NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F019049

Metagenome Family F019049

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019049
Family Type Metagenome
Number of Sequences 232
Average Sequence Length 39 residues
Representative Sequence SGAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK
Number of Associated Samples 215
Number of Associated Scaffolds 232

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.76 %
% of genes near scaffold ends (potentially truncated) 92.67 %
% of genes from short scaffolds (< 2000 bps) 90.52 %
Associated GOLD sequencing projects 207
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(8.621 % of family members)
Environment Ontology (ENVO) Unclassified
(18.103 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.845 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.08%    β-sheet: 0.00%    Coil/Unstructured: 56.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 232 Family Scaffolds
PF14236DUF4338 68.10
PF03050DDE_Tnp_IS66 3.02
PF13518HTH_28 0.86
PF00239Resolvase 0.43
PF01695IstB_IS21 0.43
PF03462PCRF 0.43
PF00117GATase 0.43
PF02371Transposase_20 0.43
PF13466STAS_2 0.43
PF13360PQQ_2 0.43
PF02796HTH_7 0.43
PF00266Aminotran_5 0.43
PF13751DDE_Tnp_1_6 0.43
PF04389Peptidase_M28 0.43
PF05717TnpB_IS66 0.43
PF07228SpoIIE 0.43
PF00440TetR_N 0.43
PF02518HATPase_c 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 232 Family Scaffolds
COG3436TransposaseMobilome: prophages, transposons [X] 3.45
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.43
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.43
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.43
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.43
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.43
COG3547TransposaseMobilome: prophages, transposons [X] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.50 %
UnclassifiedrootN/A37.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10009839All Organisms → cellular organisms → Bacteria2635Open in IMG/M
3300000955|JGI1027J12803_102513012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300002914|JGI25617J43924_10290957All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005332|Ga0066388_101142398All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300005439|Ga0070711_102002991All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005471|Ga0070698_100383046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1339Open in IMG/M
3300005569|Ga0066705_10696761All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005577|Ga0068857_101515285Not Available654Open in IMG/M
3300005577|Ga0068857_102081193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae557Open in IMG/M
3300005602|Ga0070762_10145646All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300005614|Ga0068856_100423690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1351Open in IMG/M
3300005617|Ga0068859_101601018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae719Open in IMG/M
3300005921|Ga0070766_11317987All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae500Open in IMG/M
3300005949|Ga0066791_10105476All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300006028|Ga0070717_11751011All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006041|Ga0075023_100528649All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006059|Ga0075017_101117706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300006086|Ga0075019_10288591All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300006163|Ga0070715_10065320All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300006638|Ga0075522_10010525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6182Open in IMG/M
3300006642|Ga0075521_10399402Not Available669Open in IMG/M
3300006894|Ga0079215_10194136All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300006954|Ga0079219_12039186All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300007004|Ga0079218_11192613All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300007004|Ga0079218_12559711All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300007517|Ga0105045_10742098Not Available669Open in IMG/M
3300009012|Ga0066710_101841853Not Available910Open in IMG/M
3300009029|Ga0066793_10430420Not Available757Open in IMG/M
3300009143|Ga0099792_10158608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1253Open in IMG/M
3300009148|Ga0105243_11153498Not Available786Open in IMG/M
3300009156|Ga0111538_10070441All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. SK-34452Open in IMG/M
3300009161|Ga0114966_10001220All Organisms → cellular organisms → Bacteria23993Open in IMG/M
3300009162|Ga0075423_11406822All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300009177|Ga0105248_13132024Not Available526Open in IMG/M
3300009628|Ga0116125_1211881Not Available554Open in IMG/M
3300009631|Ga0116115_1071959Not Available900Open in IMG/M
3300009632|Ga0116102_1192752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300009633|Ga0116129_1032516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1718Open in IMG/M
3300009645|Ga0116106_1297467All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300009665|Ga0116135_1149135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae873Open in IMG/M
3300009683|Ga0116224_10420980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300009764|Ga0116134_1143661Not Available845Open in IMG/M
3300009792|Ga0126374_10791104Not Available724Open in IMG/M
3300009824|Ga0116219_10124297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1500Open in IMG/M
3300009826|Ga0123355_10948511Not Available924Open in IMG/M
3300009839|Ga0116223_10768696Not Available552Open in IMG/M
3300010048|Ga0126373_13197665All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010343|Ga0074044_10387655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae915Open in IMG/M
3300010360|Ga0126372_12162208All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300010360|Ga0126372_12407798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300010373|Ga0134128_11362631All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300010379|Ga0136449_100468405All Organisms → cellular organisms → Bacteria2202Open in IMG/M
3300010379|Ga0136449_101493986Not Available1035Open in IMG/M
3300010379|Ga0136449_103197428All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300010398|Ga0126383_11401635Not Available789Open in IMG/M
3300011269|Ga0137392_10517903Not Available991Open in IMG/M
3300011997|Ga0120162_1054877Not Available947Open in IMG/M
3300012203|Ga0137399_10851446Not Available768Open in IMG/M
3300012285|Ga0137370_10786414Not Available590Open in IMG/M
3300012361|Ga0137360_11096698Not Available687Open in IMG/M
3300012363|Ga0137390_11253924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300012469|Ga0150984_115237477Not Available722Open in IMG/M
3300012527|Ga0136633_1309776Not Available570Open in IMG/M
3300012533|Ga0138256_10620258All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300012668|Ga0157216_10244471Not Available837Open in IMG/M
3300012912|Ga0157306_10084695All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300012938|Ga0162651_100041049Not Available708Open in IMG/M
3300012944|Ga0137410_11437919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300012956|Ga0154020_10071861All Organisms → cellular organisms → Bacteria → Acidobacteria3494Open in IMG/M
3300012957|Ga0164303_10527656All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300012958|Ga0164299_10077622All Organisms → cellular organisms → Bacteria → Acidobacteria1654Open in IMG/M
3300012971|Ga0126369_12926627All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300013097|Ga0136639_10250236All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300014162|Ga0181538_10701260Not Available524Open in IMG/M
3300014200|Ga0181526_10487090All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300014325|Ga0163163_13249566Not Available507Open in IMG/M
3300014489|Ga0182018_10078407All Organisms → cellular organisms → Bacteria → Acidobacteria1962Open in IMG/M
3300014490|Ga0182010_10266066Not Available914Open in IMG/M
3300014492|Ga0182013_10671389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300014493|Ga0182016_10266771Not Available1064Open in IMG/M
3300014501|Ga0182024_11183822All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300014502|Ga0182021_10819929All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300014638|Ga0181536_10006211All Organisms → cellular organisms → Bacteria12051Open in IMG/M
3300014638|Ga0181536_10438209Not Available577Open in IMG/M
3300015167|Ga0167661_1031943All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300015372|Ga0132256_102830767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300016270|Ga0182036_11062502Not Available669Open in IMG/M
3300016270|Ga0182036_11706153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300016294|Ga0182041_10684501Not Available908Open in IMG/M
3300016371|Ga0182034_10151237All Organisms → cellular organisms → Bacteria → Acidobacteria1744Open in IMG/M
3300017929|Ga0187849_1373227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300017946|Ga0187879_10556576Not Available637Open in IMG/M
3300017961|Ga0187778_10628665Not Available721Open in IMG/M
3300017973|Ga0187780_10984476Not Available614Open in IMG/M
3300018008|Ga0187888_1024728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3081Open in IMG/M
3300018014|Ga0187860_1308534Not Available611Open in IMG/M
3300018024|Ga0187881_10193151Not Available869Open in IMG/M
3300018033|Ga0187867_10185421All Organisms → cellular organisms → Bacteria → Acidobacteria1187Open in IMG/M
3300018042|Ga0187871_10248631Not Available987Open in IMG/M
3300018057|Ga0187858_10399769Not Available854Open in IMG/M
3300018062|Ga0187784_10343903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1209Open in IMG/M
3300018062|Ga0187784_10714517Not Available801Open in IMG/M
3300018476|Ga0190274_13587148Not Available524Open in IMG/M
3300019787|Ga0182031_1306218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1270Open in IMG/M
3300019787|Ga0182031_1359251All Organisms → cellular organisms → Bacteria → Acidobacteria2278Open in IMG/M
3300020022|Ga0193733_1049549All Organisms → cellular organisms → Bacteria → Acidobacteria1186Open in IMG/M
3300020221|Ga0194127_10371325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus950Open in IMG/M
3300021405|Ga0210387_10340653All Organisms → cellular organisms → Bacteria → Acidobacteria1323Open in IMG/M
3300021424|Ga0194117_10209213All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300021475|Ga0210392_10666084Not Available774Open in IMG/M
3300021478|Ga0210402_11893654All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300021560|Ga0126371_12181916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300022213|Ga0224500_10129998Not Available948Open in IMG/M
3300022516|Ga0224542_1018485Not Available891Open in IMG/M
3300022861|Ga0224528_1021334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1501Open in IMG/M
3300023088|Ga0224555_1218318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300023259|Ga0224551_1031683Not Available911Open in IMG/M
3300024181|Ga0247693_1056270All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300025461|Ga0208851_1045284All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300025495|Ga0207932_1097776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia583Open in IMG/M
3300025604|Ga0207930_1083153Not Available748Open in IMG/M
3300025725|Ga0209638_1043825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1882Open in IMG/M
3300025912|Ga0207707_10204741All Organisms → cellular organisms → Bacteria → Acidobacteria1720Open in IMG/M
3300025913|Ga0207695_11206457Not Available637Open in IMG/M
3300025915|Ga0207693_10102185All Organisms → cellular organisms → Bacteria → Acidobacteria2248Open in IMG/M
3300025925|Ga0207650_10597152Not Available928Open in IMG/M
3300025926|Ga0207659_10393663Not Available1158Open in IMG/M
3300025936|Ga0207670_10126585All Organisms → cellular organisms → Bacteria1865Open in IMG/M
3300025949|Ga0207667_11943988Not Available549Open in IMG/M
3300026023|Ga0207677_11861129Not Available559Open in IMG/M
3300026088|Ga0207641_10444299All Organisms → cellular organisms → Bacteria → Acidobacteria1252Open in IMG/M
3300026095|Ga0207676_12571687Not Available505Open in IMG/M
3300026217|Ga0209871_1016901All Organisms → cellular organisms → Bacteria → Acidobacteria1356Open in IMG/M
3300026332|Ga0209803_1062572All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300026371|Ga0257179_1037934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300026451|Ga0247845_1014064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1318Open in IMG/M
3300026494|Ga0257159_1063105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300026499|Ga0257181_1005622All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300026514|Ga0257168_1069300Not Available778Open in IMG/M
3300026538|Ga0209056_10065837All Organisms → cellular organisms → Bacteria → Acidobacteria3139Open in IMG/M
3300026551|Ga0209648_10442550Not Available814Open in IMG/M
3300026551|Ga0209648_10449056Not Available802Open in IMG/M
3300026728|Ga0208069_100408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium937Open in IMG/M
3300026879|Ga0207763_1003872All Organisms → cellular organisms → Bacteria → Acidobacteria1681Open in IMG/M
3300026890|Ga0207781_1001543All Organisms → cellular organisms → Bacteria → Acidobacteria3051Open in IMG/M
3300027326|Ga0209731_1018276Not Available964Open in IMG/M
3300027516|Ga0207761_1086033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300027587|Ga0209220_1004186All Organisms → cellular organisms → Bacteria → Acidobacteria3866Open in IMG/M
3300027618|Ga0208736_1101358Not Available691Open in IMG/M
3300027676|Ga0209333_1103024Not Available777Open in IMG/M
3300027680|Ga0207826_1069407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium971Open in IMG/M
3300027770|Ga0209086_10000738All Organisms → cellular organisms → Bacteria → Acidobacteria27523Open in IMG/M
3300027770|Ga0209086_10013743All Organisms → cellular organisms → Bacteria5337Open in IMG/M
3300027842|Ga0209580_10296501Not Available805Open in IMG/M
3300027854|Ga0209517_10325180All Organisms → cellular organisms → Bacteria → Acidobacteria889Open in IMG/M
3300027874|Ga0209465_10561727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300027875|Ga0209283_10192964All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300027895|Ga0209624_10124199All Organisms → cellular organisms → Bacteria → Acidobacteria1696Open in IMG/M
3300027905|Ga0209415_10829729All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300027910|Ga0209583_10204023Not Available846Open in IMG/M
(restricted) 3300027970|Ga0247837_1147316All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300028381|Ga0268264_11339834Not Available726Open in IMG/M
3300028762|Ga0302202_10282393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae808Open in IMG/M
3300028788|Ga0302189_10125478All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1133Open in IMG/M
3300028792|Ga0307504_10037542All Organisms → cellular organisms → Bacteria → Acidobacteria1320Open in IMG/M
3300028798|Ga0302222_10021572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2638Open in IMG/M
3300028798|Ga0302222_10335725Not Available589Open in IMG/M
3300028798|Ga0302222_10381133All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300028859|Ga0302265_1124686Not Available813Open in IMG/M
3300028871|Ga0302230_10144764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus933Open in IMG/M
3300028873|Ga0302197_10136596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1194Open in IMG/M
3300028874|Ga0302155_10088686All Organisms → cellular organisms → Bacteria → Acidobacteria1384Open in IMG/M
3300028882|Ga0302154_10414997All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300028906|Ga0308309_11357331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300029882|Ga0311368_10565924Not Available806Open in IMG/M
3300029883|Ga0311327_10435614Not Available816Open in IMG/M
3300029907|Ga0311329_10941564All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300029911|Ga0311361_10644960All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300029917|Ga0311326_10651595Not Available503Open in IMG/M
3300029951|Ga0311371_11994050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300029986|Ga0302188_10184813All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300029992|Ga0302276_10162812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1076Open in IMG/M
3300030020|Ga0311344_10412224All Organisms → cellular organisms → Bacteria → Acidobacteria1236Open in IMG/M
3300030041|Ga0302274_10500208All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300030225|Ga0302196_10195865Not Available1007Open in IMG/M
3300030339|Ga0311360_11192620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300030499|Ga0268259_10088469All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300030518|Ga0302275_10005530All Organisms → cellular organisms → Bacteria12146Open in IMG/M
3300030519|Ga0302193_10649643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300030618|Ga0311354_11706123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans550Open in IMG/M
3300030677|Ga0302317_10284855Not Available742Open in IMG/M
3300030693|Ga0302313_10154275Not Available936Open in IMG/M
3300031234|Ga0302325_12706800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300031238|Ga0265332_10093507All Organisms → cellular organisms → Bacteria → Acidobacteria1270Open in IMG/M
3300031259|Ga0302187_10279874Not Available828Open in IMG/M
3300031261|Ga0302140_10709653All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300031525|Ga0302326_11094065Not Available1108Open in IMG/M
3300031544|Ga0318534_10300261Not Available925Open in IMG/M
3300031546|Ga0318538_10122033Not Available1361Open in IMG/M
3300031573|Ga0310915_10933066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300031670|Ga0307374_10253033Not Available1175Open in IMG/M
3300031681|Ga0318572_10227567Not Available1094Open in IMG/M
3300031718|Ga0307474_11230594All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300031719|Ga0306917_10176230Not Available1605Open in IMG/M
3300031719|Ga0306917_11225095Not Available582Open in IMG/M
3300031770|Ga0318521_10390794Not Available828Open in IMG/M
3300031793|Ga0318548_10069854All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300031798|Ga0318523_10291073Not Available815Open in IMG/M
3300031890|Ga0306925_10929923All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300031912|Ga0306921_10795230All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300031941|Ga0310912_10011613All Organisms → cellular organisms → Bacteria5587Open in IMG/M
3300031946|Ga0310910_10035531All Organisms → cellular organisms → Bacteria → Acidobacteria3424Open in IMG/M
3300031954|Ga0306926_10351963All Organisms → cellular organisms → Bacteria → Acidobacteria1821Open in IMG/M
3300031962|Ga0307479_11077949Not Available770Open in IMG/M
3300032066|Ga0318514_10583837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300032116|Ga0315903_10819810All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300032160|Ga0311301_11901552Not Available701Open in IMG/M
3300032783|Ga0335079_10900174Not Available909Open in IMG/M
3300032805|Ga0335078_10398803All Organisms → cellular organisms → Bacteria → Acidobacteria1807Open in IMG/M
3300032898|Ga0335072_11367304All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300033158|Ga0335077_10123285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3009Open in IMG/M
3300033158|Ga0335077_10130500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans2908Open in IMG/M
3300033158|Ga0335077_11131807Not Available771Open in IMG/M
3300033289|Ga0310914_10884997Not Available792Open in IMG/M
3300033290|Ga0318519_10701281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300033412|Ga0310810_10058017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4699Open in IMG/M
3300033480|Ga0316620_11562336Not Available653Open in IMG/M
3300033513|Ga0316628_100527602All Organisms → cellular organisms → Bacteria → Acidobacteria1528Open in IMG/M
3300033513|Ga0316628_101053181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1081Open in IMG/M
3300033818|Ga0334804_069331Not Available968Open in IMG/M
3300033829|Ga0334854_093030Not Available721Open in IMG/M
3300034820|Ga0373959_0174327Not Available556Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.62%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog8.62%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.02%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.02%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.16%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.72%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.86%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.86%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.86%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.43%
Polar DesertEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert0.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.43%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.43%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.43%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.43%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.43%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.43%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.43%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.43%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.43%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.43%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.43%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.43%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.43%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.43%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.43%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.43%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.43%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.43%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.43%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.43%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007517Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011997Permafrost microbial communities from Nunavut, Canada - A15_80cm_18MEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012527Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06)EnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013097Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06)EnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022516Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34EnvironmentalOpen in IMG/M
3300022861Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300025461Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025495Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026451Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T-25EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026728Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN412 (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300026890Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes)EnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027618Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028859Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030693Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1000983913300000597Forest SoilQPAKKLEAYEAQLLLAAGDVSRVRAAPMWRRVDGPN*
JGI1027J12803_10251301213300000955SoilEATGATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK*
JGI25617J43924_1029095713300002914Grasslands SoilQASEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK*
Ga0066388_10114239813300005332Tropical Forest SoilESDRPAKPLEAYAVQVLMAAGDVSRVRAAPMWRRVGAPRV*
Ga0070711_10200299123300005439Corn, Switchgrass And Miscanthus RhizosphereFQWWPEASGASKPLEAYEAQLLLVAGDVSRVHAAPMWRRVNAGR*
Ga0070698_10038304613300005471Corn, Switchgrass And Miscanthus RhizosphereRFVWRPEATGTTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSALK*
Ga0066705_1069676123300005569SoilATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK*
Ga0068857_10151528513300005577Corn RhizospherePAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK*
Ga0068857_10208119323300005577Corn RhizosphereWWPEATGTTKPLEAYEAQLLMAAGDVSRLRAAPMWRRVGVLK*
Ga0070762_1014564633300005602SoilAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSVLK*
Ga0068856_10042369013300005614Corn RhizosphereESNSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVS*
Ga0068859_10160101823300005617Switchgrass RhizosphereSDAPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNTLK*
Ga0070766_1131798723300005921SoilGAAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK*
Ga0066791_1010547613300005949SoilTSKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK*
Ga0070717_1175101113300006028Corn, Switchgrass And Miscanthus RhizosphereQGRFAWWPESSSAAERLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK*
Ga0075023_10052864913300006041WatershedsEASEAAKPLEAYEAQLLLAAGDVSRVRAAPMWRRVTALK*
Ga0075017_10111770613300006059WatershedsTEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNAPK*
Ga0075019_1028859123300006086WatershedsSGAAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK*
Ga0070715_1006532033300006163Corn, Switchgrass And Miscanthus RhizosphereGTTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSALK*
Ga0075522_1001052513300006638Arctic Peat SoilWWPESSSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEVK*
Ga0075521_1039940223300006642Arctic Peat SoilNSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELA*
Ga0079215_1019413613300006894Agricultural SoilEPAKSLEAYEAQLLMAAGDVSRARAAPMWRRVNGPK*
Ga0079219_1203918613300006954Agricultural SoilSGNSPGKPLEAYEAQLLLAAGDVSRVRAAPMWRRVNTAR*
Ga0079218_1119261323300007004Agricultural SoilVWWPEATGTTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVGVLK*
Ga0079218_1255971123300007004Agricultural SoilWPESDAPAKPLEAYEAQMLMAAGDVSRVRVAPMWPRVNTLK*
Ga0105045_1074209833300007517FreshwaterWPESGNVAKQLEAYQALLLFAAGDVAGVRAAPMWRRVNALK*
Ga0066710_10184185313300009012Grasslands SoilIWWPEASEPTKSLEAFEVQLLMAAGDVSRVRAAPMWRRVKALK
Ga0066793_1043042023300009029Prmafrost SoilDAAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPTK*
Ga0099792_1015860813300009143Vadose Zone SoilTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSALK*
Ga0105243_1115349813300009148Miscanthus RhizospherePEASGPTKPLEAYEAQLLMGAGDLSRVMAAPMWRRVGVLK*
Ga0111538_1007044173300009156Populus RhizosphereMWWPEATGTTKPLEAYEAQLLMAAGDVSRVRAAPMWRRVGVLK*
Ga0114966_10001220203300009161Freshwater LakeWWPESDNAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLQ*
Ga0075423_1140682233300009162Populus RhizosphereMWWPEATGTTKPLEAYEAQLLMAAGYVSRVRAAPMWRRVGVLK*
Ga0105248_1313202413300009177Switchgrass RhizosphereATGPTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVGVLK*
Ga0116125_121188113300009628PeatlandAAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNAIK*
Ga0116115_107195913300009631PeatlandQVAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK*
Ga0116102_119275213300009632PeatlandLPESDAAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPIK*
Ga0116129_103251633300009633PeatlandEAAKPLESYEAQLLMAAGDVSRVRAAPMWRRVNVLK*
Ga0116106_129746723300009645PeatlandPEATGPAKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRVLK*
Ga0116135_114913513300009665PeatlandWWPESTNAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSVPK*
Ga0116224_1042098023300009683Peatlands SoilTEPTKPLEAYEAQLLMAAGDLSRVKAAPMWRRVNTPK*
Ga0116134_114366113300009764PeatlandSQVAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK*
Ga0126374_1079110423300009792Tropical Forest SoilPEADTPAKRLESYEAQLLLAAGDVSRVRAAPMWRRVNGTQLVNS*
Ga0116219_1012429713300009824Peatlands SoilATGPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK*
Ga0123355_1094851113300009826Termite GutQPAKKLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPD*
Ga0116223_1076869613300009839Peatlands SoilWWPEASGPAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSGPK*
Ga0126373_1319766523300010048Tropical Forest SoilAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALR*
Ga0074044_1038765523300010343Bog Forest SoilWWPEATGPAKGLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK*
Ga0126372_1216220823300010360Tropical Forest SoilEAVEPAKPLEAYEAQLLMAAGDLSRLRAAPMWRRVNARK*
Ga0126372_1240779813300010360Tropical Forest SoilATSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK*
Ga0134128_1136263113300010373Terrestrial SoilKWWPEASGPAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG*
Ga0136449_10046840543300010379Peatlands SoilWPEGIEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNAPK*
Ga0136449_10149398623300010379Peatlands SoilGPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK*
Ga0136449_10319742823300010379Peatlands SoilVWWPEGTGATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK*
Ga0126383_1140163513300010398Tropical Forest SoilTWWPEAVEPAKPLEAYEVQLLMAAGDLSRVRAAPMWRRVTARK*
Ga0137392_1051790323300011269Vadose Zone SoilEASGAAKAIEAYEAHLLMAAGDVSQVRAAPMWRRVSAGK*
Ga0120162_105487713300011997PermafrostRQESTSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK*
Ga0137399_1085144623300012203Vadose Zone SoilPAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK*
Ga0137370_1078641413300012285Vadose Zone SoilIESAKPLEAYEAQLLMAAGDLSGVRAAPMWHRVTARK*
Ga0137360_1109669823300012361Vadose Zone SoilQPAKLLEAYEVHLLMAAGDVSRVRAAPMWRRVNALK*
Ga0137390_1125392413300012363Vadose Zone SoilATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK*
Ga0150984_11523747733300012469Avena Fatua RhizosphereRFQWWPEASGASKPLEAYEARLLLATGDVTGVHVAPL*
Ga0136633_130977623300012527Polar Desert SandGDAAKQLEAYEALLLFAAGDVERVRAAPMWRRVNALK*
Ga0138256_1062025823300012533Active SludgeWPESDHAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNALK*
Ga0157216_1024447113300012668Glacier Forefield SoilWWPESGNAAQQLEAYEALLLFAAGDVARVRAAPMWRRVNALK*
Ga0157306_1008469523300012912SoilMWWPEATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK*
Ga0162651_10004104923300012938SoilEAGGATKPLEAYEAQLLMAAGGVSRVRAAPMWRRINALK*
Ga0137410_1143791913300012944Vadose Zone SoilATGPTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK*
Ga0154020_1007186113300012956Active SludgeAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNVLK*
Ga0164303_1052765613300012957SoilGPAKGLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK*
Ga0164299_1007762213300012958SoilEPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVTARK*
Ga0126369_1292662733300012971Tropical Forest SoilPEASSAAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG*
Ga0136639_1025023613300013097Polar Desert SandKGRFIWWPESGNVAKQLEAYQALLLFAAGDVAGVRAPPMWRRVNALK*
Ga0181538_1070126023300014162BogEAAGPTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVGVLK*
Ga0181526_1048709013300014200BogEASEPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK*
Ga0163163_1324956613300014325Switchgrass RhizosphereESETPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK*
Ga0182018_1007840733300014489PalsaAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK*
Ga0182010_1026606613300014490FenSSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSVLK*
Ga0182013_1067138913300014492BogPESTSPAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSELK*
Ga0182016_1026677123300014493BogSISAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK*
Ga0182024_1118382223300014501PermafrostWWPEANSPAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEVK*
Ga0182021_1081992913300014502FenSSAAKQLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK*
Ga0181536_10006211153300014638BogEGTEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNAPK*
Ga0181536_1043820913300014638BogAPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK*
Ga0167661_103194313300015167Glacier Forefield SoilDKPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVTALK*
Ga0132256_10283076723300015372Arabidopsis RhizospherePEASGPTKPLEAYEAQLLMAAGDLSRVRAVPMWRRVGVLK*
Ga0182036_1106250213300016270SoilPAKRLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPN
Ga0182036_1170615323300016270SoilWWPEADVPTKRLESYEAHLLLAAGDVSRVHAAPMWKRVDGTQLANP
Ga0182041_1068450113300016294SoilWPEAAEATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTPN
Ga0182034_1015123713300016371SoilMVAEAAEATKPLEANEAQLLMAAGDPSRVRAAPMWRRVNAPK
Ga0187849_137322723300017929PeatlandEATGPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK
Ga0187879_1055657623300017946PeatlandAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNAMK
Ga0187778_1062866523300017961Tropical PeatlandWWPQAEQPAKRLESYEAQLLLAAGDVSRVRAAPVWRRVNEPK
Ga0187780_1098447613300017973Tropical PeatlandPTKGLEAYEAQLLMAAGDVSRVCAAPMWRRVNTIK
Ga0187888_102472843300018008PeatlandVWWPEASEAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK
Ga0187860_130853423300018014PeatlandSDAPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK
Ga0187881_1019315113300018024PeatlandPESDAAAKALEAYEAQLLMAAGDLSRVRAAPMWRRVNAIK
Ga0187867_1018542113300018033PeatlandVWWPEATGPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK
Ga0187871_1024863113300018042PeatlandAAKQLEAYEAQLLMVAGDVSRVCAAPMWRRVSVLK
Ga0187858_1039976913300018057PeatlandATGPTKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRVLK
Ga0187784_1034390313300018062Tropical PeatlandESDAPAKPLEAYEAQLLMAAGDHPHLRAAAMWRRVNALR
Ga0187784_1071451723300018062Tropical PeatlandDKPTKRLESYEAQLLLAAGDVSRVRAAPMWRRVNGPN
Ga0190274_1358714823300018476SoilIWWPESGSAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNVLK
Ga0182031_130621833300019787BogPAKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRVLK
Ga0182031_135925113300019787BogVWPKSSSAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVSVLK
Ga0193733_104954933300020022SoilSGAAKALEAYEAQLLMAAGDVSRVRAAPMWRRVNVQK
Ga0194127_1037132533300020221Freshwater LakeVWWPAPESTGHAAKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRALK
Ga0210387_1034065313300021405SoilEGSGAAKPLEAYEAQLLMAAGDVSRVRVAPMWRRVNVLK
Ga0194117_1020921313300021424Freshwater LakeNDAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNALK
Ga0210392_1066608413300021475SoilVGWPESSEPAKPLEAYEAQLLMAAGDIARVRAAPMWRRVNVLK
Ga0210402_1189365423300021478SoilAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEQK
Ga0126371_1218191613300021560Tropical Forest SoilEGATKGLEAYEVQLLMAAGDVSRVRAAPMWRRVNAPK
Ga0224500_1012999813300022213SedimentEAAKPLEAYEAQLLLAAGDVSRVRAAPMWRRVTALK
Ga0224542_101848513300022516SoilSSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK
Ga0224528_102133453300022861SoilFTCWPESSSAAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSELK
Ga0224555_121831813300023088SoilESGSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK
Ga0224551_103168313300023259SoilPQASEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0247693_105627023300024181SoilWPEGTEATKPLEAYEAQLLMAAGDLSRVKAAPMWRRVNAPK
Ga0208851_104528423300025461Arctic Peat SoilPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK
Ga0207932_109777613300025495Arctic Peat SoilTWWPESATAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSVLK
Ga0207930_108315323300025604Arctic Peat SoilPEATGATKPLEAYEAQLLMAAGDLSRVRVAPMWRRVGVPK
Ga0209638_104382533300025725Arctic Peat SoilVWWPEGSAAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK
Ga0207707_1020474133300025912Corn RhizosphereEPTKPLEAYEAQLLMAAGDLSRVKAAPMWRRVNTPK
Ga0207695_1120645713300025913Corn RhizosphereSEPAKLLEAYEAQLLIVAGDVSRVRAAPMWRPVNTLK
Ga0207693_1010218533300025915Corn, Switchgrass And Miscanthus RhizosphereATEPTKLLDAYEAQLLMAAGDLSRVRAAPMWRRVNTPK
Ga0207650_1059715213300025925Switchgrass RhizosphereMVAGSEPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK
Ga0207659_1039366333300025926Miscanthus RhizosphereWPEATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK
Ga0207670_1012658523300025936Switchgrass RhizosphereMWWPEATGTTKPLEAYEAQLLMAAGDVSRVRAAPMWRRVGVLK
Ga0207667_1194398813300025949Corn RhizospherePAKPLEAYEANLLMAAGGISRVRAAPMWRRVGRLK
Ga0207677_1186112923300026023Miscanthus RhizosphereASGPAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG
Ga0207641_1044429933300026088Switchgrass RhizosphereSGPTKPLEAYEAQLLVAAGDLSRVRAAPMWRRVGVLK
Ga0207676_1257168713300026095Switchgrass RhizosphereWPESDAPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNTLK
Ga0209871_101690113300026217Permafrost SoilEATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK
Ga0209803_106257213300026332SoilEPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK
Ga0257179_103793413300026371SoilSGAAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0247845_101406433300026451SoilWWPESSSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK
Ga0257159_106310523300026494SoilGSGPARALEAYEAQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0257181_100562213300026499SoilSEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVGVLK
Ga0257168_106930023300026514SoilPEGSGAAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0209056_1006583743300026538SoilGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK
Ga0209648_1044255013300026551Grasslands SoilGSGAAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0209648_1044905623300026551Grasslands SoilQASEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0208069_10040813300026728SoilTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK
Ga0207763_100387213300026879Tropical Forest SoilPAKPLEAYEAQLLMAAGDVSRLRAAPMWRRVNALK
Ga0207781_100154333300026890Tropical Forest SoilMVPESEAPAKPLESYEAQLLMAAGDVSRLRAAPMWRRVNALK
Ga0209731_101827623300027326Forest SoilWWPEASEAAKRLETYEAQLLMAAGDVSRVRAAPMWRRVEAPP
Ga0207761_108603313300027516Tropical Forest SoilSSAAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSALG
Ga0209220_100418653300027587Forest SoilPAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0208736_110135823300027618Polar DesertATAPAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVNALK
Ga0209333_110302413300027676Forest SoilAAKPLESYEAQLLMAAGDVSRVRAAPMWRRVNVLK
Ga0207826_106940723300027680Tropical Forest SoilVQRKIHMVPESEAPAKPLEAYEAQLLMAAGDVSRLRAAPMWRRVNALK
Ga0209086_10000738233300027770Freshwater LakeWWPESDNAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLQ
Ga0209086_1001374363300027770Freshwater LakeWPESDNAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLK
Ga0209580_1029650113300027842Surface SoilGTEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNTPK
Ga0209517_1032518013300027854Peatlands SoilGPAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSGPK
Ga0209465_1056172723300027874Tropical Forest SoilPAKALEAYEAHLLMAAGDVSRVRAAPMWRRVGALK
Ga0209283_1019296413300027875Vadose Zone SoilPAKGLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK
Ga0209624_1012419913300027895Forest SoilAGAAQSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0209415_1082972913300027905Peatlands SoilEANGRTKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK
Ga0209583_1020402323300027910WatershedsMSHSDHAEAAKPLEAYEAQLLLAAGDVSRVRAAPMWRRVTALK
(restricted) Ga0247837_114731623300027970FreshwaterSDHAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLK
Ga0268264_1133983413300028381Switchgrass RhizosphereSEPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK
Ga0302202_1028239323300028762BogFTWWPESISAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK
Ga0302189_1012547833300028788BogSAAKALEAYDAQLLMVAGDVSRVRAAPMWRRVSVLK
Ga0307504_1003754213300028792SoilPAKLLEAYEAHLLMAAGDVSRVRAAPMWRRVNAPK
Ga0302222_1002157213300028798PalsaAWWPESSSSAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK
Ga0302222_1033572513300028798PalsaPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPIK
Ga0302222_1038113313300028798PalsaWWPEGSGAAKSLEAYEAQLLMAAGDVSRVRAAPMGRRVNVLK
Ga0302265_112468623300028859BogAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSVLK
Ga0302230_1014476413300028871PalsaGAAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNVLK
Ga0302197_1013659633300028873BogRFAWWPESTSAAKQLEAYEAQLLMVAGDVSRIKAAPMWRRVSALR
Ga0302155_1008868633300028874BogWPESSSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK
Ga0302154_1041499713300028882BogKGRFTCWPESGSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEPK
Ga0308309_1135733123300028906SoilSGAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK
Ga0311368_1056592413300029882PalsaSDAAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPTK
Ga0311327_1043561423300029883BogAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK
Ga0311329_1094156423300029907BogWWPESASAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSVLK
Ga0311361_1064496013300029911BogSQGRFAWWPESASAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSMLK
Ga0311326_1065159523300029917BogSAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSMLK
Ga0311371_1199405023300029951PalsaTWWPESSSVATQLEAYEAQLLMVAGDVSRVRAAPMWRRVNALK
Ga0302188_1018481313300029986BogAWWPESASAVKQLEAYEAQLLMVAGDASRISAAPMWRRVSVLK
Ga0302276_1016281213300029992BogWPESSSAAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSELK
Ga0311344_1041222413300030020BogEATSPAKALEAYEAQLLMVAGDVSRVHAAPMWRRVSVLK
Ga0302274_1050020823300030041BogVWWPEGSEAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK
Ga0302196_1019586523300030225BogEASSPAKRLEAYEAQLLMVAGDVSRVCAAPMWRRVS
Ga0311360_1119262013300030339BogAANQLESYEAQLLMAAGDVSRVRAAPMWRRVNALK
Ga0268259_1008846923300030499AgaveVWWPEGNGPAKPLEAYEAQLLMAAGDISRVRAAPMWRRVNTLQ
Ga0302275_1000553013300030518BogRFTCWPESGTAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEPK
Ga0302193_1064964313300030519BogSTSAAKQLEAYEAQLLMVAGDVARVRAAPMWRRVSALK
Ga0311354_1170612313300030618PalsaTSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK
Ga0302317_1028485513300030677PalsaWPESDAPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK
Ga0302313_1015427523300030693PalsaDAPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK
Ga0302325_1270680023300031234PalsaESSSAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVSMLK
Ga0265332_1009350713300031238RhizosphereWPEATGPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK
Ga0302187_1027987423300031259BogESASAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSMLK
Ga0302140_1070965313300031261BogFAWWPESSSPAKRLEAYEAQLLMVAGDVSRIRAAPMWRRVS
Ga0302326_1109406513300031525PalsaEANGPARSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG
Ga0318534_1030026123300031544SoilPRGIFAGGRKPAKRLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPN
Ga0318538_1012203313300031546SoilDTPAKRLEAYQAQLLLAAGDVSRVRAAPMWRRVNGPN
Ga0310915_1093306623300031573SoilSAPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLN
Ga0307374_1025303333300031670SoilWPESSSPAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSDLK
Ga0318572_1022756713300031681SoilWPQAEQPAKRLESYEAQLLLAAGDVSQVRAAPMWRRVNGPK
Ga0307474_1123059423300031718Hardwood Forest SoilVWWPEATGPTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK
Ga0306917_1017623013300031719SoilEATKPLEAYEAQLLMAAGDPSRVRAAPMWRRVNAPK
Ga0306917_1122509513300031719SoilESDTPAKPLEAHEAQLLMVAGDLSRLRAAPMWRRVNALR
Ga0318521_1039079413300031770SoilWPEADQPAKKLEAYEAQLLLAAGDVSRVHAAPMWRRVDGPN
Ga0318548_1006985433300031793SoilTPAKRLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPN
Ga0318523_1029107323300031798SoilSEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0306925_1092992323300031890SoilMVAEAAEATKPLEANEAQLLMAAGDLFRVRAAPMWRRVNALT
Ga0306921_1079523013300031912SoilPESDAPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALR
Ga0310912_1001161313300031941SoilWWPEASAPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK
Ga0310910_1003553153300031946SoilWWPEAAEATKLLEAYEAQLLMAAGDLSRVRAAPMWRRVNAPK
Ga0306926_1035196313300031954SoilASGPAKSLEAYEAQLLMAAGDISRVRAAPMWRRVNG
Ga0307479_1107794923300031962Hardwood Forest SoilWPEASEAAKRLETYEAQLLMAAGDVSRVRAAPMWRRVEAPP
Ga0318514_1058383713300032066SoilAAKALEAYEAQLLMVAGDVSRVRAAPMWRRVNAVV
Ga0315903_1081981013300032116FreshwaterWPESDHAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLK
Ga0311301_1190155213300032160Peatlands SoilAAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK
Ga0335079_1090017423300032783SoilRFVWGPQGCDATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNTPK
Ga0335078_1039880313300032805SoilWWPEASGAAKSLESYEAQLLMAAGDVSRVRAAPMWRRVNG
Ga0335072_1136730413300032898SoilAAKPLEAYEAQLLMAAGDLSRLRAAPMWRRVNAPK
Ga0335077_1012328543300033158SoilESSSPAKALEAYEAHLLMAAGDVSRVRAAPMWRRVNTVA
Ga0335077_1013050043300033158SoilAANEPAKPLEAYEAQLLMAAGDLSRLRAAPMWRRVTARK
Ga0335077_1113180713300033158SoilPESDAPAKPLEAYEAQLLIAAGDLSRLRVAPMWRRVNALR
Ga0310914_1088499723300033289SoilQPAKRLESYEAQLLLAAGDVSRVRAAPVWRRVNEPK
Ga0318519_1070128123300033290SoilAEPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNAPK
Ga0310810_1005801793300033412SoilVWWPEATGTTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVSVLK
Ga0316620_1156233623300033480SoilSALPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK
Ga0316628_10052760233300033513SoilLPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK
Ga0316628_10105318123300033513SoilVWWPEDTRATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK
Ga0334804_069331_860_9673300033818SoilAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEVK
Ga0334854_093030_592_7203300033829SoilWWPESSSAAKRLEAYEAQLLMVAGDVSRVHAAPMWRRVSELK
Ga0373959_0174327_1_1233300034820Rhizosphere SoilPESETPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.