764 | Tropical Forest Soil | HHIRFTRAGGAWSTQDRERAGLLAKRLGVSLELDS* |
Ga0068860_1006240011 | 3300005843 | Switchgrass Rhizosphere | LPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0070766_102432703 | 3300005921 | Soil | HVRFTRAEGSFGTGDRERAALLAKRLGVTVELAG* |
Ga0070766_103173301 | 3300005921 | Soil | RLVRQDGLARGGALHHVRFSRAEGSFGAADRQRAALLAKRLGVTVELAG* |
Ga0066656_103983913 | 3300006034 | Soil | GLPLGGLLHHVRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0075028_1002903503 | 3300006050 | Watersheds | RIRLVREDGLPLGGSLHHVRFTRADGAFSGQDSERAGLLAKRLGLTVELAG* |
Ga0074064_117925281 | 3300006603 | Soil | EDGLPLGGLLHHVRFSRADGAFSAQDRERAGLLAKRLGLTVELAG* |
Ga0075425_1005239603 | 3300006854 | Populus Rhizosphere | EDGLPLGGSLHHVRFTRAEGTFTAQDRERAGLLAKRLGLAVELT* |
Ga0075436_1014789082 | 3300006914 | Populus Rhizosphere | GLPLGGSLHHVGFTRAAGAFTAQESERASLLAKRLGVGLELGG* |
Ga0105245_126475812 | 3300009098 | Miscanthus Rhizosphere | REEGLPLGGLLHHVRFTRSGGAFTAQDRERAGLLAKRLGLTVELAD* |
Ga0099792_109537732 | 3300009143 | Vadose Zone Soil | EEGLPLGGLLHHVSFTRAGGAFTAQDRERAGLLAKRLGLTVELAG* |
Ga0116222_13101472 | 3300009521 | Peatlands Soil | IRLVREDGPPLGGSLHHVRFTRADGAFSAQDRERASLLAKRLGLAVELAVTRHSP* |
Ga0116218_12669701 | 3300009522 | Peatlands Soil | GSLHHVRFTRADGAFSGQDRERAGLLAKRHGLAVELAT* |
Ga0116221_12870262 | 3300009523 | Peatlands Soil | KDGLPLGGSLHHVRFTRAEGTFSAQDRERAGLLAKRLGLTVELAS* |
Ga0116220_102022791 | 3300009525 | Peatlands Soil | GGRLHQVRFTRAAGAFSGQDRERAGLLAKRLGLAVELASGAAGSR* |
Ga0116224_102845141 | 3300009683 | Peatlands Soil | RLVRAGGLARGGELHHVRFTRAEGAFAASDHERAGLLGKRLGLTLELAAVSG* |
Ga0116219_103783671 | 3300009824 | Peatlands Soil | HVRFTRAEGAFAASDHERAGLLGKRLGLTLELAAVSG* |
Ga0134080_103261481 | 3300010333 | Grasslands Soil | PLGGLLHHVRFTRAGAAFSAQDRERAGLLAKRLGLTVELAG* |
Ga0126372_102962263 | 3300010360 | Tropical Forest Soil | IRLVREHALPLGGALHHIRFTCAAGAFSAQDRERAGLLAHRLGLTVELAG* |
Ga0126379_111334422 | 3300010366 | Tropical Forest Soil | REDGLPLGGGLHHIRFTRAAGAFSTQDRKRAGLLAEHLGLAVELAGTAPT* |
Ga0134128_105299501 | 3300010373 | Terrestrial Soil | EDGLPLGGLLHHVCFSRADGSFTAQDRQRAGLLAKRLGLTVELAG* |
Ga0134128_107269903 | 3300010373 | Terrestrial Soil | GLPLGGALHHVSFTRTAEEFSAQDRERAGLLAKRLGVGLELGG* |
Ga0105239_103820523 | 3300010375 | Corn Rhizosphere | LLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0136449_1036440202 | 3300010379 | Peatlands Soil | IRLVREDGLPLGGSLHHIRFTRADGAFSTHDKERAGLLAKRLGLTVELASP* |
Ga0134126_100649651 | 3300010396 | Terrestrial Soil | EDGLPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG* |
Ga0134124_104188741 | 3300010397 | Terrestrial Soil | LHHVSFTRTAEEFSAQDRERAGLLAKRLGVGLELGG* |
Ga0134124_112338822 | 3300010397 | Terrestrial Soil | VREEGLPLGGLLHHVRFTRSGGAFTTQDRQRAGLLAKRLGLTVELAG* |
Ga0134121_103195693 | 3300010401 | Terrestrial Soil | GGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG* |
Ga0126361_106827251 | 3300010876 | Boreal Forest Soil | GKRIKLVHQDGLPPGGALHHVRFTRAARSFSSQEREHAGLLARHIGLTVELAG* |
Ga0126350_109974721 | 3300010880 | Boreal Forest Soil | RRDGLARGGALHHLRFTRAAGRFGAGDRERARILAKRLGVTVELAG* |
Ga0105246_119230303 | 3300011119 | Miscanthus Rhizosphere | VREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG* |
Ga0137388_112564081 | 3300012189 | Vadose Zone Soil | EGLPLGGLLHHVGFTRSGGAFTTQNRERAGLLAKRLGLTVELAS* |
Ga0137377_117750252 | 3300012211 | Vadose Zone Soil | VRQDGLPLGGALHHVRFARADGAFSAQDRERAALLAKRLGLTVELAR* |
Ga0137367_106597912 | 3300012353 | Vadose Zone Soil | GKRIRLVREDGLPLGGLLHHVRFTRADGAFSAQDQERAGLLAKRLGLTVELAG* |
Ga0137384_104183261 | 3300012357 | Vadose Zone Soil | VRQDGLPFGGALHHVRFARADGAFGAQDRERAALLAKRLGLTVELAG* |
Ga0157320_10306883 | 3300012481 | Arabidopsis Rhizosphere | LVREDGLPLGGSLHHVRFTRAEGTFGAQDRERAGLLAKRLGLAVELA* |
Ga0157302_100920123 | 3300012915 | Soil | EDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLTKRLGLTVELAG* |
Ga0164309_111747311 | 3300012984 | Soil | LPLGGGLHHICFTRTAGEFGAQDRERAGLLAKRLGVAVELDG* |
Ga0164308_122773531 | 3300012985 | Soil | LGGSLHHIGFSRAAGPFTAQESERASLLAKRLGVGLELGG* |
Ga0157370_102863593 | 3300013104 | Corn Rhizosphere | VREDGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0157369_112740821 | 3300013105 | Corn Rhizosphere | DGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG* |
Ga0157378_116715941 | 3300013297 | Miscanthus Rhizosphere | VREDGLPLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAG* |
Ga0134075_100432081 | 3300014154 | Grasslands Soil | HVRFTRADGGFSSQDRERAGLLAKRLGLTVELAR* |
Ga0181537_112170291 | 3300014201 | Bog | RIRLVREDGLPLGGALHHVRFTRVTGSFSTEERERANLLAKRLGLTVELSAEPG* |
Ga0182016_104735861 | 3300014493 | Bog | PLGGVLHRIRFTRTAGAVSAQDAEHAGLLAKRLGLMVDLAG* |
Ga0137412_110035721 | 3300015242 | Vadose Zone Soil | GLPLGGLLHHVRFTRSGGAFTTQDRERAGLLAKRLGLTVELAG* |
Ga0182036_110080711 | 3300016270 | Soil | LLHHVRFTRTDGTFGAGDQERAALLAKRLGVVVELAS |
Ga0182036_110340962 | 3300016270 | Soil | DGLPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG |
Ga0182036_119289641 | 3300016270 | Soil | ALHHVRFTRTDGTLGTGGTERAALLAKRLGLAVELAS |
Ga0182041_119663281 | 3300016294 | Soil | RIKLVRADGLPLGGALHHVRFTRAGAAFTTGDRERAGLLAKHLGVTVELGG |
Ga0182035_118577651 | 3300016341 | Soil | RLVREDGLPLGGAVHHLRFARVHGTFTAQDRRRSDLLAKRLDLTIELK |
Ga0182040_107680671 | 3300016387 | Soil | GALHHVRFTRTDGTLGTGGTERAALLAKRLGLAVELAS |
Ga0182039_118110812 | 3300016422 | Soil | LPLGGSRHHVSFTRAEGTLGCQDRERAGLLAKRLGVTVELAGLAGER |
Ga0187807_12702701 | 3300017926 | Freshwater Sediment | AGGLPRGGALHHVRFTRAEGAFAASDHERAGLLGKRLGLTVELAS |
Ga0187814_100875681 | 3300017932 | Freshwater Sediment | GLLLGGAVHHIRFARVRGTFSAQDRERAGLLAKRLGLTIELAD |
Ga0187809_101761912 | 3300017937 | Freshwater Sediment | GALHHVRFTRATGGYSPRDRQRAAGLAASLGLSVELAG |
Ga0187808_105358921 | 3300017942 | Freshwater Sediment | KRIKLVRADGLPLGGALHHVRFTRAAGTFSTQDRQRADLLARRLGLTVELAG |
Ga0187817_103179852 | 3300017955 | Freshwater Sediment | LVRADGLPLGGALHHVRFTRAAGTFSTQDRQRADLLARRLGLTVELAG |
Ga0187779_111910992 | 3300017959 | Tropical Peatland | DGLPLGGALHHVRFTRGTFTAQDRQRAGLLAKRLGLTVELAG |
Ga0187783_102087391 | 3300017970 | Tropical Peatland | HHVRFTRTSGPFTDTERDRAHLLAKRLGVTLELAG |
Ga0187783_103456032 | 3300017970 | Tropical Peatland | RIRLLHRDGLPLGGALHHVRFTRASGAFSDEEQDRALLLAKRLGVTLELAS |
Ga0187783_113598742 | 3300017970 | Tropical Peatland | ALHHVRFARAAGAFTAQESERAGLLAKRLGLAVELAG |
Ga0187781_100814451 | 3300017972 | Tropical Peatland | PGGKRIRLARRDGLPLGGAVHHIRFARLHGAFSARDRQRAGLLATRLGLTVELAG |
Ga0187781_104453952 | 3300017972 | Tropical Peatland | RLRLVRADGMPLGGALYRIRFTRTAGAFGTRERERADLLAKRLGLTVELAG |
Ga0187780_102354882 | 3300017973 | Tropical Peatland | IRLVREHGLPLGGALHHVGFARGTFTAQDRQRAGLLAKRLGLTVELAG |
Ga0187780_107407482 | 3300017973 | Tropical Peatland | VHEDSLPLGGALHHIRFARTKGSFSAQDGERADLLARRLGLTVELAWLEPR |
Ga0187823_100960501 | 3300017993 | Freshwater Sediment | LRLVREAGLPRGGALHHVRFTRAEGTFGTSETERAALLAKRLGVTIELAC |
Ga0187816_104172381 | 3300017995 | Freshwater Sediment | LRLVRAGGLPRGGALHHVRFTRAEGAFAASDHERAGLLGKRLGLTVELAS |
Ga0187863_102952171 | 3300018034 | Peatland | IRLVHEDGLPLGGALHRIRFTRAEDAFSTQDKERAGLLAKRLSLMVDLAG |
Ga0187871_100713123 | 3300018042 | Peatland | KRIRLVHQDGLPLGGALHHIGFSRAAGAFSTQDKERADLLAKRLGLMVDLAG |
Ga0187766_105929461 | 3300018058 | Tropical Peatland | GGTLHRVRFTRAEGAFSAQDTGRAALLAKRLGLTVELAS |
Ga0187769_104998551 | 3300018086 | Tropical Peatland | VARQDGLPLVGAVQHIRFARAQGAFSARDRERAGLLATRLGLTVELADQG |
Ga0187770_111244852 | 3300018090 | Tropical Peatland | RLVREGGLPRGGALHHVRFTRAEGTFGSSDTERAALLAKRLGLTVELAS |
Ga0066669_110269563 | 3300018482 | Grasslands Soil | GKRIRLVREEGLPLGGLLHHVRFTCADGSFSAQDRERAGLLAKRLGLTVELAG |
Ga0206355_12476131 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | HQDGLPLGGALHHVCFAREAGVFSVRDRQRAGLLAERLGLTVELAG |
Ga0210403_103662341 | 3300020580 | Soil | RLRLVREDGLARGGVLHHIRFARTEGSFGASDTERAALLAKRLGVTIELAC |
Ga0154015_16169012 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | LVHHDGLPLGGTLHHVRFTREAGVFSVRDRQRAGLLAERLGLTVELAG |
Ga0210400_114439591 | 3300021170 | Soil | LPNGGRLHHVRFTRAAGTFSAQDRERAGLLAKRLGLAVELAPGTAGSP |
Ga0210405_108158852 | 3300021171 | Soil | GAVHHLRFTRAARAFTARDCQRTGLLASGLGLRVELAS |
Ga0210388_108587392 | 3300021181 | Soil | DGLPLGGALHHIRFARVAGAFSSQDRDRADLLAKHLGLTVELAR |
Ga0210397_103075861 | 3300021403 | Soil | RGGALHHVRFSRAEGSFGAADRERAALLAKRLGVTVELAG |
Ga0210386_105198851 | 3300021406 | Soil | NGGRLHHVGFTRAAGTFSAQDRERAGLLAKRLGLAVELAPGTAGSP |
Ga0210383_115180191 | 3300021407 | Soil | LHHIRFARAEGTFGASDTERAALLAKRLGVTIELAC |
Ga0210384_102294401 | 3300021432 | Soil | REDGLPLGGALHHVRFTRVTGAFSTRDRERAGLLARQLGLTLELAG |
Ga0210398_112210471 | 3300021477 | Soil | EDGLPNGGRLHHVRFTRAAGAFSAQDRERAGLLAKRLGLAVELASGTAASP |
Ga0210402_107694642 | 3300021478 | Soil | GLLHHIGFTRADGAFTTQDRQRAGLLAKRLGLTVELAG |
Ga0210402_119209732 | 3300021478 | Soil | GGALHHLRFARATGAFSTQDRERADLLAKPLGLTVELTE |
Ga0126371_121744002 | 3300021560 | Tropical Forest Soil | PHGGALHHIRFTRAAGTYGAQDEERAALLAKRLGLAVELAS |
Ga0242668_11580441 | 3300022529 | Soil | ARGGALHHVRFTRAEGSFGAADRERADLLAKRLGVTVELAG |
Ga0179589_101928284 | 3300024288 | Vadose Zone Soil | GGLLHHVGFTRAGGAFTAQDRERAGLLAKRLGLTVELAG |
Ga0247667_10620591 | 3300024290 | Soil | HHVCFSRADGSFTAQDRQRAGLLAKRLGLTVELAG |
Ga0247668_10221302 | 3300024331 | Soil | GLLHHVCFSRADGSFTAQDRQRAGLLAKRLGLTVELAG |
Ga0207692_100335033 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KRIRLVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG |
Ga0207710_104712511 | 3300025900 | Switchgrass Rhizosphere | GLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG |
Ga0207684_100869233 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVRQDGLARGGTLHHIRFARAEGSFGAGDRERASLLAKRLGVMVELAG |
Ga0207707_112236992 | 3300025912 | Corn Rhizosphere | RLVHEDGLPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG |
Ga0207646_111516192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DDLPLGGALHHVRFSRAAGTFSAQDRERAAPLARRLGLTVELAG |
Ga0207687_101021743 | 3300025927 | Miscanthus Rhizosphere | EEGLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG |
Ga0207700_112815691 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DGLPLGGALHHVGFSRAAGAFTAPDRERAARLASRLGLTVELAG |
Ga0207711_112035271 | 3300025941 | Switchgrass Rhizosphere | RIRLVREDGLPLGGLLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG |
Ga0207639_101428611 | 3300026041 | Corn Rhizosphere | GLPLGGLLHHIRFSRADGSFSAQDRQRAGLLAKRLGLTVELAG |
Ga0207639_110717083 | 3300026041 | Corn Rhizosphere | LPLGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG |
Ga0207676_100460511 | 3300026095 | Switchgrass Rhizosphere | LLHHVRFSRADGSFTAQDRQRAGLLAKRLGLTVELAG |
Ga0207698_109932771 | 3300026142 | Corn Rhizosphere | LGGALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG |
Ga0209863_101703161 | 3300026281 | Prmafrost Soil | DGLPLGGGLHHLRFTRAAGAFTAQDAECAGLAAKHLGLTLELAG |
Ga0209801_13171781 | 3300026326 | Soil | KRIRLVREEGLPLGGLLHHVCFTRAGGAFTTQDRERAGLLAKRLGLTVELAG |
Ga0208237_10723292 | 3300027080 | Forest Soil | GALHHVRFSRAEGSFGAADRERAALLAKRLGVTVELAG |
Ga0208099_10185431 | 3300027096 | Forest Soil | LVRQDGLPLGGALHHVGFTRTSGAFSAQERDRAHLLAKRLGLALELAG |
Ga0208099_10455441 | 3300027096 | Forest Soil | GLPRGGALHHVRFARAAGTFTAGDRERAGLLAKRLGVRVELAV |
Ga0208725_10176881 | 3300027158 | Forest Soil | PHGGALHHIRFARAQGTFSERDRDRAGPLARRLGLTVDLAGGLPPA |
Ga0208729_1116591 | 3300027166 | Forest Soil | ALHHIRFTRASGAFSTQECERARLLSKRLGLTLELAD |
Ga0209529_10078921 | 3300027334 | Forest Soil | LVRQDGLPLGGAPHHLRFTRTPGAFSAQERDRAHLLAKRLGLTLELAG |
Ga0207826_10644371 | 3300027680 | Tropical Forest Soil | GLPLGGAMHHIRFARVHGRFSAQDRQRAGLLAKRLGLTIELAD |
Ga0207862_10860751 | 3300027703 | Tropical Forest Soil | KRIRLVREDGLPLGGAMHHIRFARVHGRFSAQDRQRAGLLAKRLGLTIELAD |
Ga0209178_11524323 | 3300027725 | Agricultural Soil | REDGLPLGGLLHHVRFGRVDGSFSAQDRQRAGLLAKRLGLTVELAG |
Ga0209040_102663363 | 3300027824 | Bog Forest Soil | EDGLARGGVLHHIRFARAEGTFGASDTKRAALLAKRLGVTIELTC |
Ga0209517_100129911 | 3300027854 | Peatlands Soil | GLPLGGSLHHVRFTRADGAFSGQDSERAGLLAKRLGLAVELAS |
Ga0209579_105862441 | 3300027869 | Surface Soil | RADGLPNGGRLHHVRFCRAAGTFSAQDRERAALLAKRLGLTVELGQG |
Ga0209624_102951382 | 3300027895 | Forest Soil | RDGLARGGALHHVRFTRTEGSFGAGDRERAALLAKRLGVTVELAG |
Ga0209415_101378793 | 3300027905 | Peatlands Soil | DGPPLGGSLHHVRFTRADGAFSAQDRERASLLAKRLGLAVELAVTRHSP |
Ga0209415_107113891 | 3300027905 | Peatlands Soil | REDGLPLGGSLHYVRFTRTDGAFSGQDSERAGLLAKRLGLTVELARP |
Ga0247689_10678511 | 3300028281 | Soil | ALHHVSFTRTAGEFSAQDRERAGLLAKRLGVGLELGG |
Ga0307317_103467421 | 3300028720 | Soil | GGKRIRLVREDGLPLGGLLHHVRFTRANGAFSAQDRERAGLLAKRLGLTVELAG |
Ga0302224_102427792 | 3300028759 | Palsa | LGGALHHIRFSRAAAAFSTQDKERAGLLAKRLGLMVDLDG |
Ga0302234_101500591 | 3300028773 | Palsa | LHRIRFTRVAGAFSTQDTERAGLLAKRLGLMVDLAG |
Ga0307308_103664531 | 3300028884 | Soil | LGGLLHHIRFSRADGAFSAQDRQRAGLLAKRLGLTVELAG |
Ga0308309_110618221 | 3300028906 | Soil | VREDGLPLGGSLHHVRFPRTEGAFGAQDRERAGLLAKRLGLAVELAG |
Ga0311371_104378401 | 3300029951 | Palsa | RLVREDGLAREDGLARGGALHHIRFTRAEGTFGASDRERAALLAKRLGLRVELAG |
Ga0311339_117656171 | 3300029999 | Palsa | ALHHIRFTRAAGAFSTHDTERSGLLAKRLGLMVDLAG |
Ga0302178_103070211 | 3300030013 | Palsa | LVREDGLPRGGALHHVRFARTHGAFSAADSGRVAEGAKRLGLTIELAQ |
Ga0310037_103086132 | 3300030494 | Peatlands Soil | LPLGGSLHHVRFTRADGAFSGQDRERAGLLAKRLGLAVELAS |
Ga0311356_118247202 | 3300030617 | Palsa | LPDGLPLGGALHHVRFTRAAGAFSTQDKQRAGLLAKRLGLTVDLSG |
Ga0311354_105515911 | 3300030618 | Palsa | GGALHHIRFTRAAGAFSTGEKERTGLLAKRLGLRVELAS |
Ga0302317_102910032 | 3300030677 | Palsa | LHHIRFSRAAAAFSTQDKERAGLLAKRLGLMVDLDG |
Ga0307482_10605193 | 3300030730 | Hardwood Forest Soil | ARGGVLHHIRFARTEGSFGASDAERAALLAKRLGVTIELAC |
Ga0302180_104026491 | 3300031028 | Palsa | KRIRLVREDGLPLGGALHHIRFTRGAGAFSTQDKDRAGLLAKRLGVMVDLAG |
Ga0307498_101326351 | 3300031170 | Soil | HHVRFTRAGGAFSAPDRERAALLAKRLGLTVELAD |
Ga0302307_100535331 | 3300031233 | Palsa | GLPLGGALHRIRFTRVAGAFSTQDTERAGLLAKRLGLMVDLAG |
Ga0302324_1021434992 | 3300031236 | Palsa | EAGLPLGGALHHLRFARVTGAFSAQERERADLLAKRLGLTVELAG |
Ga0318534_106006622 | 3300031544 | Soil | SLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG |
Ga0318538_103752772 | 3300031546 | Soil | FGGAMHHVRFARAAGAFSSQDRERADLLARRLGLTVELAG |
Ga0318571_101107051 | 3300031549 | Soil | DGVPRGGLLHHVRFTREDGTFGAGDQDRAALLAKRLGVTVELAG |
Ga0318571_102060881 | 3300031549 | Soil | GLPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG |
Ga0318528_104625791 | 3300031561 | Soil | DGLPLGGAVHHLRFARVHGTFTAQDRRRSDLLAKRLDLTIELK |
Ga0318515_100945703 | 3300031572 | Soil | LLHHVRFTRTDGTFGAGDQERAALLAKRLGVTVELAG |
Ga0318574_106424251 | 3300031680 | Soil | RLVREDGLPLGGAVHHLRFARVHGTFTAQDRRRSDLLAKRLGLTIELK |
Ga0318572_101541842 | 3300031681 | Soil | PLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG |
Ga0310686_1002339941 | 3300031708 | Soil | RLVRQNGLARGGALHHVRFTRAEGSFGAGDRERAALLAKRLGVTVELAR |
Ga0310686_1027394691 | 3300031708 | Soil | RGGALHHVRFSRAEGSFGAADRERADLLAKRLGVTVELAG |
Ga0310686_1067332441 | 3300031708 | Soil | QDGLARGGALHHVRFSRAEGRFGAAERERADLLAKRLGVTVELAG |
Ga0310686_1069103191 | 3300031708 | Soil | HHVRFTRAEGAFGASDRERAALLAKRLGLTVELAD |
Ga0310686_1138807832 | 3300031708 | Soil | PHGGALHHIRFARVHGTFTDRDRDRASLLAKRLGTTVDLAALA |
Ga0310686_1143120422 | 3300031708 | Soil | GKRIRLVREDGLPLGGALHHVRFSRAAGTFSAQDRERAAPLASRLGLTVELAG |
Ga0318496_101135391 | 3300031713 | Soil | GGAVHHLRFARVHGTFTAQDRRRSDLLAKRLGLTIELK |
Ga0307474_103905971 | 3300031718 | Hardwood Forest Soil | GGALHHVRFSRAEGSFGAADRERAALLAKRLGVTVELAG |
Ga0306917_107440001 | 3300031719 | Soil | LHHVRFTRTDGTFGAGDQERAALLAKRLGVTVELAG |
Ga0318493_100438281 | 3300031723 | Soil | GLPLGGALHHVRFTRAGGSFGVQDRERAGLLAKRLGLTVQLA |
Ga0318493_108027461 | 3300031723 | Soil | GGALHHVRFTRTDGTFGTGDTERAALLAKRLGLAVELAT |
Ga0306918_100242566 | 3300031744 | Soil | VREDGLPLGGALHHVRFTRAAGAFSAQDRERAGLLAKRLGLGLELAASA |
Ga0318502_109862981 | 3300031747 | Soil | PRGGALHHVRFTRAEGTFGAGDTERAPLLAKRLGLAVELTS |
Ga0318535_100383281 | 3300031764 | Soil | ALHHVRFTRAAAAFSTDDRERAGLLAGHLGLTVELAG |
Ga0318526_102743431 | 3300031769 | Soil | LLHHVRFTREDGTFGAGDQDRAALLAKRLGVTVELAG |
Ga0318546_103505571 | 3300031771 | Soil | IRLVREDGLPLGGVLHHVRFTRAEGTFSVQDRERAGLLAKRLGVTVELAG |
Ga0318552_100325381 | 3300031782 | Soil | TRSDGTFGAQDRERAGLLAKRLGVTVELAGLAGER |
Ga0318550_106452781 | 3300031797 | Soil | IRLVREDGLPLGGAVHHIGFARVHGTFSTQDRQRAGLLAKRLGLAIELAG |
Ga0318565_103776371 | 3300031799 | Soil | VREDGLARGGALHHVRFTRTDGTFGTGDTERAALLAKRLGLAVELAT |
Ga0318568_106338772 | 3300031819 | Soil | GALHHVRFTRADGTFGAGDQERAALLAKRLGVTIDLAG |
Ga0318564_100535781 | 3300031831 | Soil | LHHVRFTRAAAAFSTDDRERAGLLAGHLGLTVELAG |
Ga0318499_102170701 | 3300031832 | Soil | LVREDGLPLGGSLHHVSFTRAEGTFGAQDRERAGLLAKRLGVTVELAGLAGER |
Ga0318512_104068893 | 3300031846 | Soil | ALHHVRFTRAGGSFGVQDRERAGLLAKRLGLTVQLA |
Ga0318512_107502432 | 3300031846 | Soil | IKLVRADGLPLGGALHRVRFTRAAAAFSTRDRERAGLLAVPLGLTVELGG |
Ga0306925_112288541 | 3300031890 | Soil | GALHHVRFTRAAGAFSAQDRERASLLAKRLGLAVELAG |
Ga0318522_101262303 | 3300031894 | Soil | GGKRIRLVREDGLPLDGAVHHLRFARVHGTFTAQDRRRSDLLAKRLGLTIELK |
Ga0318551_104422461 | 3300031896 | Soil | ALHHVRFTRADGTFSVGDRERAALLAKRLGVVVELAS |
Ga0306923_121218011 | 3300031910 | Soil | GSLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG |
Ga0306921_113250461 | 3300031912 | Soil | KRIKLVRADGLPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG |
Ga0306921_122561543 | 3300031912 | Soil | GKRIRLVREDGLPLGGALHHVRFTRVGDSFGVQDRERAGLLAKRLGLTVELAR |
Ga0310912_106489361 | 3300031941 | Soil | RLVREDGLARGGALHHVRFTRTDGTFGTGDTERAALLAKRLGVTVELAG |
Ga0306926_104403821 | 3300031954 | Soil | EDGLPRGGALHHLRFTRAEGTFGAGDQERAALLAKRLGLRIDLAG |
Ga0306922_104432941 | 3300032001 | Soil | RLVREDGLPLGGSLHHVSFTRAEGTFGAQDRERAGLLAKRLGVTVELAGLAGER |
Ga0318563_101203521 | 3300032009 | Soil | RIRLVREDGLPLGGSLHHVSFTRAEGTFGAQDRERAGLLAKRVGVTVELAGLARER |
Ga0318569_101073291 | 3300032010 | Soil | LPPGGAVHHLRFARVHGTFTARDRRRSDLLAKRLGLTIELK |
Ga0318559_100402553 | 3300032039 | Soil | LVREDGLPLGGALHHIRFTRAAAAFSTDDRERAGLLAGHLGLTVELAG |
Ga0318556_104265451 | 3300032043 | Soil | LVREDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG |
Ga0318558_102639203 | 3300032044 | Soil | HHVRFSRAAGSFSTEDRERAASLASRLGLTVQLAG |
Ga0318558_104913901 | 3300032044 | Soil | LGGALHHICFTRAAAAFSTDDRERAGLLAGHLGLTVELAG |
Ga0318513_101328433 | 3300032065 | Soil | IRLVREGGLPRGGALHHVRFTRADGTFSVGDRERAALLAKRLGVVVELAS |
Ga0318553_100363911 | 3300032068 | Soil | GLLHHVRFTRTDGTFGAGDQERAALLAKRLGVTVELAG |
Ga0308173_117895151 | 3300032074 | Soil | RLVREDGLPLGGSLHHVRFTRAEGTFTAQDRERAGLLAKRLGLAVELA |
Ga0306924_106915902 | 3300032076 | Soil | LPLGGALHHIRFTRALAAFSDGDRERAGLLAKDLGLTVELAG |
Ga0306924_126140452 | 3300032076 | Soil | EGLRGGAVRRVRFTRARGAFGAQDRERAALLAKRLGLTLELG |
Ga0318525_104689831 | 3300032089 | Soil | ALHHVRFTRAEGTFGAGDTERAPLLAKRLGLAVELTS |
Ga0318518_103131993 | 3300032090 | Soil | AVHHIGFARVHGTFSTQDRQRAGLLAKRLGLAIELAG |
Ga0311301_111010531 | 3300032160 | Peatlands Soil | RLVREDGLPLGGSLHHVRFTRADGAFSGQDSERAGLLAKRLGLTVELARS |
Ga0307470_113389841 | 3300032174 | Hardwood Forest Soil | PLGGLLHHVRFTRADGAFSAQDRERAGLLAKRLGLTVELAG |
Ga0306920_1032300251 | 3300032261 | Soil | RLVRKDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGLTVELAG |
Ga0335085_111965942 | 3300032770 | Soil | KRIRLVREDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGVTVELAG |
Ga0335082_113718821 | 3300032782 | Soil | KRIRLVREDGLPLGGSLHHVRFTRAEGAFGAQDRERAGLLAKRLGLTVEAAG |
Ga0335079_109406412 | 3300032783 | Soil | IREDGLPLGGSLHHVRFSRAEGAFGAQDRERAGLLAKRLGLTVDLA |
Ga0335078_101499708 | 3300032805 | Soil | GGALHHIRFTRAAGAFSARDLERASLLAKRLGLDVELAG |
Ga0335078_113971361 | 3300032805 | Soil | GKRIRLVREDGLPLGGSLHHVRFTRAEGTFSAQERERAGLLAKRLGVTVELAG |
Ga0335080_103454093 | 3300032828 | Soil | VREEGLPLGGSLHHVRFTRADGAFGAQDRERAGLLAKRLGLTVELAR |
Ga0335081_116324711 | 3300032892 | Soil | VREDGLPLGGSLHHVRFTRAEGAFSAQDRERAGLLAKRLGVTVELAG |
Ga0335081_118572041 | 3300032892 | Soil | PLGGVLHHVRFTRAGGAFSAQDRERAALLAKRLGLTVELAASTGP |
Ga0335069_100949484 | 3300032893 | Soil | GGSLHHVRFTRTEGAFSAQDRERAGLLAKRLGLAVELAD |
Ga0335075_103275701 | 3300032896 | Soil | EDGLPRGGALHHVRFTRAEGTFGASDHERTALLAKRLGLTVELAG |
Ga0335076_105562121 | 3300032955 | Soil | LRLVRAEGLPLGGALHHVRFSRSAGAFSAADRERTAELASRLGVTVELAG |
Ga0335073_109285442 | 3300033134 | Soil | LGGALHHIRFARAAGAFSSQEREHADPLAKRLGLTVELAG |
Ga0318519_102892023 | 3300033290 | Soil | LARGGALHHVRFTRTDGTFGTGDTERAALLAKRLGLAVELAS |
Ga0370515_0333368_3_125 | 3300034163 | Untreated Peat Soil | LGGALHHIRFARAAGAFSTQDKERAGLLAKRLGLMVDLAD |
Ga0370514_075059_2_121 | 3300034199 | Untreated Peat Soil | GGALHHVRFTRAARSFSSQEREHAGPLARHIGLTVELAG |
⦗Top⦘ |