NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019314

Metagenome / Metatranscriptome Family F019314

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019314
Family Type Metagenome / Metatranscriptome
Number of Sequences 230
Average Sequence Length 44 residues
Representative Sequence MKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA
Number of Associated Samples 155
Number of Associated Scaffolds 230

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.11 %
% of genes near scaffold ends (potentially truncated) 23.91 %
% of genes from short scaffolds (< 2000 bps) 68.70 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (53.043 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(17.391 % of family members)
Environment Ontology (ENVO) Unclassified
(36.957 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.522 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.86%    β-sheet: 0.00%    Coil/Unstructured: 90.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 230 Family Scaffolds
PF13692Glyco_trans_1_4 0.87
PF03796DnaB_C 0.87
PF13252DUF4043 0.87
PF04545Sigma70_r4 0.43
PF02767DNA_pol3_beta_2 0.43
PF13522GATase_6 0.43
PF13362Toprim_3 0.43
PF01555N6_N4_Mtase 0.43
PF01930Cas_Cas4 0.43
PF01391Collagen 0.43
PF03237Terminase_6N 0.43
PF00534Glycos_transf_1 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 230 Family Scaffolds
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.87
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.87
COG0592DNA polymerase III sliding clamp (beta) subunit, PCNA homologReplication, recombination and repair [L] 0.43
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.43
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.43
COG1468CRISPR/Cas system-associated exonuclease Cas4, RecB familyDefense mechanisms [V] 0.43
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.13 %
UnclassifiedrootN/A40.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001267|B570J13875_101025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71678Open in IMG/M
3300001838|RCM33_1058583Not Available600Open in IMG/M
3300001842|RCM30_1023386Not Available833Open in IMG/M
3300001968|GOS2236_1066412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71677Open in IMG/M
3300003277|JGI25908J49247_10009807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72988Open in IMG/M
3300003431|JGI25913J50563_1032183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7818Open in IMG/M
3300003499|JGI25930J51415_1006531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72442Open in IMG/M
3300003499|JGI25930J51415_1008726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2083Open in IMG/M
3300004151|Ga0066602_10233813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7802Open in IMG/M
3300004240|Ga0007787_10356178Not Available727Open in IMG/M
3300004796|Ga0007763_11595166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7755Open in IMG/M
3300005417|Ga0068884_1589117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7574Open in IMG/M
3300005418|Ga0068881_1625811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7655Open in IMG/M
3300005420|Ga0068879_1723956Not Available716Open in IMG/M
3300005525|Ga0068877_10005107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-710145Open in IMG/M
3300005525|Ga0068877_10171690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71313Open in IMG/M
3300005525|Ga0068877_10680264Not Available552Open in IMG/M
3300005525|Ga0068877_10774831Not Available508Open in IMG/M
3300005527|Ga0068876_10297229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7917Open in IMG/M
3300005527|Ga0068876_10433342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7729Open in IMG/M
3300005581|Ga0049081_10350234Not Available501Open in IMG/M
3300005582|Ga0049080_10281306Not Available539Open in IMG/M
3300005585|Ga0049084_10106045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71006Open in IMG/M
3300005739|Ga0076948_1146828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71287Open in IMG/M
3300005758|Ga0078117_1023386Not Available1497Open in IMG/M
3300005805|Ga0079957_1004722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-711264Open in IMG/M
3300005805|Ga0079957_1014398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5783Open in IMG/M
3300005805|Ga0079957_1025753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-73988Open in IMG/M
3300006018|Ga0068875_1026726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7524Open in IMG/M
3300006030|Ga0075470_10000833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-79739Open in IMG/M
3300006030|Ga0075470_10012423All Organisms → Viruses → Predicted Viral2625Open in IMG/M
3300006637|Ga0075461_10001343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-77697Open in IMG/M
3300006637|Ga0075461_10063334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71188Open in IMG/M
3300006637|Ga0075461_10199845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7599Open in IMG/M
3300006641|Ga0075471_10601526Not Available539Open in IMG/M
3300006802|Ga0070749_10002139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-713301Open in IMG/M
3300006802|Ga0070749_10016439All Organisms → Viruses → Predicted Viral4715Open in IMG/M
3300006803|Ga0075467_10240714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7986Open in IMG/M
3300006805|Ga0075464_10078177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71874Open in IMG/M
3300006805|Ga0075464_10325873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7927Open in IMG/M
3300006805|Ga0075464_10706960Not Available624Open in IMG/M
3300006874|Ga0075475_10194370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7872Open in IMG/M
3300006875|Ga0075473_10428291Not Available534Open in IMG/M
3300006916|Ga0070750_10106272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71297Open in IMG/M
3300006920|Ga0070748_1369070Not Available504Open in IMG/M
3300007171|Ga0102977_1169185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71287Open in IMG/M
3300007177|Ga0102978_1008791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-79768Open in IMG/M
3300007212|Ga0103958_1027822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71192Open in IMG/M
3300007214|Ga0103959_1172221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71291Open in IMG/M
3300007234|Ga0075460_10137255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7859Open in IMG/M
3300007304|Ga0102689_1144704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71113Open in IMG/M
3300007363|Ga0075458_10188838Not Available633Open in IMG/M
3300007538|Ga0099851_1274419Not Available599Open in IMG/M
3300007539|Ga0099849_1298584Not Available582Open in IMG/M
3300007542|Ga0099846_1001027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-711503Open in IMG/M
3300007640|Ga0070751_1038757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72144Open in IMG/M
3300007735|Ga0104988_10949Not Available42398Open in IMG/M
3300007960|Ga0099850_1028057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72472Open in IMG/M
3300007974|Ga0105747_1163861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7722Open in IMG/M
3300008072|Ga0110929_1033649Not Available548Open in IMG/M
3300008108|Ga0114341_10512154Not Available539Open in IMG/M
3300008108|Ga0114341_10534212Not Available521Open in IMG/M
3300008110|Ga0114343_1017357Not Available3274Open in IMG/M
3300008114|Ga0114347_1058570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72401Open in IMG/M
3300008116|Ga0114350_1017878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-73541Open in IMG/M
3300008119|Ga0114354_1070933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71441Open in IMG/M
3300008120|Ga0114355_1150699Not Available825Open in IMG/M
3300008120|Ga0114355_1172791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7735Open in IMG/M
3300008259|Ga0114841_1035294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72535Open in IMG/M
3300008259|Ga0114841_1075218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71548Open in IMG/M
3300008263|Ga0114349_1258102Not Available556Open in IMG/M
3300008266|Ga0114363_1140384Not Available1221Open in IMG/M
3300008266|Ga0114363_1190674Not Available640Open in IMG/M
3300008448|Ga0114876_1005230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-78271Open in IMG/M
3300008448|Ga0114876_1024363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-73068Open in IMG/M
3300008450|Ga0114880_1214914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7631Open in IMG/M
3300008510|Ga0110928_1000741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71511Open in IMG/M
3300009166|Ga0105100_10810684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7581Open in IMG/M
3300010293|Ga0116204_1070548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71256Open in IMG/M
3300010354|Ga0129333_10009115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-79373Open in IMG/M
3300010354|Ga0129333_10132768All Organisms → Viruses → Predicted Viral2289Open in IMG/M
3300010354|Ga0129333_10806356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7800Open in IMG/M
3300010354|Ga0129333_10968291Not Available717Open in IMG/M
3300010354|Ga0129333_11033014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7689Open in IMG/M
3300010354|Ga0129333_11253566Not Available614Open in IMG/M
3300010354|Ga0129333_11276128Not Available608Open in IMG/M
3300010354|Ga0129333_11335978Not Available591Open in IMG/M
3300010354|Ga0129333_11479534Not Available557Open in IMG/M
3300010354|Ga0129333_11581816Not Available535Open in IMG/M
3300010368|Ga0129324_10285142Not Available652Open in IMG/M
3300010370|Ga0129336_10347974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7816Open in IMG/M
3300010370|Ga0129336_10730616Not Available523Open in IMG/M
3300010970|Ga0137575_10084136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli508Open in IMG/M
3300011116|Ga0151516_10359Not Available23418Open in IMG/M
3300011334|Ga0153697_1040Not Available39767Open in IMG/M
3300011381|Ga0102688_1646177Not Available513Open in IMG/M
3300012012|Ga0153799_1001720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6246Open in IMG/M
3300012970|Ga0129338_1109408Not Available611Open in IMG/M
3300012970|Ga0129338_1564261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7841Open in IMG/M
(restricted) 3300013122|Ga0172374_1067272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71421Open in IMG/M
(restricted) 3300013123|Ga0172368_10121523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71470Open in IMG/M
(restricted) 3300013130|Ga0172363_11049813Not Available502Open in IMG/M
(restricted) 3300013131|Ga0172373_10060600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-73147Open in IMG/M
(restricted) 3300013131|Ga0172373_10466392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7774Open in IMG/M
(restricted) 3300013132|Ga0172372_10023817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4406869Open in IMG/M
(restricted) 3300013132|Ga0172372_10978636Not Available512Open in IMG/M
(restricted) 3300014720|Ga0172376_10011186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-78932Open in IMG/M
3300014819|Ga0119954_1002573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-75452Open in IMG/M
3300014962|Ga0134315_1007615Not Available1764Open in IMG/M
3300017785|Ga0181355_1332027Not Available563Open in IMG/M
3300017788|Ga0169931_10052214All Organisms → Viruses → Predicted Viral4380Open in IMG/M
3300017963|Ga0180437_10703014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7733Open in IMG/M
3300019784|Ga0181359_1102359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71048Open in IMG/M
3300019784|Ga0181359_1136096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7860Open in IMG/M
3300020074|Ga0194113_10103545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72485Open in IMG/M
3300020074|Ga0194113_10204603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → unclassified Micavibrio → Micavibrio sp. TMED21576Open in IMG/M
3300020074|Ga0194113_10511733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7860Open in IMG/M
3300020083|Ga0194111_10094642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72419Open in IMG/M
3300020183|Ga0194115_10006932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-711375Open in IMG/M
3300020205|Ga0211731_11088133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-73124Open in IMG/M
3300020519|Ga0208223_1040401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7562Open in IMG/M
3300020541|Ga0208359_1044647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7662Open in IMG/M
3300020570|Ga0208465_1004802All Organisms → Viruses → Predicted Viral2174Open in IMG/M
3300021959|Ga0222716_10744844Not Available515Open in IMG/M
3300021963|Ga0222712_10177994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71411Open in IMG/M
3300022063|Ga0212029_1002655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71748Open in IMG/M
3300022063|Ga0212029_1019372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7906Open in IMG/M
3300022063|Ga0212029_1028108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7780Open in IMG/M
3300022176|Ga0212031_1072554Not Available585Open in IMG/M
3300022179|Ga0181353_1012868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2135Open in IMG/M
3300022179|Ga0181353_1091395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7757Open in IMG/M
3300022179|Ga0181353_1095869Not Available734Open in IMG/M
3300022179|Ga0181353_1149535Not Available538Open in IMG/M
3300022190|Ga0181354_1237973Not Available524Open in IMG/M
3300022198|Ga0196905_1003216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-76031Open in IMG/M
3300022200|Ga0196901_1002027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-79915Open in IMG/M
3300022200|Ga0196901_1089259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71088Open in IMG/M
3300022747|Ga0228703_1093733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7712Open in IMG/M
3300022748|Ga0228702_1078686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7814Open in IMG/M
3300022752|Ga0214917_10000825Not Available40273Open in IMG/M
3300022752|Ga0214917_10000832Not Available40122Open in IMG/M
3300022752|Ga0214917_10001761Not Available27573Open in IMG/M
3300022752|Ga0214917_10033356All Organisms → Viruses → Predicted Viral3807Open in IMG/M
3300022929|Ga0255752_10310785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7663Open in IMG/M
3300023179|Ga0214923_10629339Not Available503Open in IMG/M
3300024276|Ga0255205_1014450All Organisms → Viruses → Predicted Viral1340Open in IMG/M
3300024289|Ga0255147_1000186Not Available24243Open in IMG/M
3300024289|Ga0255147_1025440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71222Open in IMG/M
3300024298|Ga0255178_1049290Not Available820Open in IMG/M
3300024306|Ga0255148_1016468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71442Open in IMG/M
3300024350|Ga0255167_1026508Not Available1094Open in IMG/M
3300024351|Ga0255141_1013706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71262Open in IMG/M
3300024351|Ga0255141_1064131Not Available535Open in IMG/M
3300024357|Ga0255165_1010730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71798Open in IMG/M
3300024482|Ga0255265_1091959Not Available584Open in IMG/M
3300024496|Ga0255151_1021339Not Available1132Open in IMG/M
3300024496|Ga0255151_1034642Not Available854Open in IMG/M
3300024500|Ga0255143_1011002Not Available1535Open in IMG/M
3300024502|Ga0255181_1051425Not Available706Open in IMG/M
3300024503|Ga0255152_1088344Not Available525Open in IMG/M
3300024504|Ga0255179_1040522Not Available651Open in IMG/M
3300024541|Ga0256343_1026366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71048Open in IMG/M
3300024556|Ga0256341_1089830Not Available610Open in IMG/M
3300024557|Ga0255283_1093792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7645Open in IMG/M
3300024561|Ga0255288_1088431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7693Open in IMG/M
3300024573|Ga0256337_1170417Not Available539Open in IMG/M
3300024864|Ga0255271_1073231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7750Open in IMG/M
3300025630|Ga0208004_1088705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7752Open in IMG/M
3300025635|Ga0208147_1070276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7874Open in IMG/M
3300025646|Ga0208161_1180087Not Available501Open in IMG/M
3300025732|Ga0208784_1249066Not Available511Open in IMG/M
3300025889|Ga0208644_1002434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-714872Open in IMG/M
3300025889|Ga0208644_1346869Not Available568Open in IMG/M
3300025896|Ga0208916_10413959Not Available588Open in IMG/M
3300027467|Ga0255154_1102979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7616Open in IMG/M
3300027659|Ga0208975_1162447Not Available617Open in IMG/M
3300027739|Ga0209575_10336666Not Available516Open in IMG/M
3300027793|Ga0209972_10001172Not Available23464Open in IMG/M
3300027793|Ga0209972_10002210Not Available16100Open in IMG/M
3300027793|Ga0209972_10007782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-77510Open in IMG/M
3300027793|Ga0209972_10171575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71024Open in IMG/M
3300027793|Ga0209972_10218025Not Available875Open in IMG/M
3300027805|Ga0209229_10000045Not Available40827Open in IMG/M
3300027805|Ga0209229_10033706Not Available2251Open in IMG/M
3300027805|Ga0209229_10312010Not Available692Open in IMG/M
3300027806|Ga0209985_10043193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72562Open in IMG/M
3300027806|Ga0209985_10120778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71323Open in IMG/M
3300027816|Ga0209990_10008774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-76421Open in IMG/M
3300027877|Ga0209293_10102949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71295Open in IMG/M
3300028086|Ga0255201_1007178All Organisms → Viruses → Predicted Viral1939Open in IMG/M
3300028103|Ga0255172_1006729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72315Open in IMG/M
(restricted) 3300028571|Ga0247844_1030487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-73744Open in IMG/M
3300031669|Ga0307375_10489782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7743Open in IMG/M
3300031673|Ga0307377_10920376Not Available594Open in IMG/M
3300031758|Ga0315907_10010314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-79320Open in IMG/M
3300031758|Ga0315907_10087475All Organisms → Viruses → Predicted Viral2681Open in IMG/M
3300031758|Ga0315907_10412701Not Available1086Open in IMG/M
3300031758|Ga0315907_10722379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7754Open in IMG/M
3300031758|Ga0315907_10993853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7606Open in IMG/M
3300031758|Ga0315907_11023608Not Available594Open in IMG/M
3300031758|Ga0315907_11135495Not Available552Open in IMG/M
3300031787|Ga0315900_10010309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-711716Open in IMG/M
3300031787|Ga0315900_10432155Not Available1025Open in IMG/M
3300031857|Ga0315909_10309035Not Available1177Open in IMG/M
3300031951|Ga0315904_10001961Not Available32357Open in IMG/M
3300031951|Ga0315904_10012459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-710735Open in IMG/M
3300031951|Ga0315904_10143023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72435Open in IMG/M
3300031951|Ga0315904_10146828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-72396Open in IMG/M
3300031951|Ga0315904_10322487Not Available1436Open in IMG/M
3300031951|Ga0315904_10901853Not Available713Open in IMG/M
3300031951|Ga0315904_11358744Not Available533Open in IMG/M
3300032050|Ga0315906_10731813Not Available788Open in IMG/M
3300032116|Ga0315903_10003081All Organisms → cellular organisms → Bacteria23501Open in IMG/M
3300032116|Ga0315903_10034182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-75390Open in IMG/M
3300032116|Ga0315903_10328115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71279Open in IMG/M
3300032116|Ga0315903_10329357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71275Open in IMG/M
3300032116|Ga0315903_10503008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7956Open in IMG/M
3300032116|Ga0315903_10517925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7937Open in IMG/M
3300032116|Ga0315903_10730197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7735Open in IMG/M
3300033418|Ga0316625_100136533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71481Open in IMG/M
3300033485|Ga0316626_12135004Not Available508Open in IMG/M
3300033521|Ga0316616_101300831Not Available931Open in IMG/M
3300034072|Ga0310127_012560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-75876Open in IMG/M
3300034092|Ga0335010_0198959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-71224Open in IMG/M
3300034112|Ga0335066_0000402Not Available31023Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.39%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake15.22%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater11.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater10.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.96%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton5.65%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.74%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.74%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.30%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.30%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.30%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.87%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.87%
Water BodiesEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.87%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.87%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.43%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.43%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.43%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.43%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.43%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.43%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.43%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.43%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.43%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.43%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.43%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.43%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001267Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnionEnvironmentalOpen in IMG/M
3300001838Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2aEnvironmentalOpen in IMG/M
3300001842Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2bEnvironmentalOpen in IMG/M
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003431Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004151Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005417Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005418Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005739Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006014Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14EnvironmentalOpen in IMG/M
3300006018Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaGEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007212Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projectsEnvironmentalOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008072Microbial Communities in Water bodies, Singapore - Site MAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008510Microbial Communities in Water bodies, Singapore - Site RAEnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300010293Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300011116Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015NovEnvironmentalOpen in IMG/M
3300011334Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - DaesungEnvironmentalOpen in IMG/M
3300011381Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020541Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024276Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024298Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024350Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300024351Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300024357Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300024482Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024496Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300024500Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024502Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300024503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300024504Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8dEnvironmentalOpen in IMG/M
3300024541Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024556Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024561Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024864Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027529Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027739Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028086Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8hEnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028275Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8dEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J13875_10102543300001267FreshwaterMKKGGREKAPMAKPTEGKKDMKKPAGGKVEFGYAGKARKGKKA*
RCM33_105858323300001838Marine PlanktonMKKGGRAAASMQKPTEGKKDTSKPAKSDVKFGYAPAGRKGKKA*
RCM30_102338633300001842Marine PlanktonMRKGSVAAASMSKPVEGKRDTSKPAGGEVKFGFTAAARKGKSVKVQK*
GOS2236_106641223300001968MarineMKKGGRAKASVQKPTEGPKKAPMPKGGELKFGFAGKARKGKKA*
JGI25908J49247_1000980733300003277Freshwater LakeMNMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA*
JGI25913J50563_103218313300003431Freshwater LakeMKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA*
JGI25930J51415_100653133300003499Freshwater LakeMKKGGRAKAXMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA*
JGI25930J51415_100872613300003499Freshwater LakeSRYCYITRIYCRVGRCKMKKGGRXKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA
Ga0066602_1023381323300004151FreshwaterMNKGSQAKASMQKPTEGKKDTSKPKGGKVDFGYAGTARKGKKA*
Ga0007787_1035617833300004240Freshwater LakeKMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGFAPKGRKGKKA*
Ga0007763_1159516623300004796Freshwater LakeMKKGGRAKAPMAKPTEGKKDMKKPKGGMVKFGYAGKARKGKKA*
Ga0068884_158911723300005417Freshwater LakeMKKGGRAKASVQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA*
Ga0068881_162581123300005418Freshwater LakeMKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGKKA*
Ga0068879_172395633300005420Freshwater LakeMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA*
Ga0068877_1000510793300005525Freshwater LakeMKKGGRAKASVQKPTEGPKKAPMPKGGKVAFGYAAKARKGKKA*
Ga0068877_1017169023300005525Freshwater LakeMNKKGGRAAAPMQQPTKGKMDTKKPAKSDVKFGYAPAGRKGKKA*
Ga0068877_1068026423300005525Freshwater LakeMKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAPAGRKGKKA*
Ga0068877_1077483123300005525Freshwater LakeMKKGGRAEASMAKPTEGKKDMKKPAGGMVKFGYAPAGRKGKKA*
Ga0068876_1029722923300005527Freshwater LakeMKKGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA*
Ga0068876_1033614133300005527Freshwater LakeCYVTRIYCRVGRCEMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA*
Ga0068876_1043334223300005527Freshwater LakeMNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGYAPAGRKGKKA*
Ga0049081_1035023413300005581Freshwater LenticKKGGRAAAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA*
Ga0049080_1028130613300005582Freshwater LenticRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA*
Ga0049084_1010604533300005585Freshwater LenticMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA*
Ga0076948_114682823300005739Lake WaterMKKGGRAAAPVQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA*
Ga0078117_102338613300005758Lake WaterMKKGGRAKAPVQKPTEGSKKAPMPKGGMVKFGYAGKARKGKKA*
Ga0079957_100472253300005805LakeMKKGGRAAASVQQPTKGPMDTSKPKGGKTFFGMAPAGRKGKKA*
Ga0079957_101439843300005805LakeMKKGGRAKAPMAKPVEGKKDMKKPGGKVEFGYAGKARKGKKA*
Ga0079957_102575323300005805LakeMRKGSVASAPVQKPTEGKKDMSKPAGGKVSFGMAPAGRKGKKA*
Ga0073919_103077013300006014SandYITRIYCRLGRCNMNMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA*
Ga0068875_102672623300006018Freshwater LakeMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAK
Ga0075470_1000083323300006030AqueousMKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGFAAKARKGKKA*
Ga0075470_1001242333300006030AqueousMNKKGGRAAAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA*
Ga0075461_1000134323300006637AqueousMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA*
Ga0075461_1006333423300006637AqueousMKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAARKGKKA*
Ga0075461_1019984523300006637AqueousMKKGGRAKAPVQKPTEGKKDMKKPGGKVEFGYAGKARKGKKA*
Ga0075471_1060152623300006641AqueousMKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGYAAKARKGKKA*
Ga0070749_10002139183300006802AqueousGRAAAPVQKPTEGKKDTSKPKGGEVKFGYAPAGRQGKKA*
Ga0070749_1001643923300006802AqueousMKKGGRAKASMKQPTKGPLDTKKPKMADVKFGYAPAARKGKKA*
Ga0075467_1024071413300006803AqueousMNKGSRAAAPMSQPKEGKMDTSKPKGGKVDFGYAGTARKGKKA*
Ga0075464_1007817713300006805AqueousKMKKGGRAKASMAKPTEGKKDTKKPAGPGKALFGFAGKARKGKKA*
Ga0075464_1032587333300006805AqueousMKKGGRAKAMMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA*
Ga0075464_1070696023300006805AqueousMKKGGRAKASMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA*
Ga0075475_1019437013300006874AqueousTRIYCRVGRCKMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA*
Ga0075473_1042829133300006875AqueousMKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA*
Ga0070750_1010627233300006916AqueousMKKGGRAKAPMAKPTEGKKDTSKPAGGEVEFGYAGKARKGKKA*
Ga0070748_136907013300006920AqueousRCKMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA*
Ga0102977_116918543300007171Freshwater LakeMNKKGGRAAAPMQKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA*
Ga0102978_100879123300007177Freshwater LakeMKKGGRAKASMAKPKEGSKKAPMPKGGKVDFGYAAKARKGKKA*
Ga0103958_102782223300007212Freshwater LakeMKKGGRAKAPVQKPTEGSKKAGMPKGGKVAFGYAAKARKGKKA*
Ga0103959_117222123300007214Freshwater LakeMKKGGRAKAPVQKPTEGSKKAGMPKGGKVAFGYAGKARKGKKA*
Ga0075460_1005103213300007234AqueousITRIYCRVGRCKMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA*
Ga0075460_1013725533300007234AqueousLSIAEGGVQMKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA*
Ga0102689_114470423300007304Freshwater LakeMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA*
Ga0075458_1018883833300007363AqueousMKKGGREKAPMQQPTKGKMDTKKPAKSDVKFGYAPAGRKGKKA*
Ga0099851_127441933300007538AqueousMKKGGRAKALMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA*
Ga0099849_129858413300007539AqueousMNMKKGGRAKASMAMPKEGSKSAPKPAGGEVKFGYAGKARKGKKA*
Ga0099846_100102723300007542AqueousMNKGGRAKASVAKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA*
Ga0070751_103875713300007640AqueousMKKGGRAKAPMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA*
Ga0104988_10949133300007735FreshwaterMIKKGKVAKAPMSQPTKGVMDTAKPKGGKVEFGYTPAGRKGTKA*
Ga0099850_102805743300007960AqueousLSIAEGGVQMKKGGRAAAPVQKPTEGKKDTSKTKGGDVKFGYAPAGRKGKKA*
Ga0105747_116386113300007974Estuary WaterMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGK
Ga0110929_103364923300008072Water BodiesMKKGGRAKASVAKPKEGSKKAPMPKGGMVKFGFAGKARKGKKA*
Ga0114341_1051215423300008108Freshwater, PlanktonMKKGGRAKASMAKPTEGKKDTKKPAGGKVEFGYAAKARKGKKA*
Ga0114341_1053421213300008108Freshwater, PlanktonMKKGGRAKAPMAKPTEGKKDMKKPAGGKVEFGYAGKARKGKKA*
Ga0114343_101735713300008110Freshwater, PlanktonVTRIYCRVGRCKMKKGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA*
Ga0114347_105857043300008114Freshwater, PlanktonMKKGGRAAAPMQKPTEGKKDTSRPKGGAVKFGYAPAGRKGKKA*
Ga0114350_101787823300008116Freshwater, PlanktonMMGKGKVAKASMAQPTKGPMDTSKPKGGKVEMGYAGKAKPGKKA*
Ga0114354_107093323300008119Freshwater, PlanktonMKKGGRAKATMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA*
Ga0114355_115069913300008120Freshwater, PlanktonCRVGRCEMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA*
Ga0114355_117279133300008120Freshwater, PlanktonMKKGGRAKAPVQKPTEGPKAAPMPKGGKVDFGYAGKARKGKKA*
Ga0114841_103529423300008259Freshwater, PlanktonMNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGFAPAGRKGKKA*
Ga0114841_107521823300008259Freshwater, PlanktonMKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGEKA*
Ga0114349_125810233300008263Freshwater, PlanktonMKKGGRAKASVAKPTEGSKKAPMPKGGKVDFGYAAKARKGKKA*
Ga0114363_114038413300008266Freshwater, PlanktonRCEMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA*
Ga0114363_119067423300008266Freshwater, PlanktonMKKGGRAKAPMQQPTKGNESAPKPKGGEVKFGYAGKARKGKKA*
Ga0114876_100523013300008448Freshwater LakeKGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA*
Ga0114876_102436343300008448Freshwater LakeMKKGGRAKAPVQKPTEGSKKAAMPKGGKVDFGYAGKARKGKKA*
Ga0114880_121491413300008450Freshwater LakeMMGKGKVAKASMAQPTKGPMDTSKPKGGKVEMGYAGKA
Ga0110928_100074133300008510Water BodiesMKKGGRAKAPMQKPTEGSKKAPMPKGGMVKFGFAAKARKGKKA*
Ga0105100_1081068423300009166Freshwater SedimentMNKGSQANASMQKPTEGKKDTSKPKGGKVDCGYAGTA
Ga0116204_107054823300010293Anoxic Lake WaterMKKGGREKASMAKPTEGKKDTKKPAGGEVKFGYAPAGRKGKKA*
Ga0129333_1000911563300010354Freshwater To Marine Saline GradientMKKGGRAKAPVAKPTEGSTKGASVKGGKVDFGYAAKARKGKKA*
Ga0129333_1013276843300010354Freshwater To Marine Saline GradientKKGGRAAAPMQKPTEGKRDTSKPKGGKVDFGYAPAGRKGKKA*
Ga0129333_1080635623300010354Freshwater To Marine Saline GradientMKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA*
Ga0129333_1096829113300010354Freshwater To Marine Saline GradientKFARANRRLSIAEGGVQVKKGGRAAAPMQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA
Ga0129333_1103301423300010354Freshwater To Marine Saline GradientMKKGGRAKASVAKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA*
Ga0129333_1125356613300010354Freshwater To Marine Saline GradientGGRAKAPMAKPTEGKKDMKKPGGKVEYGFAPKGRKGKKA*
Ga0129333_1127612813300010354Freshwater To Marine Saline GradientSTVTSRHWRSSVGGVTMNKGGRAAAMMSKPIEGPKNAPMPQGGKVEFGYAPAGRKGKKA*
Ga0129333_1133597823300010354Freshwater To Marine Saline GradientMKKGGRAKAMMAKPTEGKKDSKKPAGGKVEFGYAGKARKGKKA*
Ga0129333_1147953423300010354Freshwater To Marine Saline GradientMKKGGRAKAPTTKPVEGSKKAPKPAGGKVDFGYAPKGRKGKKA*
Ga0129333_1158181633300010354Freshwater To Marine Saline GradientPMQKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA*
Ga0129324_1028514223300010368Freshwater To Marine Saline GradientMKKGGRAKAPMAKPTEGKNDMKKPGGKVEFGYAGKARKGKKA*
Ga0129336_1034797413300010370Freshwater To Marine Saline GradientGVNMKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGFAAKARKGKKA*
Ga0129336_1073061623300010370Freshwater To Marine Saline GradientMKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGFAAKARKGKKA*
Ga0137575_1008413613300010970Pond Fresh WaterITEGGANMNKGSQAKASMQKPTEGKKDTSKPKGGKVDFGYAGTARKGKKALITTERCTGC
Ga0151516_10359283300011116FreshwaterMKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA*
Ga0153697_1040463300011334FreshwaterMKKGTHEKASVQQPTEGKKDTSKPKGGKVEFGYAGTARKGKKA*
Ga0102688_164617713300011381Freshwater LakeGRCEMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA*
Ga0153799_100172063300012012FreshwaterMNTKKGGREKAPMQKPTEGKKDMKKPTGGKVAFGYAPAGRKGKKA*
Ga0129338_110940823300012970AqueousMKKGGRAKAMMAKPKEGSKSAPKPAGGKVEFGYAGKARKGKKA*
Ga0129338_156426123300012970AqueousMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGFAPKGRKGKKA*
(restricted) Ga0172374_106727223300013122FreshwaterMKKGGRAKAMVAKPKEGPKAAPKPAGGKVEFGYAGKARKGKKA*
(restricted) Ga0172368_1012152323300013123FreshwaterMKKGGRAKAMVAKPTEGPKAAPKPAGGKVEFGYAGKARKGKKA*
(restricted) Ga0172363_1104981323300013130SedimentMKKGGREKASMAKPTEGKKDTKKPAGGEIKFGYAPAGRKGKKA*
(restricted) Ga0172373_1006060013300013131FreshwaterMNKKGKVAKAPVAQVVKGPMDTAKPKGGEVKFGYAPAGRKGKKA*
(restricted) Ga0172373_1046639223300013131FreshwaterMKKGGRAKAMVAKPKEGSKSAPKPAGGEIKFGYAGKARKGKKA*
(restricted) Ga0172372_1002381753300013132FreshwaterMIKGGRAKAMVAKPKEGPKAAPKPAGGKVEFGYAGKARKGKKA*
(restricted) Ga0172372_1097863623300013132FreshwaterMIKGGRAKAMVAKPKEGSKSAPKPAGGKVEFGYAGKARKGKKA*
(restricted) Ga0172376_1001118613300014720FreshwaterMKKGGRAKAMVAKPKEGSKSAPKPAGGKVEFGYAGKARKGKKA*
Ga0119954_100257323300014819FreshwaterMKKGGRAKASMAKPTEGKKDMKKPAGGMVKFGYAGKARKGKKA*
Ga0134315_100761523300014962Surface WaterMNQGGRAKAPVQQPTKGKLDTKKPAKSDVKFGFAPKARMGKKA*
Ga0181355_133202723300017785Freshwater LakeMKKGGRAKASMAKPTEGKMDTKKPKGGKVDFGYAAKARKGKKA
Ga0169931_1005221443300017788FreshwaterMKKGGRAKAMVAKPTEGPKAAPKPAGGKVEFGYAGKARKGKKA
Ga0180437_1070301423300017963Hypersaline Lake SedimentMKKGGRAKAPMQKPTEGKKDMKKPGGKVEFGYAGKARKGKKA
Ga0181359_110235943300019784Freshwater LakeMKKGGRAKAPMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA
Ga0181359_113609633300019784Freshwater LakeMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA
Ga0194113_1010354543300020074Freshwater LakeMKKGGRAKASMAKPKEGSKSAPKPAGGEVRFGYAPAGRKGKKA
Ga0194113_1020460323300020074Freshwater LakeMKKGGRAKASMAKSKEGKRDTSKPKGGEVKFGYSAAGRKGNRA
Ga0194113_1051173333300020074Freshwater LakeMKKGGRAKASMARPKEGSKSAPKPAGGEVKFGYAGKARKGKKA
Ga0194111_1009464243300020083Freshwater LakeMNMKKGGRAKASMAKPKEGSKSAPKPAGGEVRFGYAPAGRKGKKA
Ga0194115_1000693283300020183Freshwater LakeMKKGGRAAASMQKPTEGKKDTSKPKSGEVRFGYAPAGRKGKKA
Ga0211731_1108813343300020205FreshwaterMKLKKGGRAAASMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA
Ga0208223_104040113300020519FreshwaterMKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKK
Ga0208359_104464713300020541FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGFAAKARKGKKA
Ga0208465_100480223300020570FreshwaterMKKGGREKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA
Ga0222716_1074484423300021959Estuarine WaterMKKGGRAKASMAMPTEGKKDTKKPAGGKVEFGYAGKARKGKKA
Ga0222712_1017799433300021963Estuarine WaterMKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGFAGKARKGKKA
Ga0212029_100265523300022063AqueousMNKGGRAKASMAKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA
Ga0212029_101937223300022063AqueousMKKGGRAKALMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA
Ga0212029_102810823300022063AqueousLSIAEGGVQMKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA
Ga0212031_107255413300022176AqueousMKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA
Ga0181353_101286823300022179Freshwater LakeMKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA
Ga0181353_109139523300022179Freshwater LakeMKKGGRAKASMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA
Ga0181353_109586913300022179Freshwater LakeKAPMAKPTEGKKDMKKPAGGKVVFGYAGKARKGKKA
Ga0181353_114953523300022179Freshwater LakeMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGFAPKGRKGKKA
Ga0181354_123797323300022190Freshwater LakeMKKGGREKAPMAKPTEGKKDMKKPAGGKVVFGYAGKARKGKKA
Ga0196905_100321623300022198AqueousMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA
Ga0196901_100202773300022200AqueousMNKGGRAKASVAKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA
Ga0196901_108925943300022200AqueousMNMKKGGRAKASMAMPKEGSKSAPKPAGGEVKFGYAGKARKGKKA
Ga0228703_109373313300022747FreshwaterMKKGTQAPAPMSKPVEGKKDTSKPAGGKTYFGFTAAG
Ga0228702_107868623300022748FreshwaterMKKGGREKAPMSKPTQGKMDTKKPAKSDVKFGYAPAGRKGKKA
Ga0214917_10000825543300022752FreshwaterMKKGGREKAPMQQPTKGKMDTKKPKMADVKFGYAPAARKGKKA
Ga0214917_10000832323300022752FreshwaterMNKKGGREKASMQKPTEGKMDSKKPSGPGKAMFGYTPAGRKGKKA
Ga0214917_10001761313300022752FreshwaterMKKGGRAKASMAKPTEGKKDMKKPAGGMVKFGYAGKARKGKKA
Ga0214917_1003335653300022752FreshwaterREKASMAKPIEGKKDTSKPKGPGKPMFGYTPAGRKGKKA
Ga0255752_1031078523300022929Salt MarshMKKGGREKASVQKPTQGKMDSKKPQGPGKAMFGYTPAGRKGKKA
Ga0214923_1062933923300023179FreshwaterMKKGGRAKASMSKPTEGKMNTSKPKGGKVFFGMITKGRKGKKA
Ga0255205_101445023300024276FreshwaterMKKGGRAKASMAKPTEGKKDTKKPAGGMVKFGYAGKARKGKKA
Ga0255147_1000186173300024289FreshwaterMNKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAGRKGKKA
Ga0255147_102544013300024289FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKGKKA
Ga0255178_104929033300024298FreshwaterMKKGGRAKAPVQQPTKGPMDTKKPAKSDVKFGYAPAGRKGKKA
Ga0255148_101646843300024306FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGMVKFGFAGKARKGKKA
Ga0255167_102650843300024350FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGMVKFGYAAKARKGKKA
Ga0255141_101370623300024351FreshwaterMKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA
Ga0255141_106413123300024351FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGAVKFGFAGKARKGKKA
Ga0255165_101073013300024357FreshwaterAPVQQPTKGPMDTKKPAKSDVKFGYAPAGRKGKKA
Ga0255265_109195913300024482FreshwaterGRCNMKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKGKKA
Ga0255151_102133913300024496FreshwaterNMNKKGGRAKAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA
Ga0255151_103464213300024496FreshwaterRCNMKKGGRAKASVQKPTEGSKKAPMPKGGMVKFGYAAKARKGKKA
Ga0255143_101100253300024500FreshwaterRCEMKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA
Ga0255181_105142533300024502FreshwaterNKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAGRKGKKA
Ga0255152_108834423300024503FreshwaterMNKKGGRAKAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA
Ga0255179_104052233300024504FreshwaterASVQKPTEGSKKAPMPKGGKLELGYAGKARKGKKA
Ga0256343_102636623300024541FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKVKKA
Ga0256341_108983033300024556FreshwaterAKASVQKPTEGSKKAPMPKGGMVKFGYAAKARKGKKA
Ga0255283_109379223300024557FreshwaterMNKKGGRAKAPVQQPTKGPMDTKKPAKSDIKFGYAPAGRKGKKA
Ga0255288_108843113300024561FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGKK
Ga0256337_117041723300024573FreshwaterMNKKGGREKAPMQQPTKGKMDTAKPKGPGKVDIGYAPAGRKGKKA
Ga0255271_107323123300024864FreshwaterMKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAGRKGKKA
Ga0208004_108870523300025630AqueousMKKGGRAKAPVQKPTEGKKDMKKPGGKVEFGYAGKARKGKKA
Ga0208147_107027623300025635AqueousMKKGGRAKASMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA
Ga0208161_118008723300025646AqueousMKKGGRAKASMAKPTEGSKSAPKPAGGEVKFGYAGKARKGKKA
Ga0208784_124906623300025732AqueousMKKGTYAKATQVKPTEGKKDTSKPKGGKVDFGYAPAGRKGTKA
Ga0208644_100243433300025889AqueousMKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAARKGKKA
Ga0208644_134686923300025889AqueousMKKGGRAKASVQKPTEGPKKAPMPKGGKVAFGYAAKARKGKKA
Ga0208916_1041395933300025896AqueousMKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGYAGKARKGKKA
Ga0255154_110297923300027467FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGMVKFCFAGKARKGKKA
Ga0255077_108662333300027529FreshwaterIYCRLGRCNMNMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA
Ga0208975_116244733300027659Freshwater LenticMKKGGRAKASMAMPTEGKKDMKKPAGGKVEFGYAGKARKGKKA
Ga0209575_1033666623300027739FreshwaterMNKGSQAKASMQKPTEGKKDTSKPKGGNVDFGYAGTARKGKKA
Ga0209972_10001172283300027793Freshwater LakeMKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGKKA
Ga0209972_1000221043300027793Freshwater LakeMNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGYAPAGRKGKKA
Ga0209972_1000778263300027793Freshwater LakeMKKGGRAKASVQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA
Ga0209972_1017157523300027793Freshwater LakeMKKGGRAEASMAKPTEGKKDMKKPAGGMVKFGYAPAGRKGKKA
Ga0209972_1021802513300027793Freshwater LakeCYVTRIYCRVGRCEMKKGGRAKASVQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA
Ga0209229_10000045573300027805Freshwater And SedimentMNKKGSRASAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRRGKPA
Ga0209229_1003370613300027805Freshwater And SedimentGGRAAAPVQQPTKGKMDTAKPAKSDVQFGYAPAGRKGKKA
Ga0209229_1031201023300027805Freshwater And SedimentMKKGGRAKAPMAKPVEGKKDMKKPGGKVEFGYAGKARKGKKA
Ga0209985_1004319323300027806Freshwater LakeMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA
Ga0209985_1012077833300027806Freshwater LakeMNKKGGRAAAPMQQPTKGKMDTKKPAKSDVKFGYAPAGRKGKKA
Ga0209990_1000877463300027816Freshwater LakeMKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAPAGRKGKKA
Ga0209293_1010294923300027877WetlandMKKGGRAKAPMSKPVEGKKDMKKPKGGKVEFGYAGKARKG
Ga0255201_100717813300028086FreshwaterMKKGGRAKASMAMPTEGKKDTKKPAGGMVKFGYAGKARKGKKA
Ga0255172_100672933300028103FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKG
Ga0255174_103277643300028275FreshwaterSRHCYVTRIYCRVGRCEMKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA
(restricted) Ga0247844_103048753300028571FreshwaterMKKGGRAKASMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA
Ga0307375_1048978223300031669SoilMNMKKGGRAKASMAMPKEGSKSAPKPAGGEVKFGYAPAGRKGKKA
Ga0307377_1092037623300031673SoilMNMKKGGRAAASMAKPKEGPKSAPKPAGGEVKFGYAPAGRKGKKA
Ga0315907_1001031443300031758FreshwaterMKKGGRAKASMAKPKEGSKKAPMPKGGKVDFGYAAKARKGKKA
Ga0315907_1008747543300031758FreshwaterMKKGGRAAAPMQKPTEGKKDTSRPKGGAVKFGYAPAGRKGKKA
Ga0315907_1041270153300031758FreshwaterRRWKMRKGSVASAPVQKPTEGKKDMSKPAGGKVSFGMAPAGRKGKKA
Ga0315907_1072237923300031758FreshwaterMNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGFAPAGRKGKKA
Ga0315907_1099385323300031758FreshwaterMRKGSVASAPVQKPTEGKKDMSKPAGGKVSFGMAPAGRKGKK
Ga0315907_1102360813300031758FreshwaterMKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAGKARKGKKA
Ga0315907_1113549523300031758FreshwaterMKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGFAGKARKGKKA
Ga0315900_1001030933300031787FreshwaterMKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA
Ga0315900_1043215513300031787FreshwaterCRVGRCEMKKGGRAKAPMAKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA
Ga0315909_1030903513300031857FreshwaterMKKGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA
Ga0315904_10001961223300031951FreshwaterMKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGFAAKARKGKKA
Ga0315904_1001245923300031951FreshwaterMGMKKGGRAAAPVQKPTEGKKDMAKPAGGKVFFGMAPAGRKGKKA
Ga0315904_1014302313300031951FreshwaterRAKAPVQKPTEGPKAAPMPKGSDVKFGYAGKARKGKKA
Ga0315904_1014682843300031951FreshwaterMNKGGRAKAPVAQPTKGKMDTKKPAKSDVKFGYAPAGRKGNKA
Ga0315904_1032248713300031951FreshwaterKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA
Ga0315904_1090185313300031951FreshwaterAKAPMAKPTEGKKDMKKPKGGKVAFGYAGKARKGKKA
Ga0315904_1135874433300031951FreshwaterMKKGGRAKAAMQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA
Ga0315906_1073181313300032050FreshwaterCEMKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAGKARKGKKA
Ga0315903_10003081313300032116FreshwaterMKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGYAAKARKGKKA
Ga0315903_1003418253300032116FreshwaterMIKKGKVAKAPMSQVVKGPMDTAKPKGGEVQFGYAPAGRKGTKA
Ga0315903_1032811523300032116FreshwaterMKKGGRAAASVQQPTKGPMDTSKPKGGKTYFGMAPAGRKGKKA
Ga0315903_1032935743300032116FreshwaterCEMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA
Ga0315903_1050300823300032116FreshwaterMMGMKKGGRAAAPVQKPTEGKKDMAKPAGGKVFFGMAPAGRKGKKA
Ga0315903_1051792513300032116FreshwaterGGRAKASVQKPTEGSKKAPMPKGGEVKFGFAAKARKGKKA
Ga0315903_1073019723300032116FreshwaterMRKGSVASAPVQKPTEGKKDMSKPTGGKVSFGMAPAG
Ga0316625_10013653343300033418SoilMKKGGRAKAPMSKPVEGKKDMKKPKGGKVDFGYAGKARKGKKA
Ga0316626_1213500423300033485SoilMNKKGGRAAAPMQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA
Ga0316616_10130083113300033521SoilGGRAKASVQKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA
Ga0310127_012560_1452_15893300034072Fracking WaterMNTKKGGREKAPMQKPTEGKMDTRKPTGGKVAFGYAPAGRKGKKA
Ga0335010_0198959_1100_12223300034092FreshwaterMKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGK
Ga0335066_0000402_21569_217003300034112FreshwaterMKKGGRAKAPVQKPTEGPKAAPMPKGSDVKFGYAGKARKGKKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.