NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018435

Metagenome / Metatranscriptome Family F018435

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018435
Family Type Metagenome / Metatranscriptome
Number of Sequences 235
Average Sequence Length 41 residues
Representative Sequence MSLPALKPQALPVLLIEDEPAVMAYVQAALERSGYPVVCC
Number of Associated Samples 199
Number of Associated Scaffolds 235

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.01 %
% of genes near scaffold ends (potentially truncated) 97.87 %
% of genes from short scaffolds (< 2000 bps) 88.51 %
Associated GOLD sequencing projects 184
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.723 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(8.936 % of family members)
Environment Ontology (ENVO) Unclassified
(20.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.191 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 20.59%    β-sheet: 0.00%    Coil/Unstructured: 79.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 235 Family Scaffolds
PF02518HATPase_c 73.62
PF13426PAS_9 17.02
PF08448PAS_4 5.11
PF13492GAF_3 1.28
PF03544TonB_C 0.85
PF00072Response_reg 0.43
PF00158Sigma54_activat 0.43
PF01584CheW 0.43
PF06271RDD 0.43
PF02895H-kinase_dim 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 235 Family Scaffolds
COG0643Chemotaxis protein histidine kinase CheASignal transduction mechanisms [T] 0.85
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.85
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.72 %
UnclassifiedrootN/A1.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10076731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1608Open in IMG/M
3300001661|JGI12053J15887_10205219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1000Open in IMG/M
3300002245|JGIcombinedJ26739_100080837All Organisms → cellular organisms → Bacteria3017Open in IMG/M
3300002245|JGIcombinedJ26739_100629646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis950Open in IMG/M
3300003505|JGIcombinedJ51221_10231611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis750Open in IMG/M
3300004080|Ga0062385_10240070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1004Open in IMG/M
3300004082|Ga0062384_101449550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter507Open in IMG/M
3300004156|Ga0062589_101763191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter620Open in IMG/M
3300005166|Ga0066674_10391193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter646Open in IMG/M
3300005177|Ga0066690_10730941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter652Open in IMG/M
3300005177|Ga0066690_11073642All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005179|Ga0066684_11102930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter507Open in IMG/M
3300005180|Ga0066685_11027453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter543Open in IMG/M
3300005181|Ga0066678_10844611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter602Open in IMG/M
3300005330|Ga0070690_100802105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter730Open in IMG/M
3300005340|Ga0070689_101925807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter540Open in IMG/M
3300005434|Ga0070709_11055992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter648Open in IMG/M
3300005435|Ga0070714_101045895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter795Open in IMG/M
3300005439|Ga0070711_100050103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2862Open in IMG/M
3300005529|Ga0070741_10652154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter933Open in IMG/M
3300005533|Ga0070734_10619902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter616Open in IMG/M
3300005534|Ga0070735_10628292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter636Open in IMG/M
3300005537|Ga0070730_10760636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter612Open in IMG/M
3300005537|Ga0070730_10920668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter547Open in IMG/M
3300005541|Ga0070733_10627418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter721Open in IMG/M
3300005546|Ga0070696_101790059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter530Open in IMG/M
3300005549|Ga0070704_100279227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1383Open in IMG/M
3300005552|Ga0066701_10287182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1020Open in IMG/M
3300005555|Ga0066692_10830525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter567Open in IMG/M
3300005555|Ga0066692_10958052All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300005559|Ga0066700_10221711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1313Open in IMG/M
3300005561|Ga0066699_10030017All Organisms → cellular organisms → Bacteria → Acidobacteria3134Open in IMG/M
3300005563|Ga0068855_101949750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter594Open in IMG/M
3300005575|Ga0066702_10703609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter602Open in IMG/M
3300005610|Ga0070763_10643580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter617Open in IMG/M
3300005614|Ga0068856_101345149All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005614|Ga0068856_102670295All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005712|Ga0070764_11009156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter525Open in IMG/M
3300005921|Ga0070766_10295150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1039Open in IMG/M
3300005921|Ga0070766_10720185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter676Open in IMG/M
3300006028|Ga0070717_10635536All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300006028|Ga0070717_11042275All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300006041|Ga0075023_100003648All Organisms → cellular organisms → Bacteria3755Open in IMG/M
3300006047|Ga0075024_100841313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300006050|Ga0075028_100941885All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300006052|Ga0075029_100281077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1058Open in IMG/M
3300006173|Ga0070716_100419898All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300006173|Ga0070716_101822596All Organisms → cellular organisms → Bacteria → Proteobacteria504Open in IMG/M
3300006176|Ga0070765_100131855All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300006176|Ga0070765_100237148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1668Open in IMG/M
3300006354|Ga0075021_10110075All Organisms → cellular organisms → Bacteria → Proteobacteria1641Open in IMG/M
3300006755|Ga0079222_11476983All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300006804|Ga0079221_11133877All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300006852|Ga0075433_11809692All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300006854|Ga0075425_100253255All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300006893|Ga0073928_10547734All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300006893|Ga0073928_10741173All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006904|Ga0075424_101297049All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300009012|Ga0066710_104642900Not Available513Open in IMG/M
3300009088|Ga0099830_10377868All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300009093|Ga0105240_11890469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300009098|Ga0105245_13156438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300009137|Ga0066709_103771283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300009174|Ga0105241_10670433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium944Open in IMG/M
3300009176|Ga0105242_12854286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300009523|Ga0116221_1268336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300009524|Ga0116225_1104810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1310Open in IMG/M
3300009645|Ga0116106_1123793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium832Open in IMG/M
3300009665|Ga0116135_1163867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300009698|Ga0116216_10773971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300009759|Ga0116101_1039750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium987Open in IMG/M
3300009792|Ga0126374_10088900All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1716Open in IMG/M
3300009792|Ga0126374_10888652All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300010043|Ga0126380_11314849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300010046|Ga0126384_11377734All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300010046|Ga0126384_12424918All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300010048|Ga0126373_10157573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2165Open in IMG/M
3300010301|Ga0134070_10209231All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300010304|Ga0134088_10416713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300010358|Ga0126370_10791899All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300010373|Ga0134128_12889452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300010375|Ga0105239_13128745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300010376|Ga0126381_102509019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300010376|Ga0126381_103687356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300010376|Ga0126381_104422340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300011270|Ga0137391_11397840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300012189|Ga0137388_11711692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300012199|Ga0137383_10914511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300012200|Ga0137382_10522441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300012200|Ga0137382_11143050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300012285|Ga0137370_10421889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300012354|Ga0137366_11062097All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300012354|Ga0137366_11205315All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012356|Ga0137371_10339144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1169Open in IMG/M
3300012357|Ga0137384_10001844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis16790Open in IMG/M
3300012532|Ga0137373_10600014All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300012917|Ga0137395_10806784All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300012929|Ga0137404_11574885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300012951|Ga0164300_11101905All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012961|Ga0164302_10845840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300012984|Ga0164309_11889224All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012984|Ga0164309_11950183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300012989|Ga0164305_12091129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300014166|Ga0134079_10485774All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300014969|Ga0157376_12058693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300015053|Ga0137405_1256445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300015264|Ga0137403_10254783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1665Open in IMG/M
3300015357|Ga0134072_10314580All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300016422|Ga0182039_11888644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300017822|Ga0187802_10342992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300017823|Ga0187818_10559601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300017928|Ga0187806_1355270All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300017933|Ga0187801_10118929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1013Open in IMG/M
3300017937|Ga0187809_10067767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1166Open in IMG/M
3300017970|Ga0187783_10672470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium748Open in IMG/M
3300017970|Ga0187783_10767172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300017975|Ga0187782_11454314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300017995|Ga0187816_10212755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300018006|Ga0187804_10292870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300018007|Ga0187805_10051301All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300018034|Ga0187863_10155026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1278Open in IMG/M
3300018058|Ga0187766_10858057All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300018060|Ga0187765_10672764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300018062|Ga0187784_11331001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300018085|Ga0187772_10903907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300018085|Ga0187772_11393996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300018086|Ga0187769_10199092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1481Open in IMG/M
3300018086|Ga0187769_10261077All Organisms → cellular organisms → Bacteria → Acidobacteria1290Open in IMG/M
3300018086|Ga0187769_10365965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1082Open in IMG/M
3300018088|Ga0187771_10920339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300018090|Ga0187770_10218625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1471Open in IMG/M
3300018433|Ga0066667_11960327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300019268|Ga0181514_1023112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2274Open in IMG/M
3300020006|Ga0193735_1159243All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300020010|Ga0193749_1015272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1501Open in IMG/M
3300020022|Ga0193733_1015042All Organisms → cellular organisms → Bacteria2178Open in IMG/M
3300020170|Ga0179594_10377256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300020579|Ga0210407_10090463All Organisms → cellular organisms → Bacteria → Acidobacteria2316Open in IMG/M
3300020580|Ga0210403_10278390All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300020582|Ga0210395_10127966All Organisms → cellular organisms → Bacteria → Acidobacteria1888Open in IMG/M
3300021088|Ga0210404_10599924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300021088|Ga0210404_10617260All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300021178|Ga0210408_10116490All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300021178|Ga0210408_10466551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1005Open in IMG/M
3300021377|Ga0213874_10404869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300021401|Ga0210393_10088977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2451Open in IMG/M
3300021404|Ga0210389_11218730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300021407|Ga0210383_10444848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1119Open in IMG/M
3300021407|Ga0210383_11213527All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300021433|Ga0210391_10097411All Organisms → cellular organisms → Bacteria2320Open in IMG/M
3300021474|Ga0210390_11511431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300021478|Ga0210402_10730298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium914Open in IMG/M
3300021479|Ga0210410_11212454All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300021559|Ga0210409_10200509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1818Open in IMG/M
3300021560|Ga0126371_12368080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300022557|Ga0212123_10006207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae20124Open in IMG/M
3300022557|Ga0212123_10625507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300022557|Ga0212123_10839315All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300025898|Ga0207692_10601897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300025898|Ga0207692_10857162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300025905|Ga0207685_10001409All Organisms → cellular organisms → Bacteria → Acidobacteria5013Open in IMG/M
3300025918|Ga0207662_11131646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis556Open in IMG/M
3300025929|Ga0207664_10313195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1383Open in IMG/M
3300025939|Ga0207665_10033656All Organisms → cellular organisms → Bacteria3399Open in IMG/M
3300025949|Ga0207667_11834573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300025986|Ga0207658_10818706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300026041|Ga0207639_10227307All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300026041|Ga0207639_11735979All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300026078|Ga0207702_10859200All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300026078|Ga0207702_11530199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis660Open in IMG/M
3300026088|Ga0207641_10976881All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300026294|Ga0209839_10155946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300026295|Ga0209234_1009288All Organisms → cellular organisms → Bacteria3732Open in IMG/M
3300026295|Ga0209234_1318000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300026316|Ga0209155_1053265All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300026317|Ga0209154_1069059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1539Open in IMG/M
3300026323|Ga0209472_1180411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300026354|Ga0257180_1019899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium866Open in IMG/M
3300026551|Ga0209648_10003862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis12669Open in IMG/M
3300027063|Ga0207762_1067789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300027497|Ga0208199_1094711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300027567|Ga0209115_1008854All Organisms → cellular organisms → Bacteria → Acidobacteria2115Open in IMG/M
3300027568|Ga0208042_1077698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300027576|Ga0209003_1069535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300027783|Ga0209448_10080349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300027821|Ga0209811_10221582All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300027826|Ga0209060_10091850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1424Open in IMG/M
3300027842|Ga0209580_10310522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300027842|Ga0209580_10436940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300027842|Ga0209580_10651078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300027846|Ga0209180_10230866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1066Open in IMG/M
3300027854|Ga0209517_10542608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300027855|Ga0209693_10007783Not Available4945Open in IMG/M
3300027862|Ga0209701_10088940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1939Open in IMG/M
3300027867|Ga0209167_10209277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1040Open in IMG/M
3300027867|Ga0209167_10497573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300027869|Ga0209579_10233492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium987Open in IMG/M
3300027875|Ga0209283_10548659All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300027889|Ga0209380_10465147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300027895|Ga0209624_10765453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300027898|Ga0209067_10072253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1770Open in IMG/M
3300027910|Ga0209583_10340145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300027915|Ga0209069_10423408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300028379|Ga0268266_10998241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300028536|Ga0137415_10733866All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300028906|Ga0308309_11132116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300029636|Ga0222749_10481854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300029903|Ga0247271_100357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis12848Open in IMG/M
3300029910|Ga0311369_11138212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300029943|Ga0311340_11407137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300030058|Ga0302179_10307482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300030294|Ga0311349_10436912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1238Open in IMG/M
3300030339|Ga0311360_10481618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium996Open in IMG/M
3300031057|Ga0170834_100708925All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300031231|Ga0170824_127415323All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031708|Ga0310686_108961823All Organisms → cellular organisms → Bacteria2507Open in IMG/M
3300031708|Ga0310686_112735943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300031718|Ga0307474_10252272All Organisms → cellular organisms → Bacteria → Acidobacteria1352Open in IMG/M
3300031740|Ga0307468_102032856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300031744|Ga0306918_11230213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300031823|Ga0307478_10878361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300032180|Ga0307471_100018441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium5019Open in IMG/M
3300032180|Ga0307471_101413050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300032180|Ga0307471_102895049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300032205|Ga0307472_101218880All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300032261|Ga0306920_100808423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1376Open in IMG/M
3300032782|Ga0335082_11064158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300032783|Ga0335079_10157511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2544Open in IMG/M
3300032805|Ga0335078_10647075All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300032828|Ga0335080_10167156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2431Open in IMG/M
3300032892|Ga0335081_11226715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300033158|Ga0335077_11724005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis591Open in IMG/M
3300033433|Ga0326726_10255334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1633Open in IMG/M
3300034163|Ga0370515_0308351All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.26%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.40%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.40%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.55%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.13%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.70%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.28%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.28%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.28%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.28%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.43%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.43%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.43%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.43%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.43%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1007673113300000567Peatlands SoilMSLPALKPQPLPVLLVEDEPAVMAYVQAALERSGYPVVCCESG
JGI12053J15887_1020521923300001661Forest SoilMNLPAFKPAPMPVLLIEDEPAVMAYVQAALERSGYPVVC
JGIcombinedJ26739_10008083713300002245Forest SoilMSMPPVAKPATLPVLLIEDEPGVMAYVRATLERSGYSVVCTESGAEGLRLL
JGIcombinedJ26739_10062964613300002245Forest SoilMNLPAFKPVSVPVLLIEDEPAVMSLVQAALERSGYPVVCC
JGIcombinedJ51221_1023161123300003505Forest SoilMSLPAFQPALLPVLLIEDEPAVMAYVQAALERSGYPVVCCDS
Ga0062385_1024007023300004080Bog Forest SoilMSLPAIKPSVLPVLLIEDEPAVMAYVRAALERSGYPVVCCESGVD
Ga0062384_10144955023300004082Bog Forest SoilMSLPALKPSLLPVLLIEDEPAVMAYVQAALERSGYPVVCCES
Ga0062589_10176319123300004156SoilMTTQPVTKPATLPVLLIEDEPAVMDFVRATLERNGYSVVCSESGANG
Ga0066674_1039119313300005166SoilMTLPATKAAVRAASLPVLLIEDEPAVMAYVRATLERSGYSVVCTE
Ga0066690_1073094113300005177SoilMSAPSMQPKPLPILLIEDEPAVMSYVRAVLERNGYEVVCS
Ga0066690_1107364213300005177SoilMSMPAIKPEPLPILLIEDEPGVMAYVCATLERSGYQVVCAK
Ga0066684_1110293023300005179SoilMTLPATKAAVRAASLPVLLIEDEPAVMAYVRATLERSGYSVVCTESGVDGLK
Ga0066685_1102745323300005180SoilMSLPAIKPTPVPPVLLVEDEPAVMAYVQAALERSGYPVVCCESGIDALR
Ga0066678_1084461123300005181SoilMTLPATKAAVRAASLPVLLIEDEPAVMAYVRATLERSGYSVVCTESGVDGL
Ga0070690_10080210513300005330Switchgrass RhizosphereMSTPARRPSRLPVLLIEDEPAVMSYVRAVLERSGYSVLCCDSG
Ga0070689_10192580713300005340Switchgrass RhizosphereMSTPARKPSRLPVLLIEDEPAVMSYVRAVLERSGYSVLCCDSGAE
Ga0070709_1105599213300005434Corn, Switchgrass And Miscanthus RhizosphereMSEARAKQEKLPVLLIEDEPSVMAYVRAALERSGYPVVSTDS
Ga0070714_10104589513300005435Agricultural SoilMSTSAAKPSALPVLLIEDEPAVMSYVSAVLERSGYSVVCCESGA
Ga0070701_1064449423300005438Corn, Switchgrass And Miscanthus RhizosphereMNQTATKPVLPPVLLIEDEPAVMAYVRAALERSGYPVVSTESGAE
Ga0070711_10005010313300005439Corn, Switchgrass And Miscanthus RhizosphereMSLPALKPQILPVLLIEDEPAVMACVQAALERSGYPVVCCE
Ga0070741_1065215413300005529Surface SoilMSAPSIQPQSLPILLIEDEPAVMSYVRAVLERNGYQ
Ga0070734_1061990223300005533Surface SoilMSLPALQPNPLPVLLVEDEPAVMAYVQAALERSGYPVVCCESG
Ga0070735_1062829223300005534Surface SoilMSAPSFHPKSLPVLLIEDEPAVMSYVRAVLERNGY
Ga0070730_1076063613300005537Surface SoilMSLPALKPQTSPVLLIEDEPAVMAYVQAALERSGYPVVCCESG
Ga0070730_1092066823300005537Surface SoilMSTPAAKPSTLPVLLIEDEPAVMSYVRAVLERSGYSVVCCES
Ga0070733_1062741813300005541Surface SoilMTTQPIAKPSHTLPVLLIEDEPAVMAYVRAALERSGYAVVCTE
Ga0070696_10179005913300005546Corn, Switchgrass And Miscanthus RhizosphereMTTQPVTKPATLPVLLIEDEPAVMDFVRATLERNGYSVVC
Ga0070704_10027922723300005549Corn, Switchgrass And Miscanthus RhizosphereMTTQPVTKPATLPVLLIEDEPAVMDFVRATLERNGYSVVCS
Ga0066701_1028718223300005552SoilMSTAAIKPNRLPVLLIEDEPAVMSYVRAVLERSGYTVVCSDS
Ga0066692_1083052523300005555SoilMTLPATKAAVRTTSLPVLLIEDEPAVMAYVRATLERSGY
Ga0066692_1095805213300005555SoilMTLPATKPAALPVLLIEDEPAVMAYVRATLERNGYSVVCAESG
Ga0066700_1022171123300005559SoilMTSIAAVSPKLPVLVIEDEPSVLAYVRAALERSGYPVIAT
Ga0066699_1003001713300005561SoilMTLPASKPAALPVLLIEDEPAVMAYVRATLERNGYSVVCAESG
Ga0068855_10194975023300005563Corn RhizosphereMSAPSIRPKSLPILLIEDEPAVMSYVRAVLERNGYEVVCSGSGVDGLKQ
Ga0066702_1070360923300005575SoilMSTPAIKQNPLPVLLIEDEPAVMSYVRAVLERSGYT
Ga0070763_1064358023300005610SoilMSSMVAKSSALPVLLIEDEPAVMAYVRATLERSGYTVVCTES
Ga0068856_10134514923300005614Corn RhizosphereMSAPSIRPKSLPILLIEDEPAVMSYVRAVLERNGYEVVCSGSGVDGL
Ga0068856_10267029523300005614Corn RhizosphereMSTPAPKPSSLPVLLIEDEPAVMSYVRAVLERSGYSVVCC
Ga0070764_1100915613300005712SoilMSTTITKSSALPVLLIEDEPAVMAYVRATLERSGYAVVCTESGAEGLRL
Ga0070766_1029515013300005921SoilMTPPPDITPAALPVLLIEDEPAVMAYVRATLERSGY
Ga0070766_1072018513300005921SoilMNLPAIKTAVLPVLLIEDEAAVMAYVQAALERNGYSVICADSGAQGLQLL
Ga0070717_1063553623300006028Corn, Switchgrass And Miscanthus RhizosphereMSTPAIKPNRLPVLLIEDEPAVMSYVRAVLERSGYSVVCSESGVEG
Ga0070717_1104227523300006028Corn, Switchgrass And Miscanthus RhizosphereMSTPAAKPSTLPVLLIEDEPAVMSYVSAVLERSGYA
Ga0075023_10000364813300006041WatershedsMTTQPISKPESLPVLLIEDEPAVMAYVRATLERNGYSVVCSESGADGLR
Ga0075024_10084131323300006047WatershedsMKSAALRIASALPILLIEDEASVMAYVRAALERNG
Ga0075028_10094188513300006050WatershedsMTTSAVTKTAMLPILLIEDEPAVMAYVRATLERSGYSVICTESGAEG
Ga0075029_10028107723300006052WatershedsMSLAALKPTPLPVLLIEDEPAVMAYVQAALERSGYP
Ga0070716_10041989823300006173Corn, Switchgrass And Miscanthus RhizosphereMSVPPLKTRALPVLLIEDEPAVMAYVQAALERSGYPVVCCESGVD
Ga0070716_10182259613300006173Corn, Switchgrass And Miscanthus RhizosphereMSLPVMQPEPLPILLIEDEPAVMAYVCATLERSGYQVVCAKSGAEGLQ
Ga0070765_10013185513300006176SoilMSLPASNPNPLPVLLIEDEPAVMAYVQAALERSGYPVVC
Ga0070765_10023714813300006176SoilMSLPAFQPALLPVLLIEDEPAVMAYVQAALERSGYP
Ga0075021_1011007513300006354WatershedsMTASPQPRALPVLLIEDEPSVSACIRAALERGGYSVVCCESGADA
Ga0079222_1147698313300006755Agricultural SoilMTTQPVTKPPTLPVLLIEDEPAVMDFVRATLERNGYSV
Ga0079221_1113387713300006804Agricultural SoilMSLPALRSSPLPVLLIEDEPAVMAYVQAALERSGYPV
Ga0075433_1180969213300006852Populus RhizosphereMTLPALKPEILPVLLIEDEPAVMSYVCAALERNGYLVVC
Ga0075425_10025325513300006854Populus RhizosphereMTLPAAKAAVRATSLPVLLIEDEPAVMAYVRATLERSGYTVVCTES
Ga0073928_1054773423300006893Iron-Sulfur Acid SpringMSQPAFKPQSLPVLLIEDEPAVMAYVQAALERSGYPVVCC
Ga0073928_1074117313300006893Iron-Sulfur Acid SpringMTMRQSAMKPATLPVLLIEDEPAVMAYVRAALERSGYVV
Ga0075424_10129704923300006904Populus RhizosphereMSTHAVKAEPIPVLLIEDEPAVMSYVKAVLERSGYTVVCSESGAD
Ga0066710_10464290023300009012Grasslands SoilMSLPALRPQPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESG
Ga0099830_1037786813300009088Vadose Zone SoilMSTLAAKSVPLPVLLIEDEPAVMSYVRAVRERRGYQVVCCE
Ga0105240_1189046923300009093Corn RhizosphereMTTQPVTKPATLPVLLIEDEPAVMDFVRATLERNGYSVVCSESGANGL
Ga0105245_1315643813300009098Miscanthus RhizosphereMTTQPVTKPATLPVLLIEDEPAVMAYVRATLERSGYSVVCT
Ga0066709_10377128323300009137Grasslands SoilMNQSVSKSVSLPVLLIEDEPGVMAYVRASLERSGYPVICAESGVEALGILE
Ga0105241_1067043313300009174Corn RhizosphereMSLPVLKTQPLPVLLVEDEPAVMAYVQAALERSGYPVVCCESGVDA
Ga0105242_1285428613300009176Miscanthus RhizosphereMTTQPVSKPETLPVLLIEDEPAVMAYVRATLERNGYSVVC
Ga0116221_126833613300009523Peatlands SoilMIQPARNPAVLPVLLIEDEPAVMAYVRAALERNGYTV
Ga0116225_110481013300009524Peatlands SoilMSLPALKPQPLPVLLVEDEPAVMAYVQAALERSGYPVVYCE*
Ga0116106_112379323300009645PeatlandVLLIEDEPAVMALVRAVLEGHGYAVVSTESGADAL
Ga0116135_116386713300009665PeatlandMSLPAFQPALLPVLLIEDEPAVMAYVQAALERSGY
Ga0116216_1077397113300009698Peatlands SoilMSLPATNPAILPVLLIEDEPAVMAYVRAVLERNGYAVVCTASGVEA
Ga0116101_103975013300009759PeatlandMSTTVTKSSALPVLLIEDEPAVMAYVRATLERSGYAVVCTES
Ga0126374_1008890023300009792Tropical Forest SoilMTLSATKTAVRAKPLPILLIEDEPAVMAYVRATLERS
Ga0126374_1088865213300009792Tropical Forest SoilMSVPAIKPDSLPILLIEDEPAVMAYVRTTLERSGYRVVCAHSGAEGVRM
Ga0126380_1131484923300010043Tropical Forest SoilMTLPALKPEILPVLLIEDEPAVMSYVCAALERNGYS
Ga0126384_1137773413300010046Tropical Forest SoilMTLLAMKPAILPVLLIEDEPAVMSYVCAALERNGYAV
Ga0126384_1242491813300010046Tropical Forest SoilMTHSVGKAGIKTSALPVLLIEDEPGVMAYVRATLERNGYR
Ga0126373_1015757313300010048Tropical Forest SoilMSLPAVKPEPLPILLIEDEPAVMAYVSATLERSGYHVV
Ga0134070_1020923123300010301Grasslands SoilMTLPSAKPEALPVLLIEDEPGVMAYVRATLERNGYAVVCAESGA
Ga0134088_1041671323300010304Grasslands SoilMTLPATKAAVRAASLPVLLIEDEPAVMAYVRATLERS
Ga0126370_1079189923300010358Tropical Forest SoilMSTPARRPSRLPVLLIEDEPAVMSYVRAVLERSGY
Ga0134128_1288945213300010373Terrestrial SoilMSLPAMKSQPLPVLLVEDEPAVMAYVQAALERSGYPVVCCESGVDA
Ga0105239_1312874523300010375Corn RhizosphereMSLPVLKTQPLPVLLVEDEPAVMAYVQAALERSGYPVVCCE
Ga0126381_10250901923300010376Tropical Forest SoilMSLPAVKPEPLPILLIEDEPAVMAYVSATLERSGYQVVCANSGA
Ga0126381_10368735623300010376Tropical Forest SoilMSLPVMKSQPLPVLLIEDEPAVMAYVQAAVERSGYPVV
Ga0126381_10442234013300010376Tropical Forest SoilMSQPAVQPEPLPILLIEDEPAVMAYVCATLERSGYRVVCAKS
Ga0137391_1139784013300011270Vadose Zone SoilMNLPAFKPASMPVLLIEDEPAVMAYVQAALERSGYPVVCCESG
Ga0137388_1171169223300012189Vadose Zone SoilMTLPVTQPAVLPVLLIEDEPAVMALVRAALERSGY
Ga0137383_1091451123300012199Vadose Zone SoilMSLPALKPRALPVLLIEDELAVMAYVQAALERSGYPVVCCESGVDALRLLDGGSFLG
Ga0137382_1052244113300012200Vadose Zone SoilMTLPASKPAALPVLLIEDEPAVMAYVRATLERNGYSVVCAESGVEG
Ga0137382_1114305013300012200Vadose Zone SoilMSVPALRLDSLPILLIEDEPAVMAYVCATLERSGYR
Ga0137370_1042188913300012285Vadose Zone SoilMTLPAYKPEILPVLLIEDEPAVMSYVCAALERNGY
Ga0137366_1106209723300012354Vadose Zone SoilMSGAVPSRRLPILVIEDEPSVMAFVRAALERSGYSVVP
Ga0137366_1120531523300012354Vadose Zone SoilMSTPAVKLNRLPVLLIEDEPAVMSYVRAVLERSGYTVVCSDS
Ga0137371_1033914433300012356Vadose Zone SoilMSAPAIRPKQLPVLLIEDEPGVMSFVREALERNGYTVVCSES*
Ga0137384_1000184413300012357Vadose Zone SoilMTLPSAKPEALPVLLIEDEPGVMAYVRATLERNGYTVVCAESGAEG
Ga0137373_1060001423300012532Vadose Zone SoilMSTPAIKLNRLPVLLIEDEPAVMSYVRAVLERSGYTVVC
Ga0137395_1080678423300012917Vadose Zone SoilMSTLAAKSVPLPVLLIEDEPAVMSYVRAVLERSGYQVVCCESGADGVRRL
Ga0137404_1157488513300012929Vadose Zone SoilMTLPSAKPEALPVLLIEDEPGVMAYVRATLERNGYTVVCAE
Ga0164300_1110190523300012951SoilMSTPAAKPSTLPVLLIEDEPAVMSYVSAVLERSGYAVVC
Ga0164302_1084584013300012961SoilMTTQPVSKPETLPVLLIEDEPAVMAYVRATLERNGYSVVCSES
Ga0164309_1188922423300012984SoilMSTSAAKPSTLPVLLIEDEPAVMSYVSAVLERSGYTVVCCES
Ga0164309_1195018323300012984SoilMSLPALKPQALPVLLIEDEPAVMAYVQAALERSGYPVVCC
Ga0164305_1209112913300012989SoilMSLPAMQPEPLPILLIEDEPAVMAYVSATLERSGYQVVS
Ga0134079_1048577413300014166Grasslands SoilMSAPSLQPKVLPVLLIEDEPAVMSYVRAVLERNGYAVVCCDSGAD
Ga0157376_1205869313300014969Miscanthus RhizosphereMSLPALRPQASPVLLIEDEPAVMAYVQAALERSGYPVV
Ga0137405_125644523300015053Vadose Zone SoilMSTQPATKPAPLPVLLIEDEPAVMAYVRATLERSG
Ga0137403_1025478313300015264Vadose Zone SoilMSTPAIKQNSLPVLLIEDEPAVMSYVRAVLERSGYTVVCSDSG
Ga0134072_1031458013300015357Grasslands SoilMTLPATKAAVRTTSLPVLLIEDEPAVMAYVRATLERSGYTVVCTESG
Ga0182039_1188864423300016422SoilMSMPALKAHPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGVDAL
Ga0187802_1034299223300017822Freshwater SedimentMSAPAFQPAALPVLLIEDEPAVMAYVQAALERSGYPVVCCESGVDA
Ga0187818_1055960113300017823Freshwater SedimentMSLPAMKLSPLPVLLIEDEPAVMAYVRAALERSGYPVVCCES
Ga0187806_135527023300017928Freshwater SedimentMTTPPDITPAALPVLLIEDEPAVMAYVRATLERSG
Ga0187801_1011892923300017933Freshwater SedimentMTYPMTTTQPILKPPALPVLLIEDEPAVMAYVRAALERSGYAVVSTESGA
Ga0187809_1006776713300017937Freshwater SedimentMSMPALKAHPLPVLLIEDEPAVMAYVQAALERSGYPVVCCES
Ga0187783_1067247013300017970Tropical PeatlandMSLPAFHSRPLPVLLIEDEPAVMAYVQAALERSGYPVICCESGVDAL
Ga0187783_1076717223300017970Tropical PeatlandMSFSAAIPPPLPVLLIEDEPAVMSYVQAALERSGYPVVCCDS
Ga0187782_1145431423300017975Tropical PeatlandMNMPAIKPLAELTLPVLLIEDESAVMAYVRTALEHSGYQVVCT
Ga0187816_1021275513300017995Freshwater SedimentMSLPAVQPSPLPVLLIEDEPAVMAYVRAALERSGYPVVC
Ga0187804_1029287023300018006Freshwater SedimentMSLPALKPQPLPVLLIEDEPAVMAYVQAALERSGYPV
Ga0187805_1005130113300018007Freshwater SedimentMTLPAMKPLMLPVLLIEDEAAVMAYVQAALERNGYSVVCAESGAHGLQ
Ga0187863_1015502613300018034PeatlandMSLPALRPQPLPVLLIEDEPAVMAYVKAALERSGYPVVCCESGV
Ga0187766_1085805713300018058Tropical PeatlandMSLPALKLQPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESG
Ga0187765_1067276413300018060Tropical PeatlandMTSPAMKLAIFPVLLIEDEPAVMAYVRTALERHGYT
Ga0187784_1133100123300018062Tropical PeatlandMSLPAIKTVALPVLLIEDEAAVMAYVQAALQGNGYSVVCAESGARGL
Ga0187772_1090390713300018085Tropical PeatlandMSLHATQPAVLPVLLIEDEPAVMSYVQAALERSGYPVVCCDS
Ga0187772_1139399613300018085Tropical PeatlandMSVPAFHSRPLPVLLIEDEPAVMAYVQAALERSGYPVICCES
Ga0187769_1019909223300018086Tropical PeatlandMSLPALQTQPLPVLLIEDEPAVMAYVQAALERSGY
Ga0187769_1026107723300018086Tropical PeatlandMNLPALKPAVQPAVLPVLLIEDESAVMAYVRTALERHGYTVVCTDS
Ga0187769_1036596523300018086Tropical PeatlandMSLPAIKLTPLPVLLIEDEPAVMAYVQAALERSGYPVVCC
Ga0187771_1092033923300018088Tropical PeatlandMSLPAVKLNPLPVLLIEDEPAVMAYVRAALERSGYPVVCCE
Ga0187770_1021862523300018090Tropical PeatlandMSLPAIKLTPLPVLLIEDEPAVMAYVQAALERSGY
Ga0066667_1196032713300018433Grasslands SoilMTSPVAKPAALPVLLIEDEPAVMAYVRATLERNGYSVVCAESGVE
Ga0181514_102311213300019268PeatlandMRLPAFEPDLLPVLLIEDEPAVMAYVQAALERSGYPVVCCDSGAQA
Ga0193735_115924313300020006SoilMSTPAIKQNPLPVLLIEDEPAVMSYVRAVLVRSGYTLVCRD
Ga0193749_101527223300020010SoilMSTPAIKPNHLPVLLIEDEPAVMSYVRAVLERSGYTVVCSE
Ga0193733_101504223300020022SoilMTLPASKPAALPVLLIEDEPAVMAYVRATLERNGY
Ga0179594_1037725613300020170Vadose Zone SoilMSLPAMKPEPLPILLIEDEPGVMAYVSATLERSGYQVVSAKS
Ga0210407_1009046313300020579SoilMTTPPDITPAALPVLLIEDEPAVMAYVRATLERSGYTVVCT
Ga0210403_1027839033300020580SoilMSLPVVRPMSLPVLLIEDEPGVMAYVRAALERSGY
Ga0210395_1012796613300020582SoilMTTPPDSTPAALPVLLIEDEPAVMAYVRATLERSGYTVVCTES
Ga0210404_1059992423300021088SoilMSLPALRSQSLPVLLVEDEPAVMAYVQAALERSGY
Ga0210404_1061726023300021088SoilMSMPAIKPAFLPVLLIEDEPAVMAYVRAALERSGYSVVCTE
Ga0210408_1011649013300021178SoilMTTTQPVIRPSALPVLLIEDEPAVMAYVRATLERSGYSVVCTES
Ga0210408_1046655113300021178SoilMTTPPDITPPAALPVLLIEDEPAVMAYVRATLERSGYTVVCTE
Ga0213874_1040486913300021377Plant RootsMKSESLPLLLIEDEPAVMSYVRAVLERNGYSVVCGSSGA
Ga0210393_1008897713300021401SoilMSLPALKPQPLPVLLIEDEPAVMAYVQAALERSGY
Ga0210389_1121873013300021404SoilMTLPALRPQLLPVLLVEDEPAVMAYVQAALERSGYPVVC
Ga0210383_1044484813300021407SoilMSLPALRPQPLPVLLIEDEPAVMAYVQAALERSGYPV
Ga0210383_1121352723300021407SoilMSLPVVRPMSLPVLLIEDEPGVMAYVRAALERSGYYV
Ga0210391_1009741113300021433SoilMKPDFLPVLLIEDEPAVMAYVRAALERSGYSVVCTES
Ga0210390_1151143113300021474SoilMSLPALRPQPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGA
Ga0210402_1073029813300021478SoilMSLSALKPTLLPVLLIEDEPAVMAYVQAALERSGYPVTCCESGVD
Ga0210410_1121245423300021479SoilMSVPAVKPLLLPVLLIEDEPAVMAYVRAALERNGYSV
Ga0210409_1020050923300021559SoilMTTTPPAIPPAALPVLLIEDEPAVMAYVRATLERSGYRVVCTESGAEGLR
Ga0126371_1236808013300021560Tropical Forest SoilMSLPVLKPTPLPVLLVEDEPAVMAYVQAALERSGYPVVCCESGV
Ga0212123_10006207173300022557Iron-Sulfur Acid SpringMSQPAFKPQSLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGA
Ga0212123_1062550723300022557Iron-Sulfur Acid SpringMTMRQSAMKPATLPVLLIEDEPAVMAYVRAALERS
Ga0212123_1083931523300022557Iron-Sulfur Acid SpringMSAPSMHPKPLPVLLIEDEPAVMSYVRAVLERNGYQVVCSES
Ga0207692_1060189713300025898Corn, Switchgrass And Miscanthus RhizosphereMSLPALKPTVPPVLLIEDEPAVMAYVQAALERSGYPVVCCESGA
Ga0207692_1085716223300025898Corn, Switchgrass And Miscanthus RhizosphereMSMPAIKPEPLPILLIEDEPAVMAYVCATLERSGY
Ga0207685_1000140913300025905Corn, Switchgrass And Miscanthus RhizosphereMSLPALRPQPLPVLLIEDEPAVMAYVQAALERSGYPVICC
Ga0207662_1113164613300025918Switchgrass RhizosphereMSTPARRPSRLPVLLIEDEPAVMSYVRAVLERSGYSVLGCESGA
Ga0207664_1031319513300025929Agricultural SoilMSLPVLKSQPLPVLLVEDEPAVMAYVQAALERSGYP
Ga0207665_1003365613300025939Corn, Switchgrass And Miscanthus RhizosphereMTTQPVTKPAILPVLLIEDEPAVMAYVRATLERNG
Ga0207667_1183457313300025949Corn RhizosphereMTTQPVTKPPTLPVLLIEDEPAVMDFVRATLERNGYSVVCSE
Ga0207658_1081870623300025986Switchgrass RhizosphereMTTQPVSKPETLPVLLIEDEPAVLAYVRATLERNGYSVVCSESGA
Ga0207639_1022730723300026041Corn RhizosphereMSTPAPKPSSLPVLLIEDEPAVMSYVRAVLERSGYSVVC
Ga0207639_1173597913300026041Corn RhizosphereMSTPARRPSRLPVLLIEDEPAVMSYVRAVLERSGYS
Ga0207702_1085920023300026078Corn RhizosphereMSTPAAKPSSLPVLLIEDEPAVMSYVRAVLERSGY
Ga0207702_1153019923300026078Corn RhizosphereMSAPSIRPKSLPILLIEDEPAVMSYVRAVLERNGYEVVCSGSGVDGLK
Ga0207641_1097688123300026088Switchgrass RhizosphereMSTPAMRHDRLPVLLIEDEPAVMSYVRAVLERSGYTVVC
Ga0209839_1015594623300026294SoilMNIPALRPQALPVLLVEDEPAVMAYVQAALERSGYPVVCC
Ga0209234_100928813300026295Grasslands SoilMTLPATKAAVRTASLPVLLIEDEPAVMAYVRATLERSGYSVVCTESG
Ga0209234_131800013300026295Grasslands SoilMTLPATKAAVRTTSQPVLLIEDEPAVMAYVRATLERSGYSVVCTESG
Ga0209155_105326523300026316SoilMSTSAIKPEHLPVLLIEDEPAVMSYVKAVLERSGYTVICSE
Ga0209154_106905923300026317SoilMSMPAIKPEPLPILLIEDEPGVMAYVCATLERSGY
Ga0209472_118041113300026323SoilMTLPSAKPAALPVLLIEDEPGVMAYVRAALERKGYAVVCAESGAE
Ga0257180_101989913300026354SoilMMTTQPVTKPFTLPVLLIEDEPAVMAYVRATLERSGYSVVC
Ga0209648_10003862113300026551Grasslands SoilMSTSAIQLKQLPVLLIEDEPAVMSYVRAVLERSGYQVV
Ga0207762_106778923300027063Tropical Forest SoilMSLPALRPQTLPVLLIEDEPAVMAYVQAALERSGYPVVCCESG
Ga0208199_109471123300027497Peatlands SoilMTTPPDITPAALPVLLIEDEPAVMAYVRATLERSGYTVVC
Ga0209115_100885413300027567Forest SoilMSSMVAKSSALPVLLIEDEPAVMAYVRATLERSGYTVVCTESGVE
Ga0208042_107769813300027568Peatlands SoilMSVPAVKPTTLPVLLIEDEPAVMAYVRAALERSGYPVV
Ga0209003_106953513300027576Forest SoilMNQPATKPTPLPVLLIEDEAGVMAYVCAILERNGYSVICTESGAEALRLLESGEFL
Ga0209448_1008034923300027783Bog Forest SoilMSLPALKPQLLPVLLIEDEPAVMAYVQAALERSGY
Ga0209811_1022158223300027821Surface SoilMSLPALKPQALPVLLIEDEPAVMAYVQAALERSGYPVV
Ga0209060_1009185023300027826Surface SoilMSLPALKPQPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGVDA
Ga0209580_1031052213300027842Surface SoilMSLPAFQPQLLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGV
Ga0209580_1043694023300027842Surface SoilMSLPAMQPEPLPILLIEDEPAVMAYVCATLERSGYQVVCAKSGAEGLQ
Ga0209580_1065107823300027842Surface SoilMSLPALKPSLLPVLLIEDEPAVMAYVQAALERSGYPVVCC
Ga0209180_1023086623300027846Vadose Zone SoilMTLPATLPAVLPVLLIEDEPAVMALVRAALERSGYAVVSA
Ga0209517_1054260813300027854Peatlands SoilMTYPMTTTQPILKPPGLPVLLIEDEPAVMAYVRAALERS
Ga0209693_1000778343300027855SoilMTPPPDITPAALPVLLIEDEPAVMAYVRAALERSGYTVV
Ga0209701_1008894023300027862Vadose Zone SoilMNLPAFKPASMPVLLIEDEPAVMAYVQAALERSGYPVVCCES
Ga0209167_1020927723300027867Surface SoilMSLPAFKPAPLPVLLIEDEPAVMAYVQAALERSGYPVV
Ga0209167_1049757323300027867Surface SoilMTTSQPIIKSETLPVLLIEDEPAVMAYVRAALERSGYAVVSTESG
Ga0209579_1023349213300027869Surface SoilMSIPALKPQPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGVDAL
Ga0209283_1054865923300027875Vadose Zone SoilMSLPATRIVSLPILLIEDESSVMAYVCAALERNGYPVVCS
Ga0209380_1046514723300027889SoilMTTQPLTKPSALPVLLIEDEPAVMAYVRAALERNGYSVVCSESG
Ga0209624_1076545323300027895Forest SoilMTLPVAKPAVLPVLLIEDEPAVMSYVRAALERSGYSVVCTE
Ga0209067_1007225313300027898WatershedsMNSTVLQPPTLPVLLIEDEPAVMAYVKAALERGGYVVQTCD
Ga0209583_1034014523300027910WatershedsMNQPAIQPAVLPVLLIEDEAGVMAYVRATLERSGYTVVCAQSGAEGI
Ga0209069_1042340823300027915WatershedsMSLPAMKPELLPILLIEDEPAVMAYVSTTLERNGYQVVCAKSGAEGVR
Ga0268266_1099824113300028379Switchgrass RhizosphereMNQTVPNPAIPPVLLIEDEPGVMAYVRAVLERSGYPVVATNSG
Ga0137415_1073386613300028536Vadose Zone SoilMSTSTVKPQQLPVLLIEDEPAVMSYVRAVLERSGYE
Ga0308309_1113211633300028906SoilMSTQPVTKPAILPVLLIEDEAGVMAYVRATLERNGYAVVCAESGAEGVR
Ga0222749_1048185423300029636SoilMTLSATKPVTLPVLLIEDEPAVMAYVRATLERNGY
Ga0247271_100357113300029903SoilMSLPALRMQPLPILLIEDEPAVMAYVQAALERSGY
Ga0311369_1113821213300029910PalsaMSLPALKPQSLPVLLIEDEPAVMAYVQAALERSGYPVVCC
Ga0311340_1140713723300029943PalsaMSLPALQLQPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGVDA
Ga0302179_1030748213300030058PalsaMSLPALQLQPLPVLLIEDEPAVMAYVQAALERSGYPVVCCESGVDAL
Ga0311349_1043691223300030294FenMMTPAKTTTLPVLLIEDEAAVMDFVRATLERSGYSV
Ga0311360_1048161813300030339BogMMTPAKTTTLPVLLIEDEAAVMDFVRATLERSGYSVVCAK
Ga0170834_10070892513300031057Forest SoilMSTHAVKAEPIPVLLIEDEPAVMSYVKAVLERSGYAVVCSESGADGVR
Ga0170824_12741532313300031231Forest SoilMSTFAAKTGPLPVLLIEDEPAVMSYVLAVLERSGYQVVCSESG
Ga0310686_10896182323300031708SoilMNLPATKPAGLPVLLIEDEPAVMAYVRAVLERSGYSVVCTES
Ga0310686_11273594323300031708SoilMSTTVTKSSALPVLLIEDEPAVMAYVRATLERSGYAVVCTESGAE
Ga0307474_1025227213300031718Hardwood Forest SoilMTTTHPIIKPPTLPVLLIEDEPAVMAYVRAALDRSGY
Ga0307468_10203285613300031740Hardwood Forest SoilMTTQPISKPESLPVLLIEDEPAVMAYVRATLERNGYSVVC
Ga0306918_1123021313300031744SoilMSLLAVKPSPLPILLIEDEPAVMAYVSATLERSGYHVVCANS
Ga0307478_1087836123300031823Hardwood Forest SoilMNSSAVKFVPSPVLLIEDEPAVMAYVQAALERSGYPVVCC
Ga0307471_10001844113300032180Hardwood Forest SoilMTTQPVTKPATLPVLLIEDEPAVMAYVRAALERNGYSVVCSESGA
Ga0307471_10141305013300032180Hardwood Forest SoilMSMPPIAKPATLPVLLIEDEPGVMAYVRATLERSGYSVV
Ga0307471_10289504923300032180Hardwood Forest SoilMSLPAMKPEPLPILLIEDEPAVMAYVSATLERSGYQVVSAKSGAEG
Ga0307472_10121888013300032205Hardwood Forest SoilMSVPAFKPALLPVLLIEDEPAVMAYVRAALERSGYSV
Ga0306920_10080842313300032261SoilMSLLAVSPNPLPILLIEDEPGVMAYVSATLERSGYQVVCANSGAA
Ga0335082_1106415813300032782SoilMNQPGSKPAVLPILLIEDEPGVMAYVRAALERSGYSVVTT
Ga0335079_1015751123300032783SoilMSLPALKAQALPVLLIEDEPAVMAYVQAALERSGYP
Ga0335078_1064707523300032805SoilMTLPAIKPAVLPVLLIEDEAAVMAYVQAALERNGYSVVCAESGA
Ga0335080_1016715623300032828SoilMSLPAFKPQPLPVLLIEDEPAVMAYVQAALERSGYPV
Ga0335081_1122671523300032892SoilMSLPAFKAQPLPILLIEDEPAVMAYVQAALERSGYPVVCC
Ga0335077_1172400523300033158SoilMGLSTPHPVVLPVLIIEDEPGVMAYVRAALERSGYVVVGAHSGEEALGIL
Ga0326726_1025533413300033433Peat SoilMSLPAVKSHQLPVLLVEDEPAVMAYVQAALERSGYPVVCCESGVDAL
Ga0370515_0308351_538_6693300034163Untreated Peat SoilMSLPAFQPALLPVLLIEDEPAVMAYVQAALERSGYPVVCCDSGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.