Basic Information | |
---|---|
Family ID | F019314 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 230 |
Average Sequence Length | 44 residues |
Representative Sequence | MKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA |
Number of Associated Samples | 155 |
Number of Associated Scaffolds | 230 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.11 % |
% of genes near scaffold ends (potentially truncated) | 23.91 % |
% of genes from short scaffolds (< 2000 bps) | 68.70 % |
Associated GOLD sequencing projects | 140 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.13 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.043 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (17.391 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.957 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.522 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.86% β-sheet: 0.00% Coil/Unstructured: 90.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 230 Family Scaffolds |
---|---|---|
PF13692 | Glyco_trans_1_4 | 0.87 |
PF03796 | DnaB_C | 0.87 |
PF13252 | DUF4043 | 0.87 |
PF04545 | Sigma70_r4 | 0.43 |
PF02767 | DNA_pol3_beta_2 | 0.43 |
PF13522 | GATase_6 | 0.43 |
PF13362 | Toprim_3 | 0.43 |
PF01555 | N6_N4_Mtase | 0.43 |
PF01930 | Cas_Cas4 | 0.43 |
PF01391 | Collagen | 0.43 |
PF03237 | Terminase_6N | 0.43 |
PF00534 | Glycos_transf_1 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
---|---|---|---|
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.87 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.87 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.43 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.43 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.43 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.13 % |
Unclassified | root | N/A | 40.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001267|B570J13875_101025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1678 | Open in IMG/M |
3300001838|RCM33_1058583 | Not Available | 600 | Open in IMG/M |
3300001842|RCM30_1023386 | Not Available | 833 | Open in IMG/M |
3300001968|GOS2236_1066412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1677 | Open in IMG/M |
3300003277|JGI25908J49247_10009807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2988 | Open in IMG/M |
3300003431|JGI25913J50563_1032183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 818 | Open in IMG/M |
3300003499|JGI25930J51415_1006531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2442 | Open in IMG/M |
3300003499|JGI25930J51415_1008726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2083 | Open in IMG/M |
3300004151|Ga0066602_10233813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 802 | Open in IMG/M |
3300004240|Ga0007787_10356178 | Not Available | 727 | Open in IMG/M |
3300004796|Ga0007763_11595166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 755 | Open in IMG/M |
3300005417|Ga0068884_1589117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 574 | Open in IMG/M |
3300005418|Ga0068881_1625811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 655 | Open in IMG/M |
3300005420|Ga0068879_1723956 | Not Available | 716 | Open in IMG/M |
3300005525|Ga0068877_10005107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 10145 | Open in IMG/M |
3300005525|Ga0068877_10171690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1313 | Open in IMG/M |
3300005525|Ga0068877_10680264 | Not Available | 552 | Open in IMG/M |
3300005525|Ga0068877_10774831 | Not Available | 508 | Open in IMG/M |
3300005527|Ga0068876_10297229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 917 | Open in IMG/M |
3300005527|Ga0068876_10433342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 729 | Open in IMG/M |
3300005581|Ga0049081_10350234 | Not Available | 501 | Open in IMG/M |
3300005582|Ga0049080_10281306 | Not Available | 539 | Open in IMG/M |
3300005585|Ga0049084_10106045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1006 | Open in IMG/M |
3300005739|Ga0076948_1146828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1287 | Open in IMG/M |
3300005758|Ga0078117_1023386 | Not Available | 1497 | Open in IMG/M |
3300005805|Ga0079957_1004722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11264 | Open in IMG/M |
3300005805|Ga0079957_1014398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5783 | Open in IMG/M |
3300005805|Ga0079957_1025753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3988 | Open in IMG/M |
3300006018|Ga0068875_1026726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 524 | Open in IMG/M |
3300006030|Ga0075470_10000833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9739 | Open in IMG/M |
3300006030|Ga0075470_10012423 | All Organisms → Viruses → Predicted Viral | 2625 | Open in IMG/M |
3300006637|Ga0075461_10001343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 7697 | Open in IMG/M |
3300006637|Ga0075461_10063334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1188 | Open in IMG/M |
3300006637|Ga0075461_10199845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 599 | Open in IMG/M |
3300006641|Ga0075471_10601526 | Not Available | 539 | Open in IMG/M |
3300006802|Ga0070749_10002139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 13301 | Open in IMG/M |
3300006802|Ga0070749_10016439 | All Organisms → Viruses → Predicted Viral | 4715 | Open in IMG/M |
3300006803|Ga0075467_10240714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 986 | Open in IMG/M |
3300006805|Ga0075464_10078177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1874 | Open in IMG/M |
3300006805|Ga0075464_10325873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 927 | Open in IMG/M |
3300006805|Ga0075464_10706960 | Not Available | 624 | Open in IMG/M |
3300006874|Ga0075475_10194370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 872 | Open in IMG/M |
3300006875|Ga0075473_10428291 | Not Available | 534 | Open in IMG/M |
3300006916|Ga0070750_10106272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1297 | Open in IMG/M |
3300006920|Ga0070748_1369070 | Not Available | 504 | Open in IMG/M |
3300007171|Ga0102977_1169185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1287 | Open in IMG/M |
3300007177|Ga0102978_1008791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9768 | Open in IMG/M |
3300007212|Ga0103958_1027822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1192 | Open in IMG/M |
3300007214|Ga0103959_1172221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1291 | Open in IMG/M |
3300007234|Ga0075460_10137255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 859 | Open in IMG/M |
3300007304|Ga0102689_1144704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1113 | Open in IMG/M |
3300007363|Ga0075458_10188838 | Not Available | 633 | Open in IMG/M |
3300007538|Ga0099851_1274419 | Not Available | 599 | Open in IMG/M |
3300007539|Ga0099849_1298584 | Not Available | 582 | Open in IMG/M |
3300007542|Ga0099846_1001027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11503 | Open in IMG/M |
3300007640|Ga0070751_1038757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2144 | Open in IMG/M |
3300007735|Ga0104988_10949 | Not Available | 42398 | Open in IMG/M |
3300007960|Ga0099850_1028057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2472 | Open in IMG/M |
3300007974|Ga0105747_1163861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 722 | Open in IMG/M |
3300008072|Ga0110929_1033649 | Not Available | 548 | Open in IMG/M |
3300008108|Ga0114341_10512154 | Not Available | 539 | Open in IMG/M |
3300008108|Ga0114341_10534212 | Not Available | 521 | Open in IMG/M |
3300008110|Ga0114343_1017357 | Not Available | 3274 | Open in IMG/M |
3300008114|Ga0114347_1058570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2401 | Open in IMG/M |
3300008116|Ga0114350_1017878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3541 | Open in IMG/M |
3300008119|Ga0114354_1070933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1441 | Open in IMG/M |
3300008120|Ga0114355_1150699 | Not Available | 825 | Open in IMG/M |
3300008120|Ga0114355_1172791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 735 | Open in IMG/M |
3300008259|Ga0114841_1035294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2535 | Open in IMG/M |
3300008259|Ga0114841_1075218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1548 | Open in IMG/M |
3300008263|Ga0114349_1258102 | Not Available | 556 | Open in IMG/M |
3300008266|Ga0114363_1140384 | Not Available | 1221 | Open in IMG/M |
3300008266|Ga0114363_1190674 | Not Available | 640 | Open in IMG/M |
3300008448|Ga0114876_1005230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 8271 | Open in IMG/M |
3300008448|Ga0114876_1024363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3068 | Open in IMG/M |
3300008450|Ga0114880_1214914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 631 | Open in IMG/M |
3300008510|Ga0110928_1000741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1511 | Open in IMG/M |
3300009166|Ga0105100_10810684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 581 | Open in IMG/M |
3300010293|Ga0116204_1070548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1256 | Open in IMG/M |
3300010354|Ga0129333_10009115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9373 | Open in IMG/M |
3300010354|Ga0129333_10132768 | All Organisms → Viruses → Predicted Viral | 2289 | Open in IMG/M |
3300010354|Ga0129333_10806356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 800 | Open in IMG/M |
3300010354|Ga0129333_10968291 | Not Available | 717 | Open in IMG/M |
3300010354|Ga0129333_11033014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 689 | Open in IMG/M |
3300010354|Ga0129333_11253566 | Not Available | 614 | Open in IMG/M |
3300010354|Ga0129333_11276128 | Not Available | 608 | Open in IMG/M |
3300010354|Ga0129333_11335978 | Not Available | 591 | Open in IMG/M |
3300010354|Ga0129333_11479534 | Not Available | 557 | Open in IMG/M |
3300010354|Ga0129333_11581816 | Not Available | 535 | Open in IMG/M |
3300010368|Ga0129324_10285142 | Not Available | 652 | Open in IMG/M |
3300010370|Ga0129336_10347974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 816 | Open in IMG/M |
3300010370|Ga0129336_10730616 | Not Available | 523 | Open in IMG/M |
3300010970|Ga0137575_10084136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 508 | Open in IMG/M |
3300011116|Ga0151516_10359 | Not Available | 23418 | Open in IMG/M |
3300011334|Ga0153697_1040 | Not Available | 39767 | Open in IMG/M |
3300011381|Ga0102688_1646177 | Not Available | 513 | Open in IMG/M |
3300012012|Ga0153799_1001720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6246 | Open in IMG/M |
3300012970|Ga0129338_1109408 | Not Available | 611 | Open in IMG/M |
3300012970|Ga0129338_1564261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 841 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1067272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1421 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10121523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1470 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_11049813 | Not Available | 502 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10060600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3147 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10466392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 774 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10023817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 6869 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10978636 | Not Available | 512 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10011186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 8932 | Open in IMG/M |
3300014819|Ga0119954_1002573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5452 | Open in IMG/M |
3300014962|Ga0134315_1007615 | Not Available | 1764 | Open in IMG/M |
3300017785|Ga0181355_1332027 | Not Available | 563 | Open in IMG/M |
3300017788|Ga0169931_10052214 | All Organisms → Viruses → Predicted Viral | 4380 | Open in IMG/M |
3300017963|Ga0180437_10703014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 733 | Open in IMG/M |
3300019784|Ga0181359_1102359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1048 | Open in IMG/M |
3300019784|Ga0181359_1136096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 860 | Open in IMG/M |
3300020074|Ga0194113_10103545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2485 | Open in IMG/M |
3300020074|Ga0194113_10204603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → unclassified Micavibrio → Micavibrio sp. TMED2 | 1576 | Open in IMG/M |
3300020074|Ga0194113_10511733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 860 | Open in IMG/M |
3300020083|Ga0194111_10094642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2419 | Open in IMG/M |
3300020183|Ga0194115_10006932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11375 | Open in IMG/M |
3300020205|Ga0211731_11088133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3124 | Open in IMG/M |
3300020519|Ga0208223_1040401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 562 | Open in IMG/M |
3300020541|Ga0208359_1044647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 662 | Open in IMG/M |
3300020570|Ga0208465_1004802 | All Organisms → Viruses → Predicted Viral | 2174 | Open in IMG/M |
3300021959|Ga0222716_10744844 | Not Available | 515 | Open in IMG/M |
3300021963|Ga0222712_10177994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1411 | Open in IMG/M |
3300022063|Ga0212029_1002655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1748 | Open in IMG/M |
3300022063|Ga0212029_1019372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 906 | Open in IMG/M |
3300022063|Ga0212029_1028108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 780 | Open in IMG/M |
3300022176|Ga0212031_1072554 | Not Available | 585 | Open in IMG/M |
3300022179|Ga0181353_1012868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2135 | Open in IMG/M |
3300022179|Ga0181353_1091395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 757 | Open in IMG/M |
3300022179|Ga0181353_1095869 | Not Available | 734 | Open in IMG/M |
3300022179|Ga0181353_1149535 | Not Available | 538 | Open in IMG/M |
3300022190|Ga0181354_1237973 | Not Available | 524 | Open in IMG/M |
3300022198|Ga0196905_1003216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 6031 | Open in IMG/M |
3300022200|Ga0196901_1002027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9915 | Open in IMG/M |
3300022200|Ga0196901_1089259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1088 | Open in IMG/M |
3300022747|Ga0228703_1093733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 712 | Open in IMG/M |
3300022748|Ga0228702_1078686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 814 | Open in IMG/M |
3300022752|Ga0214917_10000825 | Not Available | 40273 | Open in IMG/M |
3300022752|Ga0214917_10000832 | Not Available | 40122 | Open in IMG/M |
3300022752|Ga0214917_10001761 | Not Available | 27573 | Open in IMG/M |
3300022752|Ga0214917_10033356 | All Organisms → Viruses → Predicted Viral | 3807 | Open in IMG/M |
3300022929|Ga0255752_10310785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 663 | Open in IMG/M |
3300023179|Ga0214923_10629339 | Not Available | 503 | Open in IMG/M |
3300024276|Ga0255205_1014450 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
3300024289|Ga0255147_1000186 | Not Available | 24243 | Open in IMG/M |
3300024289|Ga0255147_1025440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1222 | Open in IMG/M |
3300024298|Ga0255178_1049290 | Not Available | 820 | Open in IMG/M |
3300024306|Ga0255148_1016468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1442 | Open in IMG/M |
3300024350|Ga0255167_1026508 | Not Available | 1094 | Open in IMG/M |
3300024351|Ga0255141_1013706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1262 | Open in IMG/M |
3300024351|Ga0255141_1064131 | Not Available | 535 | Open in IMG/M |
3300024357|Ga0255165_1010730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1798 | Open in IMG/M |
3300024482|Ga0255265_1091959 | Not Available | 584 | Open in IMG/M |
3300024496|Ga0255151_1021339 | Not Available | 1132 | Open in IMG/M |
3300024496|Ga0255151_1034642 | Not Available | 854 | Open in IMG/M |
3300024500|Ga0255143_1011002 | Not Available | 1535 | Open in IMG/M |
3300024502|Ga0255181_1051425 | Not Available | 706 | Open in IMG/M |
3300024503|Ga0255152_1088344 | Not Available | 525 | Open in IMG/M |
3300024504|Ga0255179_1040522 | Not Available | 651 | Open in IMG/M |
3300024541|Ga0256343_1026366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1048 | Open in IMG/M |
3300024556|Ga0256341_1089830 | Not Available | 610 | Open in IMG/M |
3300024557|Ga0255283_1093792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 645 | Open in IMG/M |
3300024561|Ga0255288_1088431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 693 | Open in IMG/M |
3300024573|Ga0256337_1170417 | Not Available | 539 | Open in IMG/M |
3300024864|Ga0255271_1073231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 750 | Open in IMG/M |
3300025630|Ga0208004_1088705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 752 | Open in IMG/M |
3300025635|Ga0208147_1070276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 874 | Open in IMG/M |
3300025646|Ga0208161_1180087 | Not Available | 501 | Open in IMG/M |
3300025732|Ga0208784_1249066 | Not Available | 511 | Open in IMG/M |
3300025889|Ga0208644_1002434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 14872 | Open in IMG/M |
3300025889|Ga0208644_1346869 | Not Available | 568 | Open in IMG/M |
3300025896|Ga0208916_10413959 | Not Available | 588 | Open in IMG/M |
3300027467|Ga0255154_1102979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 616 | Open in IMG/M |
3300027659|Ga0208975_1162447 | Not Available | 617 | Open in IMG/M |
3300027739|Ga0209575_10336666 | Not Available | 516 | Open in IMG/M |
3300027793|Ga0209972_10001172 | Not Available | 23464 | Open in IMG/M |
3300027793|Ga0209972_10002210 | Not Available | 16100 | Open in IMG/M |
3300027793|Ga0209972_10007782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 7510 | Open in IMG/M |
3300027793|Ga0209972_10171575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1024 | Open in IMG/M |
3300027793|Ga0209972_10218025 | Not Available | 875 | Open in IMG/M |
3300027805|Ga0209229_10000045 | Not Available | 40827 | Open in IMG/M |
3300027805|Ga0209229_10033706 | Not Available | 2251 | Open in IMG/M |
3300027805|Ga0209229_10312010 | Not Available | 692 | Open in IMG/M |
3300027806|Ga0209985_10043193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2562 | Open in IMG/M |
3300027806|Ga0209985_10120778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1323 | Open in IMG/M |
3300027816|Ga0209990_10008774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 6421 | Open in IMG/M |
3300027877|Ga0209293_10102949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1295 | Open in IMG/M |
3300028086|Ga0255201_1007178 | All Organisms → Viruses → Predicted Viral | 1939 | Open in IMG/M |
3300028103|Ga0255172_1006729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2315 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1030487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3744 | Open in IMG/M |
3300031669|Ga0307375_10489782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 743 | Open in IMG/M |
3300031673|Ga0307377_10920376 | Not Available | 594 | Open in IMG/M |
3300031758|Ga0315907_10010314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9320 | Open in IMG/M |
3300031758|Ga0315907_10087475 | All Organisms → Viruses → Predicted Viral | 2681 | Open in IMG/M |
3300031758|Ga0315907_10412701 | Not Available | 1086 | Open in IMG/M |
3300031758|Ga0315907_10722379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 754 | Open in IMG/M |
3300031758|Ga0315907_10993853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 606 | Open in IMG/M |
3300031758|Ga0315907_11023608 | Not Available | 594 | Open in IMG/M |
3300031758|Ga0315907_11135495 | Not Available | 552 | Open in IMG/M |
3300031787|Ga0315900_10010309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11716 | Open in IMG/M |
3300031787|Ga0315900_10432155 | Not Available | 1025 | Open in IMG/M |
3300031857|Ga0315909_10309035 | Not Available | 1177 | Open in IMG/M |
3300031951|Ga0315904_10001961 | Not Available | 32357 | Open in IMG/M |
3300031951|Ga0315904_10012459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 10735 | Open in IMG/M |
3300031951|Ga0315904_10143023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2435 | Open in IMG/M |
3300031951|Ga0315904_10146828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2396 | Open in IMG/M |
3300031951|Ga0315904_10322487 | Not Available | 1436 | Open in IMG/M |
3300031951|Ga0315904_10901853 | Not Available | 713 | Open in IMG/M |
3300031951|Ga0315904_11358744 | Not Available | 533 | Open in IMG/M |
3300032050|Ga0315906_10731813 | Not Available | 788 | Open in IMG/M |
3300032116|Ga0315903_10003081 | All Organisms → cellular organisms → Bacteria | 23501 | Open in IMG/M |
3300032116|Ga0315903_10034182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5390 | Open in IMG/M |
3300032116|Ga0315903_10328115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1279 | Open in IMG/M |
3300032116|Ga0315903_10329357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1275 | Open in IMG/M |
3300032116|Ga0315903_10503008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 956 | Open in IMG/M |
3300032116|Ga0315903_10517925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 937 | Open in IMG/M |
3300032116|Ga0315903_10730197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 735 | Open in IMG/M |
3300033418|Ga0316625_100136533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1481 | Open in IMG/M |
3300033485|Ga0316626_12135004 | Not Available | 508 | Open in IMG/M |
3300033521|Ga0316616_101300831 | Not Available | 931 | Open in IMG/M |
3300034072|Ga0310127_012560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5876 | Open in IMG/M |
3300034092|Ga0335010_0198959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1224 | Open in IMG/M |
3300034112|Ga0335066_0000402 | Not Available | 31023 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.39% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.22% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 11.74% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.87% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.96% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.65% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.17% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.74% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.74% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.30% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.30% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.30% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.87% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.87% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.87% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.87% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.43% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.43% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.43% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.43% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.43% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.43% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.43% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.43% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.43% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.43% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.43% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.43% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001267 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
3300006018 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300024276 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
3300024482 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300024504 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8d | Environmental | Open in IMG/M |
3300024541 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J13875_1010254 | 3300001267 | Freshwater | MKKGGREKAPMAKPTEGKKDMKKPAGGKVEFGYAGKARKGKKA* |
RCM33_10585832 | 3300001838 | Marine Plankton | MKKGGRAAASMQKPTEGKKDTSKPAKSDVKFGYAPAGRKGKKA* |
RCM30_10233863 | 3300001842 | Marine Plankton | MRKGSVAAASMSKPVEGKRDTSKPAGGEVKFGFTAAARKGKSVKVQK* |
GOS2236_10664122 | 3300001968 | Marine | MKKGGRAKASVQKPTEGPKKAPMPKGGELKFGFAGKARKGKKA* |
JGI25908J49247_100098073 | 3300003277 | Freshwater Lake | MNMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA* |
JGI25913J50563_10321831 | 3300003431 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA* |
JGI25930J51415_10065313 | 3300003499 | Freshwater Lake | MKKGGRAKAXMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA* |
JGI25930J51415_10087261 | 3300003499 | Freshwater Lake | SRYCYITRIYCRVGRCKMKKGGRXKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA |
Ga0066602_102338132 | 3300004151 | Freshwater | MNKGSQAKASMQKPTEGKKDTSKPKGGKVDFGYAGTARKGKKA* |
Ga0007787_103561783 | 3300004240 | Freshwater Lake | KMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGFAPKGRKGKKA* |
Ga0007763_115951662 | 3300004796 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDMKKPKGGMVKFGYAGKARKGKKA* |
Ga0068884_15891172 | 3300005417 | Freshwater Lake | MKKGGRAKASVQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA* |
Ga0068881_16258112 | 3300005418 | Freshwater Lake | MKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGKKA* |
Ga0068879_17239563 | 3300005420 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA* |
Ga0068877_100051079 | 3300005525 | Freshwater Lake | MKKGGRAKASVQKPTEGPKKAPMPKGGKVAFGYAAKARKGKKA* |
Ga0068877_101716902 | 3300005525 | Freshwater Lake | MNKKGGRAAAPMQQPTKGKMDTKKPAKSDVKFGYAPAGRKGKKA* |
Ga0068877_106802642 | 3300005525 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAPAGRKGKKA* |
Ga0068877_107748312 | 3300005525 | Freshwater Lake | MKKGGRAEASMAKPTEGKKDMKKPAGGMVKFGYAPAGRKGKKA* |
Ga0068876_102972292 | 3300005527 | Freshwater Lake | MKKGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA* |
Ga0068876_103361413 | 3300005527 | Freshwater Lake | CYVTRIYCRVGRCEMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA* |
Ga0068876_104333422 | 3300005527 | Freshwater Lake | MNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGYAPAGRKGKKA* |
Ga0049081_103502341 | 3300005581 | Freshwater Lentic | KKGGRAAAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA* |
Ga0049080_102813061 | 3300005582 | Freshwater Lentic | RAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA* |
Ga0049084_101060453 | 3300005585 | Freshwater Lentic | MKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA* |
Ga0076948_11468282 | 3300005739 | Lake Water | MKKGGRAAAPVQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA* |
Ga0078117_10233861 | 3300005758 | Lake Water | MKKGGRAKAPVQKPTEGSKKAPMPKGGMVKFGYAGKARKGKKA* |
Ga0079957_10047225 | 3300005805 | Lake | MKKGGRAAASVQQPTKGPMDTSKPKGGKTFFGMAPAGRKGKKA* |
Ga0079957_10143984 | 3300005805 | Lake | MKKGGRAKAPMAKPVEGKKDMKKPGGKVEFGYAGKARKGKKA* |
Ga0079957_10257532 | 3300005805 | Lake | MRKGSVASAPVQKPTEGKKDMSKPAGGKVSFGMAPAGRKGKKA* |
Ga0073919_10307701 | 3300006014 | Sand | YITRIYCRLGRCNMNMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA* |
Ga0068875_10267262 | 3300006018 | Freshwater Lake | MKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAK |
Ga0075470_100008332 | 3300006030 | Aqueous | MKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGFAAKARKGKKA* |
Ga0075470_100124233 | 3300006030 | Aqueous | MNKKGGRAAAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA* |
Ga0075461_100013432 | 3300006637 | Aqueous | MKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA* |
Ga0075461_100633342 | 3300006637 | Aqueous | MKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAARKGKKA* |
Ga0075461_101998452 | 3300006637 | Aqueous | MKKGGRAKAPVQKPTEGKKDMKKPGGKVEFGYAGKARKGKKA* |
Ga0075471_106015262 | 3300006641 | Aqueous | MKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGYAAKARKGKKA* |
Ga0070749_1000213918 | 3300006802 | Aqueous | GRAAAPVQKPTEGKKDTSKPKGGEVKFGYAPAGRQGKKA* |
Ga0070749_100164392 | 3300006802 | Aqueous | MKKGGRAKASMKQPTKGPLDTKKPKMADVKFGYAPAARKGKKA* |
Ga0075467_102407141 | 3300006803 | Aqueous | MNKGSRAAAPMSQPKEGKMDTSKPKGGKVDFGYAGTARKGKKA* |
Ga0075464_100781771 | 3300006805 | Aqueous | KMKKGGRAKASMAKPTEGKKDTKKPAGPGKALFGFAGKARKGKKA* |
Ga0075464_103258733 | 3300006805 | Aqueous | MKKGGRAKAMMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA* |
Ga0075464_107069602 | 3300006805 | Aqueous | MKKGGRAKASMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA* |
Ga0075475_101943701 | 3300006874 | Aqueous | TRIYCRVGRCKMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA* |
Ga0075473_104282913 | 3300006875 | Aqueous | MKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA* |
Ga0070750_101062723 | 3300006916 | Aqueous | MKKGGRAKAPMAKPTEGKKDTSKPAGGEVEFGYAGKARKGKKA* |
Ga0070748_13690701 | 3300006920 | Aqueous | RCKMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA* |
Ga0102977_11691854 | 3300007171 | Freshwater Lake | MNKKGGRAAAPMQKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA* |
Ga0102978_10087912 | 3300007177 | Freshwater Lake | MKKGGRAKASMAKPKEGSKKAPMPKGGKVDFGYAAKARKGKKA* |
Ga0103958_10278222 | 3300007212 | Freshwater Lake | MKKGGRAKAPVQKPTEGSKKAGMPKGGKVAFGYAAKARKGKKA* |
Ga0103959_11722212 | 3300007214 | Freshwater Lake | MKKGGRAKAPVQKPTEGSKKAGMPKGGKVAFGYAGKARKGKKA* |
Ga0075460_100510321 | 3300007234 | Aqueous | ITRIYCRVGRCKMKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA* |
Ga0075460_101372553 | 3300007234 | Aqueous | LSIAEGGVQMKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA* |
Ga0102689_11447042 | 3300007304 | Freshwater Lake | MKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA* |
Ga0075458_101888383 | 3300007363 | Aqueous | MKKGGREKAPMQQPTKGKMDTKKPAKSDVKFGYAPAGRKGKKA* |
Ga0099851_12744193 | 3300007538 | Aqueous | MKKGGRAKALMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA* |
Ga0099849_12985841 | 3300007539 | Aqueous | MNMKKGGRAKASMAMPKEGSKSAPKPAGGEVKFGYAGKARKGKKA* |
Ga0099846_10010272 | 3300007542 | Aqueous | MNKGGRAKASVAKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA* |
Ga0070751_10387571 | 3300007640 | Aqueous | MKKGGRAKAPMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA* |
Ga0104988_1094913 | 3300007735 | Freshwater | MIKKGKVAKAPMSQPTKGVMDTAKPKGGKVEFGYTPAGRKGTKA* |
Ga0099850_10280574 | 3300007960 | Aqueous | LSIAEGGVQMKKGGRAAAPVQKPTEGKKDTSKTKGGDVKFGYAPAGRKGKKA* |
Ga0105747_11638611 | 3300007974 | Estuary Water | MKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGK |
Ga0110929_10336492 | 3300008072 | Water Bodies | MKKGGRAKASVAKPKEGSKKAPMPKGGMVKFGFAGKARKGKKA* |
Ga0114341_105121542 | 3300008108 | Freshwater, Plankton | MKKGGRAKASMAKPTEGKKDTKKPAGGKVEFGYAAKARKGKKA* |
Ga0114341_105342121 | 3300008108 | Freshwater, Plankton | MKKGGRAKAPMAKPTEGKKDMKKPAGGKVEFGYAGKARKGKKA* |
Ga0114343_10173571 | 3300008110 | Freshwater, Plankton | VTRIYCRVGRCKMKKGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA* |
Ga0114347_10585704 | 3300008114 | Freshwater, Plankton | MKKGGRAAAPMQKPTEGKKDTSRPKGGAVKFGYAPAGRKGKKA* |
Ga0114350_10178782 | 3300008116 | Freshwater, Plankton | MMGKGKVAKASMAQPTKGPMDTSKPKGGKVEMGYAGKAKPGKKA* |
Ga0114354_10709332 | 3300008119 | Freshwater, Plankton | MKKGGRAKATMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA* |
Ga0114355_11506991 | 3300008120 | Freshwater, Plankton | CRVGRCEMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA* |
Ga0114355_11727913 | 3300008120 | Freshwater, Plankton | MKKGGRAKAPVQKPTEGPKAAPMPKGGKVDFGYAGKARKGKKA* |
Ga0114841_10352942 | 3300008259 | Freshwater, Plankton | MNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGFAPAGRKGKKA* |
Ga0114841_10752182 | 3300008259 | Freshwater, Plankton | MKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGEKA* |
Ga0114349_12581023 | 3300008263 | Freshwater, Plankton | MKKGGRAKASVAKPTEGSKKAPMPKGGKVDFGYAAKARKGKKA* |
Ga0114363_11403841 | 3300008266 | Freshwater, Plankton | RCEMKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA* |
Ga0114363_11906742 | 3300008266 | Freshwater, Plankton | MKKGGRAKAPMQQPTKGNESAPKPKGGEVKFGYAGKARKGKKA* |
Ga0114876_10052301 | 3300008448 | Freshwater Lake | KGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA* |
Ga0114876_10243634 | 3300008448 | Freshwater Lake | MKKGGRAKAPVQKPTEGSKKAAMPKGGKVDFGYAGKARKGKKA* |
Ga0114880_12149141 | 3300008450 | Freshwater Lake | MMGKGKVAKASMAQPTKGPMDTSKPKGGKVEMGYAGKA |
Ga0110928_10007413 | 3300008510 | Water Bodies | MKKGGRAKAPMQKPTEGSKKAPMPKGGMVKFGFAAKARKGKKA* |
Ga0105100_108106842 | 3300009166 | Freshwater Sediment | MNKGSQANASMQKPTEGKKDTSKPKGGKVDCGYAGTA |
Ga0116204_10705482 | 3300010293 | Anoxic Lake Water | MKKGGREKASMAKPTEGKKDTKKPAGGEVKFGYAPAGRKGKKA* |
Ga0129333_100091156 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGGRAKAPVAKPTEGSTKGASVKGGKVDFGYAAKARKGKKA* |
Ga0129333_101327684 | 3300010354 | Freshwater To Marine Saline Gradient | KKGGRAAAPMQKPTEGKRDTSKPKGGKVDFGYAPAGRKGKKA* |
Ga0129333_108063562 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA* |
Ga0129333_109682911 | 3300010354 | Freshwater To Marine Saline Gradient | KFARANRRLSIAEGGVQVKKGGRAAAPMQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA |
Ga0129333_110330142 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGGRAKASVAKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA* |
Ga0129333_112535661 | 3300010354 | Freshwater To Marine Saline Gradient | GGRAKAPMAKPTEGKKDMKKPGGKVEYGFAPKGRKGKKA* |
Ga0129333_112761281 | 3300010354 | Freshwater To Marine Saline Gradient | STVTSRHWRSSVGGVTMNKGGRAAAMMSKPIEGPKNAPMPQGGKVEFGYAPAGRKGKKA* |
Ga0129333_113359782 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGGRAKAMMAKPTEGKKDSKKPAGGKVEFGYAGKARKGKKA* |
Ga0129333_114795342 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGGRAKAPTTKPVEGSKKAPKPAGGKVDFGYAPKGRKGKKA* |
Ga0129333_115818163 | 3300010354 | Freshwater To Marine Saline Gradient | PMQKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA* |
Ga0129324_102851422 | 3300010368 | Freshwater To Marine Saline Gradient | MKKGGRAKAPMAKPTEGKNDMKKPGGKVEFGYAGKARKGKKA* |
Ga0129336_103479741 | 3300010370 | Freshwater To Marine Saline Gradient | GVNMKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGFAAKARKGKKA* |
Ga0129336_107306162 | 3300010370 | Freshwater To Marine Saline Gradient | MKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGFAAKARKGKKA* |
Ga0137575_100841361 | 3300010970 | Pond Fresh Water | ITEGGANMNKGSQAKASMQKPTEGKKDTSKPKGGKVDFGYAGTARKGKKALITTERCTGC |
Ga0151516_1035928 | 3300011116 | Freshwater | MKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA* |
Ga0153697_104046 | 3300011334 | Freshwater | MKKGTHEKASVQQPTEGKKDTSKPKGGKVEFGYAGTARKGKKA* |
Ga0102688_16461771 | 3300011381 | Freshwater Lake | GRCEMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA* |
Ga0153799_10017206 | 3300012012 | Freshwater | MNTKKGGREKAPMQKPTEGKKDMKKPTGGKVAFGYAPAGRKGKKA* |
Ga0129338_11094082 | 3300012970 | Aqueous | MKKGGRAKAMMAKPKEGSKSAPKPAGGKVEFGYAGKARKGKKA* |
Ga0129338_15642612 | 3300012970 | Aqueous | MKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGFAPKGRKGKKA* |
(restricted) Ga0172374_10672722 | 3300013122 | Freshwater | MKKGGRAKAMVAKPKEGPKAAPKPAGGKVEFGYAGKARKGKKA* |
(restricted) Ga0172368_101215232 | 3300013123 | Freshwater | MKKGGRAKAMVAKPTEGPKAAPKPAGGKVEFGYAGKARKGKKA* |
(restricted) Ga0172363_110498132 | 3300013130 | Sediment | MKKGGREKASMAKPTEGKKDTKKPAGGEIKFGYAPAGRKGKKA* |
(restricted) Ga0172373_100606001 | 3300013131 | Freshwater | MNKKGKVAKAPVAQVVKGPMDTAKPKGGEVKFGYAPAGRKGKKA* |
(restricted) Ga0172373_104663922 | 3300013131 | Freshwater | MKKGGRAKAMVAKPKEGSKSAPKPAGGEIKFGYAGKARKGKKA* |
(restricted) Ga0172372_100238175 | 3300013132 | Freshwater | MIKGGRAKAMVAKPKEGPKAAPKPAGGKVEFGYAGKARKGKKA* |
(restricted) Ga0172372_109786362 | 3300013132 | Freshwater | MIKGGRAKAMVAKPKEGSKSAPKPAGGKVEFGYAGKARKGKKA* |
(restricted) Ga0172376_100111861 | 3300014720 | Freshwater | MKKGGRAKAMVAKPKEGSKSAPKPAGGKVEFGYAGKARKGKKA* |
Ga0119954_10025732 | 3300014819 | Freshwater | MKKGGRAKASMAKPTEGKKDMKKPAGGMVKFGYAGKARKGKKA* |
Ga0134315_10076152 | 3300014962 | Surface Water | MNQGGRAKAPVQQPTKGKLDTKKPAKSDVKFGFAPKARMGKKA* |
Ga0181355_13320272 | 3300017785 | Freshwater Lake | MKKGGRAKASMAKPTEGKMDTKKPKGGKVDFGYAAKARKGKKA |
Ga0169931_100522144 | 3300017788 | Freshwater | MKKGGRAKAMVAKPTEGPKAAPKPAGGKVEFGYAGKARKGKKA |
Ga0180437_107030142 | 3300017963 | Hypersaline Lake Sediment | MKKGGRAKAPMQKPTEGKKDMKKPGGKVEFGYAGKARKGKKA |
Ga0181359_11023594 | 3300019784 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA |
Ga0181359_11360963 | 3300019784 | Freshwater Lake | MKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA |
Ga0194113_101035454 | 3300020074 | Freshwater Lake | MKKGGRAKASMAKPKEGSKSAPKPAGGEVRFGYAPAGRKGKKA |
Ga0194113_102046032 | 3300020074 | Freshwater Lake | MKKGGRAKASMAKSKEGKRDTSKPKGGEVKFGYSAAGRKGNRA |
Ga0194113_105117333 | 3300020074 | Freshwater Lake | MKKGGRAKASMARPKEGSKSAPKPAGGEVKFGYAGKARKGKKA |
Ga0194111_100946424 | 3300020083 | Freshwater Lake | MNMKKGGRAKASMAKPKEGSKSAPKPAGGEVRFGYAPAGRKGKKA |
Ga0194115_100069328 | 3300020183 | Freshwater Lake | MKKGGRAAASMQKPTEGKKDTSKPKSGEVRFGYAPAGRKGKKA |
Ga0211731_110881334 | 3300020205 | Freshwater | MKLKKGGRAAASMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA |
Ga0208223_10404011 | 3300020519 | Freshwater | MKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKK |
Ga0208359_10446471 | 3300020541 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGFAAKARKGKKA |
Ga0208465_10048022 | 3300020570 | Freshwater | MKKGGREKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA |
Ga0222716_107448442 | 3300021959 | Estuarine Water | MKKGGRAKASMAMPTEGKKDTKKPAGGKVEFGYAGKARKGKKA |
Ga0222712_101779943 | 3300021963 | Estuarine Water | MKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGFAGKARKGKKA |
Ga0212029_10026552 | 3300022063 | Aqueous | MNKGGRAKASMAKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA |
Ga0212029_10193722 | 3300022063 | Aqueous | MKKGGRAKALMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA |
Ga0212029_10281082 | 3300022063 | Aqueous | LSIAEGGVQMKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA |
Ga0212031_10725541 | 3300022176 | Aqueous | MKKGGRAAAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRKGKKA |
Ga0181353_10128682 | 3300022179 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA |
Ga0181353_10913952 | 3300022179 | Freshwater Lake | MKKGGRAKASMAKPTEGKKDTSKPAGGMVKFGYAGKARKGKKA |
Ga0181353_10958691 | 3300022179 | Freshwater Lake | KAPMAKPTEGKKDMKKPAGGKVVFGYAGKARKGKKA |
Ga0181353_11495352 | 3300022179 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGFAPKGRKGKKA |
Ga0181354_12379732 | 3300022190 | Freshwater Lake | MKKGGREKAPMAKPTEGKKDMKKPAGGKVVFGYAGKARKGKKA |
Ga0196905_10032162 | 3300022198 | Aqueous | MKKGGRAKAPMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA |
Ga0196901_10020277 | 3300022200 | Aqueous | MNKGGRAKASVAKPTEGKKDTSKPKGGEVKFGYAPAGRKGKKA |
Ga0196901_10892594 | 3300022200 | Aqueous | MNMKKGGRAKASMAMPKEGSKSAPKPAGGEVKFGYAGKARKGKKA |
Ga0228703_10937331 | 3300022747 | Freshwater | MKKGTQAPAPMSKPVEGKKDTSKPAGGKTYFGFTAAG |
Ga0228702_10786862 | 3300022748 | Freshwater | MKKGGREKAPMSKPTQGKMDTKKPAKSDVKFGYAPAGRKGKKA |
Ga0214917_1000082554 | 3300022752 | Freshwater | MKKGGREKAPMQQPTKGKMDTKKPKMADVKFGYAPAARKGKKA |
Ga0214917_1000083232 | 3300022752 | Freshwater | MNKKGGREKASMQKPTEGKMDSKKPSGPGKAMFGYTPAGRKGKKA |
Ga0214917_1000176131 | 3300022752 | Freshwater | MKKGGRAKASMAKPTEGKKDMKKPAGGMVKFGYAGKARKGKKA |
Ga0214917_100333565 | 3300022752 | Freshwater | REKASMAKPIEGKKDTSKPKGPGKPMFGYTPAGRKGKKA |
Ga0255752_103107852 | 3300022929 | Salt Marsh | MKKGGREKASVQKPTQGKMDSKKPQGPGKAMFGYTPAGRKGKKA |
Ga0214923_106293392 | 3300023179 | Freshwater | MKKGGRAKASMSKPTEGKMNTSKPKGGKVFFGMITKGRKGKKA |
Ga0255205_10144502 | 3300024276 | Freshwater | MKKGGRAKASMAKPTEGKKDTKKPAGGMVKFGYAGKARKGKKA |
Ga0255147_100018617 | 3300024289 | Freshwater | MNKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAGRKGKKA |
Ga0255147_10254401 | 3300024289 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKGKKA |
Ga0255178_10492903 | 3300024298 | Freshwater | MKKGGRAKAPVQQPTKGPMDTKKPAKSDVKFGYAPAGRKGKKA |
Ga0255148_10164684 | 3300024306 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGMVKFGFAGKARKGKKA |
Ga0255167_10265084 | 3300024350 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGMVKFGYAAKARKGKKA |
Ga0255141_10137062 | 3300024351 | Freshwater | MKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA |
Ga0255141_10641312 | 3300024351 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGAVKFGFAGKARKGKKA |
Ga0255165_10107301 | 3300024357 | Freshwater | APVQQPTKGPMDTKKPAKSDVKFGYAPAGRKGKKA |
Ga0255265_10919591 | 3300024482 | Freshwater | GRCNMKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKGKKA |
Ga0255151_10213391 | 3300024496 | Freshwater | NMNKKGGRAKAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA |
Ga0255151_10346421 | 3300024496 | Freshwater | RCNMKKGGRAKASVQKPTEGSKKAPMPKGGMVKFGYAAKARKGKKA |
Ga0255143_10110025 | 3300024500 | Freshwater | RCEMKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA |
Ga0255181_10514253 | 3300024502 | Freshwater | NKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAGRKGKKA |
Ga0255152_10883442 | 3300024503 | Freshwater | MNKKGGRAKAPMQQPTKGKMDTKKPAKSDVQFGYAPAGRKGKKA |
Ga0255179_10405223 | 3300024504 | Freshwater | ASVQKPTEGSKKAPMPKGGKLELGYAGKARKGKKA |
Ga0256343_10263662 | 3300024541 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKVKKA |
Ga0256341_10898303 | 3300024556 | Freshwater | AKASVQKPTEGSKKAPMPKGGMVKFGYAAKARKGKKA |
Ga0255283_10937922 | 3300024557 | Freshwater | MNKKGGRAKAPVQQPTKGPMDTKKPAKSDIKFGYAPAGRKGKKA |
Ga0255288_10884311 | 3300024561 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGKK |
Ga0256337_11704172 | 3300024573 | Freshwater | MNKKGGREKAPMQQPTKGKMDTAKPKGPGKVDIGYAPAGRKGKKA |
Ga0255271_10732312 | 3300024864 | Freshwater | MKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAGRKGKKA |
Ga0208004_10887052 | 3300025630 | Aqueous | MKKGGRAKAPVQKPTEGKKDMKKPGGKVEFGYAGKARKGKKA |
Ga0208147_10702762 | 3300025635 | Aqueous | MKKGGRAKASMAKPTEGKKDTSKPAGGKVEFGYAGKARKGKKA |
Ga0208161_11800872 | 3300025646 | Aqueous | MKKGGRAKASMAKPTEGSKSAPKPAGGEVKFGYAGKARKGKKA |
Ga0208784_12490662 | 3300025732 | Aqueous | MKKGTYAKATQVKPTEGKKDTSKPKGGKVDFGYAPAGRKGTKA |
Ga0208644_10024343 | 3300025889 | Aqueous | MKKGGREKAPMQQPTKGKMDTAKPKGPGKVDFGYAPAARKGKKA |
Ga0208644_13468692 | 3300025889 | Aqueous | MKKGGRAKASVQKPTEGPKKAPMPKGGKVAFGYAAKARKGKKA |
Ga0208916_104139593 | 3300025896 | Aqueous | MKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGYAGKARKGKKA |
Ga0255154_11029792 | 3300027467 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGMVKFCFAGKARKGKKA |
Ga0255077_10866233 | 3300027529 | Freshwater | IYCRLGRCNMNMKKGGRAKASMAKPTEGSTSAPKPKGGEVRFGYIPAGRKGKKA |
Ga0208975_11624473 | 3300027659 | Freshwater Lentic | MKKGGRAKASMAMPTEGKKDMKKPAGGKVEFGYAGKARKGKKA |
Ga0209575_103366662 | 3300027739 | Freshwater | MNKGSQAKASMQKPTEGKKDTSKPKGGNVDFGYAGTARKGKKA |
Ga0209972_1000117228 | 3300027793 | Freshwater Lake | MKKGGRAKASVQKPTEGSKKAPMPKGGKVDFGYAAKARKGKKA |
Ga0209972_100022104 | 3300027793 | Freshwater Lake | MNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGYAPAGRKGKKA |
Ga0209972_100077826 | 3300027793 | Freshwater Lake | MKKGGRAKASVQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA |
Ga0209972_101715752 | 3300027793 | Freshwater Lake | MKKGGRAEASMAKPTEGKKDMKKPAGGMVKFGYAPAGRKGKKA |
Ga0209972_102180251 | 3300027793 | Freshwater Lake | CYVTRIYCRVGRCEMKKGGRAKASVQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA |
Ga0209229_1000004557 | 3300027805 | Freshwater And Sediment | MNKKGSRASAPVQKPTEGKKDTSKPKGGDVKFGYAPAGRRGKPA |
Ga0209229_100337061 | 3300027805 | Freshwater And Sediment | GGRAAAPVQQPTKGKMDTAKPAKSDVQFGYAPAGRKGKKA |
Ga0209229_103120102 | 3300027805 | Freshwater And Sediment | MKKGGRAKAPMAKPVEGKKDMKKPGGKVEFGYAGKARKGKKA |
Ga0209985_100431932 | 3300027806 | Freshwater Lake | MKKGGRAKASTQKPTEGSKKAPMPKGGKVAFGYAAKARKGKKA |
Ga0209985_101207783 | 3300027806 | Freshwater Lake | MNKKGGRAAAPMQQPTKGKMDTKKPAKSDVKFGYAPAGRKGKKA |
Ga0209990_100087746 | 3300027816 | Freshwater Lake | MKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAPAGRKGKKA |
Ga0209293_101029492 | 3300027877 | Wetland | MKKGGRAKAPMSKPVEGKKDMKKPKGGKVEFGYAGKARKG |
Ga0255201_10071781 | 3300028086 | Freshwater | MKKGGRAKASMAMPTEGKKDTKKPAGGMVKFGYAGKARKGKKA |
Ga0255172_10067293 | 3300028103 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGKLELGYAGKARKG |
Ga0255174_10327764 | 3300028275 | Freshwater | SRHCYVTRIYCRVGRCEMKKGGRAKASVAKPKEGSKKAPMPKGGAVKFGFAGKARKGKKA |
(restricted) Ga0247844_10304875 | 3300028571 | Freshwater | MKKGGRAKASMAKPTEGKKDMKKPAGGKVAFGYAGKARKGKKA |
Ga0307375_104897822 | 3300031669 | Soil | MNMKKGGRAKASMAMPKEGSKSAPKPAGGEVKFGYAPAGRKGKKA |
Ga0307377_109203762 | 3300031673 | Soil | MNMKKGGRAAASMAKPKEGPKSAPKPAGGEVKFGYAPAGRKGKKA |
Ga0315907_100103144 | 3300031758 | Freshwater | MKKGGRAKASMAKPKEGSKKAPMPKGGKVDFGYAAKARKGKKA |
Ga0315907_100874754 | 3300031758 | Freshwater | MKKGGRAAAPMQKPTEGKKDTSRPKGGAVKFGYAPAGRKGKKA |
Ga0315907_104127015 | 3300031758 | Freshwater | RRWKMRKGSVASAPVQKPTEGKKDMSKPAGGKVSFGMAPAGRKGKKA |
Ga0315907_107223792 | 3300031758 | Freshwater | MNAKGGRAAAPVQKPTEGKKDMSKPKGGKVDFGFAPAGRKGKKA |
Ga0315907_109938532 | 3300031758 | Freshwater | MRKGSVASAPVQKPTEGKKDMSKPAGGKVSFGMAPAGRKGKK |
Ga0315907_110236081 | 3300031758 | Freshwater | MKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAGKARKGKKA |
Ga0315907_111354952 | 3300031758 | Freshwater | MKKGGRAKASVQKPTEGSKKAPMPKGGEVKFGFAGKARKGKKA |
Ga0315900_100103093 | 3300031787 | Freshwater | MKKGGRAKASVQKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA |
Ga0315900_104321551 | 3300031787 | Freshwater | CRVGRCEMKKGGRAKAPMAKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA |
Ga0315909_103090351 | 3300031857 | Freshwater | MKKGGRAKAPVQKPTEGSKKAPMPKGGKVKFGYAGKARKGKKA |
Ga0315904_1000196122 | 3300031951 | Freshwater | MKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGFAAKARKGKKA |
Ga0315904_100124592 | 3300031951 | Freshwater | MGMKKGGRAAAPVQKPTEGKKDMAKPAGGKVFFGMAPAGRKGKKA |
Ga0315904_101430231 | 3300031951 | Freshwater | RAKAPVQKPTEGPKAAPMPKGSDVKFGYAGKARKGKKA |
Ga0315904_101468284 | 3300031951 | Freshwater | MNKGGRAKAPVAQPTKGKMDTKKPAKSDVKFGYAPAGRKGNKA |
Ga0315904_103224871 | 3300031951 | Freshwater | KKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA |
Ga0315904_109018531 | 3300031951 | Freshwater | AKAPMAKPTEGKKDMKKPKGGKVAFGYAGKARKGKKA |
Ga0315904_113587443 | 3300031951 | Freshwater | MKKGGRAKAAMQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA |
Ga0315906_107318131 | 3300032050 | Freshwater | CEMKKGGRAKAPMAKPTEGKKDMKKPKGGKVAFGYAGKARKGKKA |
Ga0315903_1000308131 | 3300032116 | Freshwater | MKKGGRAKASVAKPTEGSKKAPMPKGGAVKFGYAAKARKGKKA |
Ga0315903_100341825 | 3300032116 | Freshwater | MIKKGKVAKAPMSQVVKGPMDTAKPKGGEVQFGYAPAGRKGTKA |
Ga0315903_103281152 | 3300032116 | Freshwater | MKKGGRAAASVQQPTKGPMDTSKPKGGKTYFGMAPAGRKGKKA |
Ga0315903_103293574 | 3300032116 | Freshwater | CEMKKGGRAKAPMAKPTEGKKDMKKPGGKVEFGYAGKARKGKKA |
Ga0315903_105030082 | 3300032116 | Freshwater | MMGMKKGGRAAAPVQKPTEGKKDMAKPAGGKVFFGMAPAGRKGKKA |
Ga0315903_105179251 | 3300032116 | Freshwater | GGRAKASVQKPTEGSKKAPMPKGGEVKFGFAAKARKGKKA |
Ga0315903_107301972 | 3300032116 | Freshwater | MRKGSVASAPVQKPTEGKKDMSKPTGGKVSFGMAPAG |
Ga0316625_1001365334 | 3300033418 | Soil | MKKGGRAKAPMSKPVEGKKDMKKPKGGKVDFGYAGKARKGKKA |
Ga0316626_121350042 | 3300033485 | Soil | MNKKGGRAAAPMQKPTEGKKDTSKPKGGAVKFGYAPAGRKGKKA |
Ga0316616_1013008311 | 3300033521 | Soil | GGRAKASVQKPTEGKKDTKKPAGGMVKFGYAAKARKGKKA |
Ga0310127_012560_1452_1589 | 3300034072 | Fracking Water | MNTKKGGREKAPMQKPTEGKMDTRKPTGGKVAFGYAPAGRKGKKA |
Ga0335010_0198959_1100_1222 | 3300034092 | Freshwater | MKKGGRAKAPMAKPTEGKKDMKKPAGGKVAFGYAGKARKGK |
Ga0335066_0000402_21569_21700 | 3300034112 | Freshwater | MKKGGRAKAPVQKPTEGPKAAPMPKGSDVKFGYAGKARKGKKA |
⦗Top⦘ |