Basic Information | |
---|---|
Family ID | F018558 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 234 |
Average Sequence Length | 39 residues |
Representative Sequence | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Number of Associated Samples | 67 |
Number of Associated Scaffolds | 232 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 74.57 % |
% of genes near scaffold ends (potentially truncated) | 20.09 % |
% of genes from short scaffolds (< 2000 bps) | 73.50 % |
Associated GOLD sequencing projects | 58 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.821 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (19.658 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.470 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (36.325 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.31% β-sheet: 0.00% Coil/Unstructured: 87.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 232 Family Scaffolds |
---|---|---|
PF05402 | PqqD | 8.19 |
PF02412 | TSP_3 | 2.59 |
PF13186 | SPASM | 2.16 |
PF01243 | Putative_PNPOx | 1.29 |
PF06966 | DUF1295 | 0.86 |
PF13385 | Laminin_G_3 | 0.86 |
PF13517 | FG-GAP_3 | 0.86 |
PF12974 | Phosphonate-bd | 0.86 |
PF07603 | DUF1566 | 0.43 |
PF14697 | Fer4_21 | 0.43 |
PF13426 | PAS_9 | 0.43 |
PF00534 | Glycos_transf_1 | 0.43 |
PF01078 | Mg_chelatase | 0.43 |
PF13462 | Thioredoxin_4 | 0.43 |
PF01475 | FUR | 0.43 |
PF12695 | Abhydrolase_5 | 0.43 |
PF00275 | EPSP_synthase | 0.43 |
PF00440 | TetR_N | 0.43 |
PF13004 | BACON | 0.43 |
PF03781 | FGE-sulfatase | 0.43 |
PF03050 | DDE_Tnp_IS66 | 0.43 |
PF01966 | HD | 0.43 |
PF00535 | Glycos_transf_2 | 0.43 |
PF13448 | DUF4114 | 0.43 |
PF03459 | TOBE | 0.43 |
PF14870 | PSII_BNR | 0.43 |
PF05168 | HEPN | 0.43 |
PF02371 | Transposase_20 | 0.43 |
PF13360 | PQQ_2 | 0.43 |
PF01842 | ACT | 0.43 |
PF08340 | DUF1732 | 0.43 |
PF01909 | NTP_transf_2 | 0.43 |
PF00306 | ATP-synt_ab_C | 0.43 |
PF01565 | FAD_binding_4 | 0.43 |
PF01850 | PIN | 0.43 |
PF10049 | DUF2283 | 0.43 |
PF08126 | Propeptide_C25 | 0.43 |
PF00239 | Resolvase | 0.43 |
PF13229 | Beta_helix | 0.43 |
PF17210 | SdrD_B | 0.43 |
PF00374 | NiFeSe_Hases | 0.43 |
PF00210 | Ferritin | 0.43 |
PF00082 | Peptidase_S8 | 0.43 |
PF01750 | HycI | 0.43 |
PF05036 | SPOR | 0.43 |
PF00690 | Cation_ATPase_N | 0.43 |
PF01625 | PMSR | 0.43 |
PF08241 | Methyltransf_11 | 0.43 |
PF16173 | DUF4874 | 0.43 |
PF07690 | MFS_1 | 0.43 |
PF02874 | ATP-synt_ab_N | 0.43 |
PF01527 | HTH_Tnp_1 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
---|---|---|---|
COG2020 | Protein-S-isoprenylcysteine O-methyltransferase Ste14 | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
COG3752 | Steroid 5-alpha reductase family enzyme | General function prediction only [R] | 0.86 |
COG0055 | FoF1-type ATP synthase, beta subunit | Energy production and conversion [C] | 0.43 |
COG0056 | FoF1-type ATP synthase, alpha subunit | Energy production and conversion [C] | 0.43 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 0.43 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.43 |
COG0680 | Ni,Fe-hydrogenase maturation factor | Energy production and conversion [C] | 0.43 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.43 |
COG1155 | Archaeal/vacuolar-type H+-ATPase catalytic subunit A/Vma1 | Energy production and conversion [C] | 0.43 |
COG1156 | Archaeal/vacuolar-type H+-ATPase subunit B/Vma2 | Energy production and conversion [C] | 0.43 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.43 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.43 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.43 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.43 |
COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 0.43 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.25 % |
Unclassified | root | N/A | 36.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090005|LWSO_GFMCQXZ02H275C | Not Available | 557 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100993956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 | 1096 | Open in IMG/M |
3300001213|JGIcombinedJ13530_101472874 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2062 | Open in IMG/M |
3300001213|JGIcombinedJ13530_101606870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1463 | Open in IMG/M |
3300001213|JGIcombinedJ13530_101798538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 696 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102108877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 766 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102272050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 631 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102852760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 503 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103086258 | Not Available | 877 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103503016 | Not Available | 563 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103679512 | Not Available | 681 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103789222 | Not Available | 536 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103885576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 828 | Open in IMG/M |
3300001213|JGIcombinedJ13530_105735112 | Not Available | 701 | Open in IMG/M |
3300001213|JGIcombinedJ13530_106603479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 532 | Open in IMG/M |
3300001213|JGIcombinedJ13530_106858367 | Not Available | 538 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107452982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 615 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107586997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 536 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107605915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 621 | Open in IMG/M |
3300003432|JGI20214J51088_10022758 | All Organisms → cellular organisms → Bacteria | 4266 | Open in IMG/M |
3300003432|JGI20214J51088_10213056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1356 | Open in IMG/M |
3300003432|JGI20214J51088_10959203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 562 | Open in IMG/M |
3300003541|JGI20214J51650_11304746 | Not Available | 501 | Open in IMG/M |
3300003852|Ga0031655_10001071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16584 | Open in IMG/M |
3300003852|Ga0031655_10020626 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
3300003852|Ga0031655_10022308 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
3300003852|Ga0031655_10026369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2726 | Open in IMG/M |
3300003860|Ga0031658_1004846 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
3300003860|Ga0031658_1019068 | Not Available | 1154 | Open in IMG/M |
3300003860|Ga0031658_1027022 | Not Available | 968 | Open in IMG/M |
3300003860|Ga0031658_1084801 | Not Available | 566 | Open in IMG/M |
3300004282|Ga0066599_101619454 | Not Available | 502 | Open in IMG/M |
3300005077|Ga0071116_1047571 | All Organisms → cellular organisms → Bacteria | 2724 | Open in IMG/M |
3300005830|Ga0074473_10164423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3145 | Open in IMG/M |
3300005830|Ga0074473_10497318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 4829 | Open in IMG/M |
3300005833|Ga0074472_11115584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Schekmanbacteria → Candidatus Schekmanbacteria bacterium RIFCSPLOWO2_12_FULL_38_15 | 891 | Open in IMG/M |
3300006224|Ga0079037_100043221 | All Organisms → cellular organisms → Bacteria | 3459 | Open in IMG/M |
3300006224|Ga0079037_100072307 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
3300006224|Ga0079037_100223918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1704 | Open in IMG/M |
3300006224|Ga0079037_100401687 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → Candidatus Brocadia sinica | 1297 | Open in IMG/M |
3300006224|Ga0079037_100857856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 894 | Open in IMG/M |
3300006224|Ga0079037_100944017 | Not Available | 852 | Open in IMG/M |
3300006224|Ga0079037_100966559 | Not Available | 842 | Open in IMG/M |
3300006224|Ga0079037_101130186 | Not Available | 778 | Open in IMG/M |
3300006224|Ga0079037_101250226 | Not Available | 739 | Open in IMG/M |
3300006224|Ga0079037_101250226 | Not Available | 739 | Open in IMG/M |
3300006224|Ga0079037_101260885 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300006224|Ga0079037_101794263 | Not Available | 613 | Open in IMG/M |
3300006930|Ga0079303_10161373 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300006930|Ga0079303_10398155 | Not Available | 583 | Open in IMG/M |
3300007072|Ga0073932_1019256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4776 | Open in IMG/M |
3300007072|Ga0073932_1022621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4180 | Open in IMG/M |
3300007072|Ga0073932_1023142 | All Organisms → cellular organisms → Bacteria | 4103 | Open in IMG/M |
3300007072|Ga0073932_1156788 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300009009|Ga0105105_10305744 | Not Available | 860 | Open in IMG/M |
3300009037|Ga0105093_10520839 | Not Available | 664 | Open in IMG/M |
3300009082|Ga0105099_10129826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1406 | Open in IMG/M |
3300009087|Ga0105107_10644805 | Not Available | 737 | Open in IMG/M |
3300009091|Ga0102851_10072845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2869 | Open in IMG/M |
3300009091|Ga0102851_10076484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2811 | Open in IMG/M |
3300009091|Ga0102851_11764702 | Not Available | 696 | Open in IMG/M |
3300009091|Ga0102851_12014951 | Not Available | 654 | Open in IMG/M |
3300009091|Ga0102851_12882380 | Not Available | 552 | Open in IMG/M |
3300009111|Ga0115026_10019161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3291 | Open in IMG/M |
3300009111|Ga0115026_10051179 | Not Available | 2285 | Open in IMG/M |
3300009111|Ga0115026_10263320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1188 | Open in IMG/M |
3300009111|Ga0115026_10854966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 716 | Open in IMG/M |
3300009111|Ga0115026_11084814 | Not Available | 645 | Open in IMG/M |
3300009111|Ga0115026_11312820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 594 | Open in IMG/M |
3300009131|Ga0115027_10076296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1840 | Open in IMG/M |
3300009131|Ga0115027_10414267 | Not Available | 946 | Open in IMG/M |
3300009131|Ga0115027_10707316 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300009131|Ga0115027_11681231 | Not Available | 527 | Open in IMG/M |
3300009167|Ga0113563_10009456 | All Organisms → cellular organisms → Bacteria | 6730 | Open in IMG/M |
3300009167|Ga0113563_10178151 | Not Available | 2085 | Open in IMG/M |
3300009167|Ga0113563_10211827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1936 | Open in IMG/M |
3300009167|Ga0113563_10491603 | Not Available | 1335 | Open in IMG/M |
3300009167|Ga0113563_10657082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1169 | Open in IMG/M |
3300009167|Ga0113563_10830722 | Not Available | 1049 | Open in IMG/M |
3300009167|Ga0113563_10895040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1013 | Open in IMG/M |
3300009167|Ga0113563_11666364 | Not Available | 756 | Open in IMG/M |
3300009167|Ga0113563_11734890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 741 | Open in IMG/M |
3300009167|Ga0113563_11736069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 741 | Open in IMG/M |
3300009167|Ga0113563_12997081 | Not Available | 572 | Open in IMG/M |
3300009167|Ga0113563_13419354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 537 | Open in IMG/M |
3300009167|Ga0113563_13571766 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 526 | Open in IMG/M |
3300009167|Ga0113563_13961006 | Not Available | 502 | Open in IMG/M |
3300009179|Ga0115028_10020461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2842 | Open in IMG/M |
3300009179|Ga0115028_10795316 | Not Available | 735 | Open in IMG/M |
3300009179|Ga0115028_11022241 | Not Available | 665 | Open in IMG/M |
3300009506|Ga0118657_10652221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1335 | Open in IMG/M |
3300010430|Ga0118733_103847632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 809 | Open in IMG/M |
3300011340|Ga0151652_13326226 | Not Available | 872 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1010426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 4731 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1034928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2161 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10084847 | Not Available | 1908 | Open in IMG/M |
3300017944|Ga0187786_10222556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 731 | Open in IMG/M |
3300022385|Ga0210376_1101200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 512 | Open in IMG/M |
3300022554|Ga0212093_1011483 | All Organisms → cellular organisms → Bacteria | 8402 | Open in IMG/M |
3300022554|Ga0212093_1023309 | All Organisms → cellular organisms → Bacteria | 4463 | Open in IMG/M |
3300022554|Ga0212093_1025137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 4181 | Open in IMG/M |
3300022554|Ga0212093_1070928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1788 | Open in IMG/M |
(restricted) 3300023177|Ga0233423_10358619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 621 | Open in IMG/M |
3300024056|Ga0124853_1299182 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
3300027715|Ga0208665_10294868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 509 | Open in IMG/M |
3300027871|Ga0209397_10197081 | Not Available | 924 | Open in IMG/M |
3300027871|Ga0209397_10410287 | Not Available | 664 | Open in IMG/M |
3300027871|Ga0209397_10432107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 648 | Open in IMG/M |
3300027877|Ga0209293_10021906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2307 | Open in IMG/M |
3300027877|Ga0209293_10459624 | Not Available | 664 | Open in IMG/M |
3300027885|Ga0209450_10123214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1755 | Open in IMG/M |
3300027885|Ga0209450_10629651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 782 | Open in IMG/M |
3300027887|Ga0208980_10110334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1614 | Open in IMG/M |
3300027890|Ga0209496_10305089 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300027890|Ga0209496_10379689 | Not Available | 728 | Open in IMG/M |
3300027890|Ga0209496_10684553 | Not Available | 560 | Open in IMG/M |
3300027896|Ga0209777_10001997 | All Organisms → cellular organisms → Bacteria | 27920 | Open in IMG/M |
3300027896|Ga0209777_10003990 | All Organisms → cellular organisms → Bacteria | 17768 | Open in IMG/M |
3300027896|Ga0209777_10005593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 14396 | Open in IMG/M |
3300027896|Ga0209777_10008340 | All Organisms → cellular organisms → Bacteria | 11353 | Open in IMG/M |
3300027896|Ga0209777_10009525 | All Organisms → cellular organisms → Bacteria | 10429 | Open in IMG/M |
3300027896|Ga0209777_10012734 | All Organisms → cellular organisms → Bacteria | 8715 | Open in IMG/M |
3300027896|Ga0209777_10020052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 6640 | Open in IMG/M |
3300027896|Ga0209777_10036798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4571 | Open in IMG/M |
3300027896|Ga0209777_10047200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3924 | Open in IMG/M |
3300027896|Ga0209777_10047608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3904 | Open in IMG/M |
3300027896|Ga0209777_10053360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3644 | Open in IMG/M |
3300027896|Ga0209777_10103849 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
3300027896|Ga0209777_10146167 | Not Available | 1954 | Open in IMG/M |
3300027896|Ga0209777_10211306 | Not Available | 1552 | Open in IMG/M |
3300027897|Ga0209254_10033237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 4607 | Open in IMG/M |
3300027897|Ga0209254_10169209 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
3300027899|Ga0209668_10001378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10376 | Open in IMG/M |
3300027899|Ga0209668_10001994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 8896 | Open in IMG/M |
3300027899|Ga0209668_10002337 | All Organisms → cellular organisms → Bacteria | 8350 | Open in IMG/M |
3300027899|Ga0209668_10008645 | All Organisms → cellular organisms → Bacteria | 4705 | Open in IMG/M |
3300027899|Ga0209668_10016741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3552 | Open in IMG/M |
3300027899|Ga0209668_10020201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3280 | Open in IMG/M |
3300027899|Ga0209668_10025216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2988 | Open in IMG/M |
3300027899|Ga0209668_10213810 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300027899|Ga0209668_10372307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 930 | Open in IMG/M |
3300027899|Ga0209668_10650865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 706 | Open in IMG/M |
3300027902|Ga0209048_10334762 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300027902|Ga0209048_10956268 | Not Available | 550 | Open in IMG/M |
3300027902|Ga0209048_11046919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 519 | Open in IMG/M |
3300028621|Ga0257142_1009936 | Not Available | 1865 | Open in IMG/M |
3300028623|Ga0257141_1089034 | Not Available | 565 | Open in IMG/M |
3300029691|Ga0265598_1016363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1251 | Open in IMG/M |
3300031834|Ga0315290_10091394 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
3300031834|Ga0315290_10168427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1892 | Open in IMG/M |
3300031834|Ga0315290_10243945 | Not Available | 1567 | Open in IMG/M |
3300031834|Ga0315290_10650632 | Not Available | 912 | Open in IMG/M |
3300031834|Ga0315290_11037859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 689 | Open in IMG/M |
3300031834|Ga0315290_11429023 | Not Available | 565 | Open in IMG/M |
3300031997|Ga0315278_10164297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2273 | Open in IMG/M |
3300031997|Ga0315278_10181861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2159 | Open in IMG/M |
3300031997|Ga0315278_10519681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1224 | Open in IMG/M |
3300031997|Ga0315278_10531017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1209 | Open in IMG/M |
3300031997|Ga0315278_10811680 | Not Available | 944 | Open in IMG/M |
3300031997|Ga0315278_10940350 | Not Available | 865 | Open in IMG/M |
3300032143|Ga0315292_10282984 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300032143|Ga0315292_10801900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 789 | Open in IMG/M |
3300032143|Ga0315292_11257752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 607 | Open in IMG/M |
3300032164|Ga0315283_10685297 | Not Available | 1105 | Open in IMG/M |
3300032164|Ga0315283_11076016 | Not Available | 847 | Open in IMG/M |
3300032164|Ga0315283_11077915 | Not Available | 846 | Open in IMG/M |
3300032164|Ga0315283_11324394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 746 | Open in IMG/M |
3300032164|Ga0315283_11979207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 580 | Open in IMG/M |
3300032164|Ga0315283_12059815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 566 | Open in IMG/M |
3300032177|Ga0315276_10026017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5614 | Open in IMG/M |
3300032177|Ga0315276_10110927 | Not Available | 2804 | Open in IMG/M |
3300032177|Ga0315276_10279746 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300032177|Ga0315276_10641413 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300032177|Ga0315276_10902500 | Not Available | 943 | Open in IMG/M |
3300032177|Ga0315276_11713111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 649 | Open in IMG/M |
3300032177|Ga0315276_12364326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 535 | Open in IMG/M |
3300032177|Ga0315276_12599358 | Not Available | 505 | Open in IMG/M |
3300032342|Ga0315286_10995050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 834 | Open in IMG/M |
3300032342|Ga0315286_11905555 | Not Available | 555 | Open in IMG/M |
3300032397|Ga0315287_10230448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2170 | Open in IMG/M |
3300032397|Ga0315287_12527919 | Not Available | 551 | Open in IMG/M |
3300032401|Ga0315275_10262578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1930 | Open in IMG/M |
3300032401|Ga0315275_11407434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 752 | Open in IMG/M |
3300032516|Ga0315273_10136467 | Not Available | 3363 | Open in IMG/M |
3300032516|Ga0315273_10298671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2186 | Open in IMG/M |
3300032516|Ga0315273_10469952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1687 | Open in IMG/M |
3300032516|Ga0315273_13108692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 516 | Open in IMG/M |
3300033408|Ga0316605_11687449 | Not Available | 616 | Open in IMG/M |
3300033408|Ga0316605_12279796 | Not Available | 527 | Open in IMG/M |
3300033413|Ga0316603_10280332 | Not Available | 1463 | Open in IMG/M |
3300033413|Ga0316603_10435099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1193 | Open in IMG/M |
3300033413|Ga0316603_10435099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1193 | Open in IMG/M |
3300033413|Ga0316603_10931383 | Not Available | 819 | Open in IMG/M |
3300033413|Ga0316603_11496347 | Not Available | 640 | Open in IMG/M |
3300033413|Ga0316603_11755003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 588 | Open in IMG/M |
3300033414|Ga0316619_10567056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 938 | Open in IMG/M |
3300033414|Ga0316619_11002280 | Not Available | 727 | Open in IMG/M |
3300033414|Ga0316619_11016862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 723 | Open in IMG/M |
3300033414|Ga0316619_11099536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 697 | Open in IMG/M |
3300033414|Ga0316619_12033904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 524 | Open in IMG/M |
3300033414|Ga0316619_12104630 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300033418|Ga0316625_100052630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1988 | Open in IMG/M |
3300033418|Ga0316625_100521657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 944 | Open in IMG/M |
3300033418|Ga0316625_100783837 | Not Available | 815 | Open in IMG/M |
3300033418|Ga0316625_101019452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 739 | Open in IMG/M |
3300033418|Ga0316625_101629471 | Not Available | 618 | Open in IMG/M |
3300033418|Ga0316625_102033211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 566 | Open in IMG/M |
3300033418|Ga0316625_102255331 | Not Available | 544 | Open in IMG/M |
3300033419|Ga0316601_100072000 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
3300033419|Ga0316601_100096570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2374 | Open in IMG/M |
3300033482|Ga0316627_100416846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1160 | Open in IMG/M |
3300033482|Ga0316627_100728365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 926 | Open in IMG/M |
3300033482|Ga0316627_101280612 | Not Available | 730 | Open in IMG/M |
3300033482|Ga0316627_101510294 | Not Available | 680 | Open in IMG/M |
3300033482|Ga0316627_102214236 | Not Available | 575 | Open in IMG/M |
3300033483|Ga0316629_10302650 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → unclassified Candidatus Thermoplasmatota → Candidatus Thermoplasmatota archaeon | 1081 | Open in IMG/M |
3300033483|Ga0316629_10784352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 730 | Open in IMG/M |
3300033485|Ga0316626_11799217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 554 | Open in IMG/M |
3300033487|Ga0316630_12070444 | Not Available | 524 | Open in IMG/M |
3300033488|Ga0316621_10410373 | Not Available | 925 | Open in IMG/M |
3300033488|Ga0316621_10442397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 896 | Open in IMG/M |
3300033488|Ga0316621_10781309 | Not Available | 697 | Open in IMG/M |
3300033513|Ga0316628_103918873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 533 | Open in IMG/M |
3300033521|Ga0316616_100174749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2087 | Open in IMG/M |
3300033521|Ga0316616_104939690 | Not Available | 502 | Open in IMG/M |
3300033521|Ga0316616_104947917 | Not Available | 501 | Open in IMG/M |
3300033557|Ga0316617_101108333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 781 | Open in IMG/M |
3300033557|Ga0316617_101332172 | Not Available | 718 | Open in IMG/M |
3300033557|Ga0316617_101550003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 670 | Open in IMG/M |
3300033557|Ga0316617_101936781 | Not Available | 604 | Open in IMG/M |
3300033557|Ga0316617_101943165 | Not Available | 603 | Open in IMG/M |
3300033557|Ga0316617_102222489 | Not Available | 566 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 19.66% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 16.67% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 16.67% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 14.10% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 9.83% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 8.97% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 3.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.71% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.28% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.28% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.28% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.43% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.43% |
Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.43% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.43% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.43% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.43% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090005 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300007072 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300022385 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
3300023177 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_112_MG | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028621 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028623 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029691 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LWSO_00210120 | 2088090005 | Freshwater Sediment | MKKDYEAPKVVTYSEDEIVEMLGPAQTCSPSPCPTYQ |
JGIcombinedJ13530_1009939561 | 3300001213 | Wetland | LMKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYS* |
JGIcombinedJ13530_1014728741 | 3300001213 | Wetland | MKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYS* |
JGIcombinedJ13530_1016068701 | 3300001213 | Wetland | MKKEYEAPKVITYSEDEIVEMLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1017985381 | 3300001213 | Wetland | MKKDYETPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1021088771 | 3300001213 | Wetland | MEKEYEAPKVITYSEDEIVEMLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1022720501 | 3300001213 | Wetland | MKKEYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1028527602 | 3300001213 | Wetland | KSEK*KKEGYQMKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYS* |
JGIcombinedJ13530_1030862582 | 3300001213 | Wetland | MQDKKQYEAPKVITYSEDEIVEMLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1035030162 | 3300001213 | Wetland | MKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYGV* |
JGIcombinedJ13530_1036795121 | 3300001213 | Wetland | MEFKGAISIMKKEYEAPKVITYSEDKIIEMLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1037892222 | 3300001213 | Wetland | MKENKLIYEPPKVITYSEDEIIELLGPAQTCSPSPSPT* |
JGIcombinedJ13530_1038855762 | 3300001213 | Wetland | KEYEAPQVITYSEDQIIELLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1057351121 | 3300001213 | Wetland | MKENKLDYESPKVITYSENEIVEMLGPAQTCSPSP |
JGIcombinedJ13530_1066034792 | 3300001213 | Wetland | MKKEYEAPKVITYAEDEITELLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1068583672 | 3300001213 | Wetland | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1074529822 | 3300001213 | Wetland | MKNEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
JGIcombinedJ13530_1075869971 | 3300001213 | Wetland | MNKEYEAPEVMTYSEDEITELLGPAQTCSPSPCPTYR* |
JGIcombinedJ13530_1076059152 | 3300001213 | Wetland | MKAKETGMEKKYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
JGI20214J51088_100227584 | 3300003432 | Wetland | MAMKKEYEAPKVITYSEDEIIDLLGPAQTCSPSPCPTYS* |
JGI20214J51088_102130562 | 3300003432 | Wetland | MXRKQEYEAPXVITYSEDXIVEMLGPAQTXSPSPCPTYS* |
JGI20214J51088_109592031 | 3300003432 | Wetland | MEYKKKYEAPTVITYSEDEIVEMLGPAQTCSPSPCPTYS* |
JGI20214J51650_113047461 | 3300003541 | Wetland | MKGVIKMENKKQYEAPAVITYSEDEIIEMLGPAQTCSPSPCPTYQ* |
Ga0031655_100010718 | 3300003852 | Freshwater Lake Sediment | MERKHEYEAPKVITYSEDEIVDMLGPAQTCSPSPCPTYQ* |
Ga0031655_100206262 | 3300003852 | Freshwater Lake Sediment | MQTKKQYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0031655_100223083 | 3300003852 | Freshwater Lake Sediment | MQSKKQYESPKVITYSEDEIVEMLGPAQTCSPSPCPTYQ* |
Ga0031655_100263694 | 3300003852 | Freshwater Lake Sediment | MQAKKQYEAPMVITYSEDEIIEMLGPAQTCSPSPCPTYQ* |
Ga0031658_10048464 | 3300003860 | Freshwater Lake Sediment | MQDKKQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ* |
Ga0031658_10190682 | 3300003860 | Freshwater Lake Sediment | MQAKKQYEAPTVITYSEDEIIEMLGPAQTCSPSPCPTYQ* |
Ga0031658_10270221 | 3300003860 | Freshwater Lake Sediment | DHMKKDYEAPKVITYSEDDIIDMLGPAQTCSPSPCPTYQ* |
Ga0031658_10848011 | 3300003860 | Freshwater Lake Sediment | MKEKKPTYEAPKVITYSEDEITELLGPAQTCSPSPCPTYQ* |
Ga0066599_1016194541 | 3300004282 | Freshwater | MQARKQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ* |
Ga0071116_10475712 | 3300005077 | Sinkhole | MKDKKQYEAPMVITYSEDEIIEMLGPAQTCSPSPCPTYQ* |
Ga0074473_101644233 | 3300005830 | Sediment (Intertidal) | MKKEYEAPQVITYSEDEIIELLGPAQTCSPSPCPTYN* |
Ga0074473_104973181 | 3300005830 | Sediment (Intertidal) | MIKEYESPKVITYSEDEIIEILGPAQTCSPSPCPTYQ* |
Ga0074472_111155842 | 3300005833 | Sediment (Intertidal) | MIKVKEYEAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ* |
Ga0079037_1000432213 | 3300006224 | Freshwater Wetlands | MKKEYEAPKVITYSEDEIIELLGPAQTCAPSPNPTGM* |
Ga0079037_1000723073 | 3300006224 | Freshwater Wetlands | MIKEYEAPKVITYSEDEMIEILGPAQTCSPSPCPTYQ* |
Ga0079037_1002239182 | 3300006224 | Freshwater Wetlands | MEEKKPTYQAPEVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0079037_1004016871 | 3300006224 | Freshwater Wetlands | MKKEYEAPNVITYSEDEILELLGPAQTCSPSPCPTYN* |
Ga0079037_1008578562 | 3300006224 | Freshwater Wetlands | MNQKKLDYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYS* |
Ga0079037_1009440172 | 3300006224 | Freshwater Wetlands | MKENKENYQAPEVITYSEDEIIELLGPAQTCSPSPYPTGN* |
Ga0079037_1009665591 | 3300006224 | Freshwater Wetlands | MKDQKTTYEAPKVITYSEDEIMELLGPAQTCSPSPCPTYS* |
Ga0079037_1011301861 | 3300006224 | Freshwater Wetlands | MKKERQQYEAPQVMTYSEDEIIELLGPAQTCAPSPQPTG* |
Ga0079037_1012502261 | 3300006224 | Freshwater Wetlands | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPYPTG* |
Ga0079037_1012502262 | 3300006224 | Freshwater Wetlands | MIKEYEAPKVITYSEDEIIELLAPAQTCSPSPCPTYQ* |
Ga0079037_1012608851 | 3300006224 | Freshwater Wetlands | MIEKKPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0079037_1017942632 | 3300006224 | Freshwater Wetlands | MKDKKPNYQAPEVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0079303_101613732 | 3300006930 | Deep Subsurface | MKKERQQYEAPQVITYSEDEIIELLGPAQTCAPSPQPTG* |
Ga0079303_103981552 | 3300006930 | Deep Subsurface | MKDQKPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYN* |
Ga0073932_10192562 | 3300007072 | Hot Spring Sediment | MKPKDAVYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0073932_10226212 | 3300007072 | Hot Spring Sediment | MKEKKYEAPKVITYSEDEIKEILGPAQTCSPSPCPTYR* |
Ga0073932_10231424 | 3300007072 | Hot Spring Sediment | MKKEYEAPKVITYSEEEIIELLGPAQTCSPSPYIFG* |
Ga0073932_11567881 | 3300007072 | Hot Spring Sediment | MKPKDAMYEAPKVITYSEDEIIEMLGPAQTCSPSPNPTYSG* |
Ga0105105_103057443 | 3300009009 | Freshwater Sediment | RMKKEYEAPQVVTYSEDEIVELLGPAQTCSPSPCPTYS* |
Ga0105093_105208392 | 3300009037 | Freshwater Sediment | VKGVIKMENKKQYEAPAVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0105099_101298262 | 3300009082 | Freshwater Sediment | MKKEYEAPKVITYSEDEIIDLLGPAQTCSPSPCPTYS* |
Ga0105107_106448052 | 3300009087 | Freshwater Sediment | VKGVIKMENKKQYEAPAVITYSEDEIIELLGPAQTCSPSPCPTYN* |
Ga0102851_100728453 | 3300009091 | Freshwater Wetlands | MKNEKKQYEAPQVMTYSEDEIIELLGPAQTCAPSPQPTG* |
Ga0102851_100764843 | 3300009091 | Freshwater Wetlands | VKGEVMKEKKETYQAPKVITYSEDEIIELLGPAQTCSPSPYPTGN* |
Ga0102851_117647022 | 3300009091 | Freshwater Wetlands | MIKEYEAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ* |
Ga0102851_120149512 | 3300009091 | Freshwater Wetlands | MIKEYDAPKVITYSDDEIIELLGPAQTCSPSPCPTYQ* |
Ga0102851_128823802 | 3300009091 | Freshwater Wetlands | MIKEYEAPKVITYSEDEIIELLAPAQTCSPSPCPTYQ |
Ga0115026_100191612 | 3300009111 | Wetland | MKREYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0115026_100511792 | 3300009111 | Wetland | VKGEVMKENKENYQAPEVITYSEDEIIELLGPAQTCSPSPYPTGN* |
Ga0115026_102633201 | 3300009111 | Wetland | MIKEYDAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0115026_108549661 | 3300009111 | Wetland | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPYPTGN* |
Ga0115026_110848142 | 3300009111 | Wetland | EVVMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0115026_113128201 | 3300009111 | Wetland | MKDKKPNYQAPEVITYSEDEIIELLGPAQTCSPSP |
Ga0115027_100762963 | 3300009131 | Wetland | MIKEYDAPNVITYSEDDIIELLSPAQTCSPSPCPTYQ* |
Ga0115027_104142673 | 3300009131 | Wetland | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYS* |
Ga0115027_107073162 | 3300009131 | Wetland | MKTEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0115027_116812312 | 3300009131 | Wetland | MKAKEPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0113563_100094563 | 3300009167 | Freshwater Wetlands | VKGEVMKEKKPTYQAPKVITYSEDEIIELLGPAQTCSPSPYPTGN* |
Ga0113563_101781512 | 3300009167 | Freshwater Wetlands | MLRRISDMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0113563_102118272 | 3300009167 | Freshwater Wetlands | MKQDYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0113563_104916032 | 3300009167 | Freshwater Wetlands | MKDKKPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0113563_106570822 | 3300009167 | Freshwater Wetlands | MKKEYEAPKVITYSEDEIIELLEPAQTCSPSPCPTYQ* |
Ga0113563_108307221 | 3300009167 | Freshwater Wetlands | MNQKKLEYEAPKVITYSEDEIIELLGPAQTCSPSPYPTGN* |
Ga0113563_108950402 | 3300009167 | Freshwater Wetlands | MRITHMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYR* |
Ga0113563_116663641 | 3300009167 | Freshwater Wetlands | MKEKKETYQAPQVITYSEDEIIELLGPAQTCSPSPCPTYGSGS* |
Ga0113563_117348902 | 3300009167 | Freshwater Wetlands | MKEKKPTYEAPKVITYSEDAIIELLGPAQTCSPSPCPTYQ* |
Ga0113563_117360692 | 3300009167 | Freshwater Wetlands | LRGCPMKKERQQYEAPQVITYSEDEIIELLGPAQTCAPSPQPTG* |
Ga0113563_122069533 | 3300009167 | Freshwater Wetlands | MSKLNKIKEDFMKAKEPTYEAPKVITYSEDEIIELLGPAQTCSPSPCP |
Ga0113563_129970811 | 3300009167 | Freshwater Wetlands | MKEKKETYQAPQVITYSEDEIIELLGPAQTCQPSPNPIP* |
Ga0113563_134193541 | 3300009167 | Freshwater Wetlands | MKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ* |
Ga0113563_135717662 | 3300009167 | Freshwater Wetlands | MNKEYEATKVITYSEDEIIELLGPAQTCSPSPYPTGN* |
Ga0113563_139610061 | 3300009167 | Freshwater Wetlands | MKGVIKMENKKQYEAPAVITYSEDEIIDLLGPAQTCSPSPCPTYQ* |
Ga0115028_100204613 | 3300009179 | Wetland | MNKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0115028_107953161 | 3300009179 | Wetland | MKDNKTTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0115028_110222411 | 3300009179 | Wetland | MKKEYEAPRVITYSEDEIIELLGPAQTCSPSPCPTYQ* |
Ga0118657_106522212 | 3300009506 | Mangrove Sediment | MKKERKEYESPKVITYSEDEIIEVLGPAQTCSPSPCPAYQ* |
Ga0118733_1038476321 | 3300010430 | Marine Sediment | MKTKEYEAPKVITYTEEELEEILGPAQACSPSPTTGL* |
Ga0151652_133262262 | 3300011340 | Wetland | GRKIMKENKLIYEPPKVITYSEDEIIELLGPAQTCSPSPSPT* |
(restricted) Ga0172374_10104261 | 3300013122 | Freshwater | MKKEYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYS* |
(restricted) Ga0172374_10349282 | 3300013122 | Freshwater | MEKEKLEYEAPKVISYSEDEIIEQIGPAQTCSPTPAGIQN* |
(restricted) Ga0172368_100848472 | 3300013123 | Freshwater | MENKKQYEAPAVITYSEDEIIDLLGPAQTCSPSPCPTYS* |
Ga0187786_102225562 | 3300017944 | Tropical Peatland | MEAKKQYEAPTAITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0210376_11012002 | 3300022385 | Estuarine | REEFQMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTCS |
Ga0212093_101148310 | 3300022554 | Hot Spring Sediment | MKKEYEAPKVITYSEEEIIELLGPAQTCSPSPYIFG |
Ga0212093_10233097 | 3300022554 | Hot Spring Sediment | MKPKDAVYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0212093_10251375 | 3300022554 | Hot Spring Sediment | MKEKKYEAPKVITYSEDEIKEILGPAQTCSPSPCPTYR |
Ga0212093_10709284 | 3300022554 | Hot Spring Sediment | MKPKDAMYEAPKVITYSEDEIIEMLGPAQTCSPSPNPTYSG |
(restricted) Ga0233423_103586191 | 3300023177 | Freshwater | MKKEYETPKVITYSEDELIDLLGPAQTCSPSPCPTYS |
Ga0124853_12991825 | 3300024056 | Freshwater Wetlands | MKRDYEAPKVLTYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0208665_102948682 | 3300027715 | Deep Subsurface | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209397_101970813 | 3300027871 | Wetland | MIKEYEAPKVITYSEDEMIEILGPAQTCSPSPCPTYQ |
Ga0209397_104102872 | 3300027871 | Wetland | MKAKEPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209397_104321072 | 3300027871 | Wetland | MKTEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209293_100219062 | 3300027877 | Wetland | MKREYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209293_104596241 | 3300027877 | Wetland | MKKEYEAPKVITYSEDEIIELLGPAQTCAPSPNPTGM |
Ga0209450_101232143 | 3300027885 | Freshwater Lake Sediment | MIKVKEYEAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0209450_106296511 | 3300027885 | Freshwater Lake Sediment | MKKDYEAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0208980_101103342 | 3300027887 | Wetland | MKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0209496_103050891 | 3300027890 | Wetland | LGREDYMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209496_103796891 | 3300027890 | Wetland | MEEKKPTYQAPEVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209496_106845532 | 3300027890 | Wetland | MKENKENYQAPEVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0209777_1000199719 | 3300027896 | Freshwater Lake Sediment | MERKHEYEAPKVITYSEDEIVDMLGPAQTCSPSPCPTYQ |
Ga0209777_100039907 | 3300027896 | Freshwater Lake Sediment | MKKQYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209777_100055934 | 3300027896 | Freshwater Lake Sediment | MKKEYEAPKVITYAEDEIIELLGPAQTCSPSPCPTYN |
Ga0209777_100083405 | 3300027896 | Freshwater Lake Sediment | MKKEYAAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0209777_100095257 | 3300027896 | Freshwater Lake Sediment | MKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYS |
Ga0209777_1001273410 | 3300027896 | Freshwater Lake Sediment | MKKEYEVPQVITYSEDEIVEMLGPAQTCSPSPCPTYQ |
Ga0209777_100200526 | 3300027896 | Freshwater Lake Sediment | MKKEYDAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0209777_100367983 | 3300027896 | Freshwater Lake Sediment | MERKEYEAPKVITYSEDEIVDMLGPAQTCSPSPCPTYQ |
Ga0209777_100472004 | 3300027896 | Freshwater Lake Sediment | MKKSEYEAPKVITYSEDEIVDLLGPAQTCSPSPCPTDIP |
Ga0209777_100476082 | 3300027896 | Freshwater Lake Sediment | MRKDYEAPRVITYSEDEIIDMLGPAQACSPSPCPTYN |
Ga0209777_100533607 | 3300027896 | Freshwater Lake Sediment | MKKEYEAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0209777_101038494 | 3300027896 | Freshwater Lake Sediment | MKKEYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0209777_101461671 | 3300027896 | Freshwater Lake Sediment | MQDKKQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTY |
Ga0209777_102113064 | 3300027896 | Freshwater Lake Sediment | MKDKNQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0209254_100332374 | 3300027897 | Freshwater Lake Sediment | MKKDYEAPKVITYSEDEIIDILGPAQTCSPSPCPTYQ |
Ga0209254_101692092 | 3300027897 | Freshwater Lake Sediment | MERKKEYEAPKVITYSEDEIVEMLGPAQTCSPSPCPTYQ |
Ga0209668_100013784 | 3300027899 | Freshwater Lake Sediment | MKKDYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0209668_100019942 | 3300027899 | Freshwater Lake Sediment | MQDKKQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0209668_100023373 | 3300027899 | Freshwater Lake Sediment | MKKEYEVPQVITYSEDEIVELLGPAQTCSPSPCPTYQ |
Ga0209668_100086452 | 3300027899 | Freshwater Lake Sediment | MKKEYEAPKVITYSEDEIIEMLGLAQTCSPSPCPTYQ |
Ga0209668_100167414 | 3300027899 | Freshwater Lake Sediment | MKKEYEEPKVITYSEDEIIDLLGPAQTCSPSPCPTYQ |
Ga0209668_100202014 | 3300027899 | Freshwater Lake Sediment | MERKKEYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0209668_100252162 | 3300027899 | Freshwater Lake Sediment | MKKDYEAPKVITYSEDDIIDMLGPAQTCSPSPCPTYQ |
Ga0209668_102138101 | 3300027899 | Freshwater Lake Sediment | MEAKKPTYESPKVITYSEDEIIELLGPAQTCSPSPCP |
Ga0209668_103723072 | 3300027899 | Freshwater Lake Sediment | MNLIKEKEIKMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0209668_106508652 | 3300027899 | Freshwater Lake Sediment | MKKDYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0209048_103347622 | 3300027902 | Freshwater Lake Sediment | MKKDYEAPKVIKYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0209048_109562681 | 3300027902 | Freshwater Lake Sediment | YIMQAKKQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0209048_110469192 | 3300027902 | Freshwater Lake Sediment | MKKEYEAPKVITYSEDEIIDLLGPAQTCSPSPCPT |
Ga0257142_10099362 | 3300028621 | Marine | MKKDYEAPKVITYSEDEIVEILGPAQTCSPSPCPTY |
Ga0257141_10890341 | 3300028623 | Marine | TQTMQHGETVMKKDYESPKVITYAEDDIIELLGPAQTCSPSPCPTYQ |
Ga0265598_10163632 | 3300029691 | Marine | MKKEYEAPKVITYIEDEIIELLGPAQTCSPSPCPTYQ |
Ga0315290_100913941 | 3300031834 | Sediment | MQAKKQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0315290_101684271 | 3300031834 | Sediment | MSTRQKEYKAPKVITYAEDEIIELLGPAQTCSPSPCPTYS |
Ga0315290_102439451 | 3300031834 | Sediment | MKKEYEAPKMIIYSEDEIIDLLGPAQTCSPSPCPTYSI |
Ga0315290_106506322 | 3300031834 | Sediment | KEYEPPKVLTYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0315290_110378592 | 3300031834 | Sediment | MKKEYESPQVITYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0315290_114290232 | 3300031834 | Sediment | MNKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0315278_101642973 | 3300031997 | Sediment | MKEKKPTYEAPKVITYSEDEIIELLGPAQTCSPSPQPIPPQ |
Ga0315278_101818612 | 3300031997 | Sediment | MNKEYVAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0315278_105196813 | 3300031997 | Sediment | MKEKKPTYEAPKVITYSEDEIVELLGPAQTCSPSPCPTYQ |
Ga0315278_105310172 | 3300031997 | Sediment | MKKERKQYEAPQVITYSEDEIIEMLGPAQTCSPSPSGLQN |
Ga0315278_108116802 | 3300031997 | Sediment | MKKEYEAPKVITYSEDEIIDLPGSAQTCSPRSCPTYSI |
Ga0315278_109403502 | 3300031997 | Sediment | MKKERQQYEAPQVITYSEDEIIELLGPAQTCAPSPQPTG |
Ga0315292_102829841 | 3300032143 | Sediment | MKKEYEAPKVVTYSEDEIVEMLGPAQTCSPSPCPTYQ |
Ga0315292_108019002 | 3300032143 | Sediment | LMKKDYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0315292_112577522 | 3300032143 | Sediment | EKKATYEAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0315283_106852972 | 3300032164 | Sediment | MKRERSDNMKKEYEAPKVITYSEDEIVEMLGPAQTCSPSPCPTYQ |
Ga0315283_110760161 | 3300032164 | Sediment | MKKEYEAPQVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0315283_110779151 | 3300032164 | Sediment | SFGGGFKHMKKEYEAPKVITYAEDEIIELLGPAQTCSPSPCPTYQ |
Ga0315283_113243941 | 3300032164 | Sediment | MKKEYEAPKVITYSEDEIVEMLGPAQTCSPSPCPTYQ |
Ga0315283_119792071 | 3300032164 | Sediment | MKKEYEAPKVLTYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0315283_120598151 | 3300032164 | Sediment | MKKEYEAPKVITYAEDEIIEMLGPAQTCSPSPCPTY |
Ga0315276_100260174 | 3300032177 | Sediment | MIKEYEAPRVITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0315276_101109272 | 3300032177 | Sediment | MIEKKPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0315276_102797461 | 3300032177 | Sediment | TRNKREENMQAKKQYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0315276_106414131 | 3300032177 | Sediment | ILMRIDHMKKEYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0315276_109025001 | 3300032177 | Sediment | MKKEYEAPKVITYSEDDIVEMLGPAQTCSPSPIPIPPQ |
Ga0315276_117131111 | 3300032177 | Sediment | MEIGMKKEYEAPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0315276_123643262 | 3300032177 | Sediment | MKKAYEAPKVITYAEDEIIELLGPAQTCSPSPCPTYQ |
Ga0315276_125993581 | 3300032177 | Sediment | KEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0315286_109950502 | 3300032342 | Sediment | MIKEYQAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0315286_119055552 | 3300032342 | Sediment | MQAKKQYEAPTVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0315287_102304483 | 3300032397 | Sediment | QAKKQYESPKVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0315287_125279191 | 3300032397 | Sediment | MKKEYEAPKVITYSEDEIVEMLGPAQTCSPSPCPAFV |
Ga0315275_102625783 | 3300032401 | Sediment | MKKERNQYEAPQVITYSEDEIIEMLGPAQTCSPSPSGLQN |
Ga0315275_114074341 | 3300032401 | Sediment | MKKEYEAPKVITYAEDEIIELLGPAQTCSPSPCPTYQ |
Ga0315273_101364672 | 3300032516 | Sediment | MKKGYEAPKVITYSEDEIIDMLGPAQTCSPSPCPTYQ |
Ga0315273_102986714 | 3300032516 | Sediment | KATYQAPEVITYSEDEIIELLGPAQTCSPSPCPVSYYGN |
Ga0315273_104699522 | 3300032516 | Sediment | MKEKKETYQAPQVITYSEDEIIELLGPAQTCSPSPQPIPPQ |
Ga0315273_131086921 | 3300032516 | Sediment | MKKEYEAPMVITYSEDEIIEMLGPAQTCSPSPCPTYQ |
Ga0316605_116874491 | 3300033408 | Soil | MKKEYEAPQVITYSEDEIIELLGPAQTCSPSPCPTYN |
Ga0316605_122797963 | 3300033408 | Soil | VKGEVMNEKKPTYQAPKVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0316603_102803322 | 3300033413 | Soil | MKRDYEAPKVITYSEDEIIELLGPAQTCSPSPLPNVPMI |
Ga0316603_104350991 | 3300033413 | Soil | EVKMIKEYEAPRVITYSEDNIIELLGPAQTCSPSPCPTYQ |
Ga0316603_104350992 | 3300033413 | Soil | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPYPTG |
Ga0316603_109313832 | 3300033413 | Soil | KGKGEVMKEKKETYQAPEVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0316603_114963471 | 3300033413 | Soil | VKGEVMKEKKETYQAPKVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0316603_117550032 | 3300033413 | Soil | MVMNKEYEATKVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0316619_105670562 | 3300033414 | Soil | MNKEYEAPKVISYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0316619_110022801 | 3300033414 | Soil | RDYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316619_110168622 | 3300033414 | Soil | MEKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYH |
Ga0316619_110995361 | 3300033414 | Soil | VQIKEIDMIKVKEYEAPKIITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0316619_120339041 | 3300033414 | Soil | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQXXK |
Ga0316619_121046302 | 3300033414 | Soil | QKKECEMKKEYDAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316625_1000526304 | 3300033418 | Soil | MIKEYDAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316625_1005216572 | 3300033418 | Soil | MKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0316625_1007838371 | 3300033418 | Soil | MTKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316625_1010194521 | 3300033418 | Soil | MRRIDHMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316625_1016294712 | 3300033418 | Soil | MKKEYEAPRVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316625_1020332112 | 3300033418 | Soil | MNQKKLDYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0316625_1022183641 | 3300033418 | Soil | MSKLNNIKEDFMKAKEPTYQAPKVITYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0316625_1022553311 | 3300033418 | Soil | KKPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYN |
Ga0316601_1000720003 | 3300033419 | Soil | MKKERQQYEAPQVMTYSEDEIIELLGPAQTCAPSPQPTG |
Ga0316601_1000965701 | 3300033419 | Soil | VKGEVMKEKKPTYQAPKVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0316627_1004168462 | 3300033482 | Soil | MKDKKPTYEAPQVITYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0316627_1007283652 | 3300033482 | Soil | MEYMKNIKTEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316627_1012806121 | 3300033482 | Soil | KIMKDKKTTYEAPNVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316627_1015102941 | 3300033482 | Soil | MKAKETTYKAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316627_1022142361 | 3300033482 | Soil | MNQKKLEYEAPKVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0316629_103026501 | 3300033483 | Soil | MKKEYEAPRIITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316629_107843522 | 3300033483 | Soil | MEYMKNIKTEYETPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316626_117992172 | 3300033485 | Soil | PMKNKKLEYEAPKVITYSEDEIIKLLGPAQTCSPSPCPTYS |
Ga0316630_120704441 | 3300033487 | Soil | MKAKEPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYS |
Ga0316621_104103732 | 3300033488 | Soil | MKDKKPNYQAPEVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316621_104423972 | 3300033488 | Soil | MNLIKEKEIGMKKEYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316621_107813091 | 3300033488 | Soil | VKGEVMKENKENYQAPEVITYSEDEIIELLGPAQTCSPSPYPTGN |
Ga0316628_1039188732 | 3300033513 | Soil | YNYRRKDHMKKEYEAPKVITYSEDEIIELLGPAQTCAPSPSPL |
Ga0316616_1001747492 | 3300033521 | Soil | MKKEYDAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316616_1049396901 | 3300033521 | Soil | MKEKKETYQAPEVITYSEDDIIELLGPAQTCSPSPCPTYGAGS |
Ga0316616_1049479172 | 3300033521 | Soil | MKDKKPNYQAPEVITYSEDEIIELLGPAQTCSPSPCP |
Ga0316617_1011083332 | 3300033557 | Soil | MKKEYETPKVITYSEDEIIELLGPAQTCSPSPCPTYR |
Ga0316617_1013321722 | 3300033557 | Soil | KTTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316617_1015500031 | 3300033557 | Soil | MKQDYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYQ |
Ga0316617_1019367812 | 3300033557 | Soil | MKEKKETYQAPQVITYSEDEIIELLGPAQTCQPSPNPIP |
Ga0316617_1019431652 | 3300033557 | Soil | MIKEYEAPKVITYSEDEIIEILGPAQTCSPSPCPTYQ |
Ga0316617_1022224892 | 3300033557 | Soil | MKDQKPTYEAPKVITYSEDEIIELLGPAQTCSPSPCPTYN |
⦗Top⦘ |