NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018355

Metagenome / Metatranscriptome Family F018355

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018355
Family Type Metagenome / Metatranscriptome
Number of Sequences 235
Average Sequence Length 52 residues
Representative Sequence MKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNDLIEE
Number of Associated Samples 137
Number of Associated Scaffolds 235

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.78 %
% of genes near scaffold ends (potentially truncated) 31.06 %
% of genes from short scaffolds (< 2000 bps) 77.45 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.660 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(48.936 % of family members)
Environment Ontology (ENVO) Unclassified
(81.702 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(95.319 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.27%    β-sheet: 0.00%    Coil/Unstructured: 72.73%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 235 Family Scaffolds
PF06199Phage_tail_2 61.70
PF09550Phage_TAC_6 8.94
PF11367DUF3168 3.83
PF09206ArabFuran-catal 2.55
PF10145PhageMin_Tail 1.70
PF05521Phage_H_T_join 1.28
PF06791TMP_2 1.28
PF00754F5_F8_type_C 0.85
PF13385Laminin_G_3 0.85
PF05135Phage_connect_1 0.85
PF13730HTH_36 0.43
PF05065Phage_capsid 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 235 Family Scaffolds
COG5281Phage-related minor tail proteinMobilome: prophages, transposons [X] 1.28
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.30 %
UnclassifiedrootN/A21.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10022389All Organisms → cellular organisms → Bacteria3654Open in IMG/M
3300000101|DelMOSum2010_c10037143All Organisms → Viruses → Predicted Viral2592Open in IMG/M
3300000101|DelMOSum2010_c10055701All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1939Open in IMG/M
3300000101|DelMOSum2010_c10116433All Organisms → Viruses → Predicted Viral1064Open in IMG/M
3300000115|DelMOSum2011_c10039523All Organisms → Viruses → Predicted Viral1989Open in IMG/M
3300000115|DelMOSum2011_c10060488All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1429Open in IMG/M
3300000115|DelMOSum2011_c10131932All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium766Open in IMG/M
3300000116|DelMOSpr2010_c10011003All Organisms → cellular organisms → Bacteria4690Open in IMG/M
3300000116|DelMOSpr2010_c10015307All Organisms → Viruses → Predicted Viral3858Open in IMG/M
3300000116|DelMOSpr2010_c10194565All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium654Open in IMG/M
3300000117|DelMOWin2010_c10016395All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3992Open in IMG/M
3300000117|DelMOWin2010_c10020608All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3444Open in IMG/M
3300000117|DelMOWin2010_c10026942All Organisms → Viruses → Predicted Viral2870Open in IMG/M
3300000117|DelMOWin2010_c10029081All Organisms → cellular organisms → Bacteria2724Open in IMG/M
3300000117|DelMOWin2010_c10049814All Organisms → Viruses → Predicted Viral1858Open in IMG/M
3300000117|DelMOWin2010_c10059484All Organisms → Viruses → Predicted Viral1614Open in IMG/M
3300000117|DelMOWin2010_c10094855All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1113Open in IMG/M
3300000117|DelMOWin2010_c10095160All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1110Open in IMG/M
3300000117|DelMOWin2010_c10163251All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium721Open in IMG/M
3300000117|DelMOWin2010_c10225207All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300001346|JGI20151J14362_10031905All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2547Open in IMG/M
3300001347|JGI20156J14371_10005581All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium8695Open in IMG/M
3300001460|JGI24003J15210_10000573All Organisms → cellular organisms → Bacteria15755Open in IMG/M
3300002930|Water_100370All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium9995Open in IMG/M
3300002930|Water_101361All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4607Open in IMG/M
3300004097|Ga0055584_100179373All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2145Open in IMG/M
3300004829|Ga0068515_109085All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300005747|Ga0076924_1232393Not Available512Open in IMG/M
3300006025|Ga0075474_10004248All Organisms → cellular organisms → Bacteria5857Open in IMG/M
3300006025|Ga0075474_10094704All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300006025|Ga0075474_10185868All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006026|Ga0075478_10025704All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1973Open in IMG/M
3300006026|Ga0075478_10177677All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium656Open in IMG/M
3300006027|Ga0075462_10068499All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1118Open in IMG/M
3300006027|Ga0075462_10108845All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium858Open in IMG/M
3300006027|Ga0075462_10129472All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium776Open in IMG/M
3300006027|Ga0075462_10155199All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium698Open in IMG/M
3300006029|Ga0075466_1037422All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1483Open in IMG/M
3300006637|Ga0075461_10047025All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300006637|Ga0075461_10187043All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium623Open in IMG/M
3300006735|Ga0098038_1073442Not Available1207Open in IMG/M
3300006752|Ga0098048_1107971All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium840Open in IMG/M
3300006789|Ga0098054_1016841All Organisms → cellular organisms → Bacteria2942Open in IMG/M
3300006802|Ga0070749_10171440All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300006802|Ga0070749_10380825All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300006802|Ga0070749_10381665All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300006802|Ga0070749_10405027All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006802|Ga0070749_10558933All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium620Open in IMG/M
3300006810|Ga0070754_10072261All Organisms → Viruses → Predicted Viral1760Open in IMG/M
3300006810|Ga0070754_10149087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1119Open in IMG/M
3300006810|Ga0070754_10158745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1076Open in IMG/M
3300006810|Ga0070754_10220061All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300006810|Ga0070754_10307633All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300006810|Ga0070754_10481987All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium535Open in IMG/M
3300006810|Ga0070754_10493893All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006867|Ga0075476_10210778Not Available704Open in IMG/M
3300006868|Ga0075481_10098889All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1085Open in IMG/M
3300006868|Ga0075481_10151153All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300006869|Ga0075477_10108573All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300006916|Ga0070750_10056270All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1893Open in IMG/M
3300006919|Ga0070746_10010035All Organisms → cellular organisms → Bacteria5384Open in IMG/M
3300006919|Ga0070746_10064871All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300006919|Ga0070746_10193054All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300006924|Ga0098051_1178644All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium557Open in IMG/M
3300007229|Ga0075468_10101038Not Available914Open in IMG/M
3300007229|Ga0075468_10162382All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium670Open in IMG/M
3300007234|Ga0075460_10124215All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300007236|Ga0075463_10057166All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1261Open in IMG/M
3300007344|Ga0070745_1135527All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300007345|Ga0070752_1122363Not Available1093Open in IMG/M
3300007345|Ga0070752_1177723All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium860Open in IMG/M
3300007345|Ga0070752_1386106All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter520Open in IMG/M
3300007346|Ga0070753_1053608All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1652Open in IMG/M
3300007346|Ga0070753_1303517Not Available570Open in IMG/M
3300007346|Ga0070753_1322119All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300007538|Ga0099851_1085506Not Available1211Open in IMG/M
3300007538|Ga0099851_1249230All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300007538|Ga0099851_1267417Not Available608Open in IMG/M
3300007538|Ga0099851_1281784Not Available589Open in IMG/M
3300007540|Ga0099847_1053581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1267Open in IMG/M
3300007541|Ga0099848_1191650Not Available737Open in IMG/M
3300007542|Ga0099846_1135428Not Available892Open in IMG/M
3300007640|Ga0070751_1057773All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1680Open in IMG/M
3300008012|Ga0075480_10200737All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300008012|Ga0075480_10278776Not Available855Open in IMG/M
3300008012|Ga0075480_10603068Not Available519Open in IMG/M
3300009076|Ga0115550_1142856All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium842Open in IMG/M
3300009077|Ga0115552_1383324All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium555Open in IMG/M
3300009124|Ga0118687_10051387All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1378Open in IMG/M
3300009124|Ga0118687_10115741All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300009423|Ga0115548_1029158All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2131Open in IMG/M
3300009467|Ga0115565_10248212Not Available814Open in IMG/M
3300009467|Ga0115565_10458885Not Available573Open in IMG/M
3300009599|Ga0115103_1297989Not Available501Open in IMG/M
3300009599|Ga0115103_1834212All Organisms → Viruses → Predicted Viral2018Open in IMG/M
3300009606|Ga0115102_10788118Not Available869Open in IMG/M
3300009757|Ga0123367_1074222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.892Open in IMG/M
3300010296|Ga0129348_1150369All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300010296|Ga0129348_1154614All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300010296|Ga0129348_1184558All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium713Open in IMG/M
3300010299|Ga0129342_1256750Not Available608Open in IMG/M
3300010300|Ga0129351_1279610Not Available634Open in IMG/M
3300010368|Ga0129324_10230661Not Available743Open in IMG/M
3300010368|Ga0129324_10257817All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300010368|Ga0129324_10292515Not Available642Open in IMG/M
3300010368|Ga0129324_10358400All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium567Open in IMG/M
3300011253|Ga0151671_1009155All Organisms → cellular organisms → Bacteria6898Open in IMG/M
3300011258|Ga0151677_1017384All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium8207Open in IMG/M
3300012472|Ga0129328_1050867Not Available935Open in IMG/M
3300013010|Ga0129327_10495205Not Available661Open in IMG/M
3300016748|Ga0182043_1303625All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium670Open in IMG/M
3300017708|Ga0181369_1110457Not Available565Open in IMG/M
3300017710|Ga0181403_1002300All Organisms → Viruses → Predicted Viral4375Open in IMG/M
3300017717|Ga0181404_1032741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1330Open in IMG/M
3300017720|Ga0181383_1023700All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300017720|Ga0181383_1027027All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300017724|Ga0181388_1010997All Organisms → Viruses → Predicted Viral2334Open in IMG/M
3300017724|Ga0181388_1045820Not Available1060Open in IMG/M
3300017726|Ga0181381_1029402All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300017742|Ga0181399_1024404All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1670Open in IMG/M
3300017770|Ga0187217_1219926All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium625Open in IMG/M
3300017776|Ga0181394_1025715All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2087Open in IMG/M
3300017824|Ga0181552_10043620All Organisms → cellular organisms → Bacteria2668Open in IMG/M
3300017951|Ga0181577_10251889All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1161Open in IMG/M
3300017951|Ga0181577_10505022All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium756Open in IMG/M
3300017951|Ga0181577_10674778All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300017957|Ga0181571_10313070Not Available988Open in IMG/M
3300017985|Ga0181576_10471970Not Available774Open in IMG/M
3300018080|Ga0180433_10863801All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300018410|Ga0181561_10232678Not Available884Open in IMG/M
3300018410|Ga0181561_10486817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter554Open in IMG/M
3300018416|Ga0181553_10066712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2317Open in IMG/M
3300018416|Ga0181553_10067303All Organisms → cellular organisms → Bacteria2304Open in IMG/M
3300018416|Ga0181553_10086249All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1969Open in IMG/M
3300018428|Ga0181568_10333994All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1230Open in IMG/M
3300019756|Ga0194023_1067318All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300020165|Ga0206125_10001949All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium22780Open in IMG/M
3300020165|Ga0206125_10038168All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2491Open in IMG/M
3300020165|Ga0206125_10170323Not Available864Open in IMG/M
3300020184|Ga0181573_10008850All Organisms → cellular organisms → Bacteria7868Open in IMG/M
3300020185|Ga0206131_10024448All Organisms → cellular organisms → Bacteria4796Open in IMG/M
3300020185|Ga0206131_10027413All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4422Open in IMG/M
3300020187|Ga0206130_10070177All Organisms → Viruses → Predicted Viral2279Open in IMG/M
3300020187|Ga0206130_10085069All Organisms → cellular organisms → Bacteria1948Open in IMG/M
3300021085|Ga0206677_10001226All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium23881Open in IMG/M
3300021085|Ga0206677_10149169Not Available1047Open in IMG/M
3300021185|Ga0206682_10128748Not Available1218Open in IMG/M
3300021335|Ga0213867_1047756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1646Open in IMG/M
3300021347|Ga0213862_10319852Not Available551Open in IMG/M
3300021356|Ga0213858_10022074All Organisms → Viruses → Predicted Viral3042Open in IMG/M
3300021364|Ga0213859_10243002All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300021364|Ga0213859_10365266All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter643Open in IMG/M
3300021365|Ga0206123_10318533All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium657Open in IMG/M
3300021371|Ga0213863_10060584All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1922Open in IMG/M
3300021378|Ga0213861_10395624Not Available680Open in IMG/M
3300021379|Ga0213864_10073723All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300021389|Ga0213868_10239651All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1066Open in IMG/M
3300021389|Ga0213868_10457376Not Available694Open in IMG/M
3300021958|Ga0222718_10321660All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium796Open in IMG/M
3300021958|Ga0222718_10545649Not Available553Open in IMG/M
3300021958|Ga0222718_10595115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter520Open in IMG/M
3300021960|Ga0222715_10450253Not Available693Open in IMG/M
3300021964|Ga0222719_10216960All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1296Open in IMG/M
3300022050|Ga0196883_1019601Not Available812Open in IMG/M
3300022053|Ga0212030_1053462Not Available574Open in IMG/M
3300022057|Ga0212025_1007604All Organisms → Viruses → Predicted Viral1529Open in IMG/M
3300022058|Ga0224905_101232All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300022063|Ga0212029_1024240Not Available829Open in IMG/M
3300022067|Ga0196895_1035831All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300022068|Ga0212021_1005749All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300022068|Ga0212021_1119132All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300022072|Ga0196889_1001501All Organisms → cellular organisms → Bacteria6282Open in IMG/M
3300022072|Ga0196889_1052370All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium789Open in IMG/M
3300022164|Ga0212022_1035055All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium774Open in IMG/M
3300022178|Ga0196887_1117179All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium576Open in IMG/M
3300022183|Ga0196891_1032555Not Available976Open in IMG/M
3300022183|Ga0196891_1077148Not Available592Open in IMG/M
3300022187|Ga0196899_1003835All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium6664Open in IMG/M
3300022187|Ga0196899_1116711All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300022187|Ga0196899_1169228Not Available596Open in IMG/M
3300022198|Ga0196905_1048983All Organisms → Viruses → Predicted Viral1208Open in IMG/M
3300022200|Ga0196901_1089828All Organisms → Viruses → Predicted Viral1084Open in IMG/M
3300022200|Ga0196901_1139083All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium817Open in IMG/M
3300022909|Ga0255755_1117800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1128Open in IMG/M
3300022934|Ga0255781_10002525All Organisms → cellular organisms → Bacteria14582Open in IMG/M
3300023706|Ga0232123_1050319All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium836Open in IMG/M
(restricted) 3300024062|Ga0255039_10048071All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1609Open in IMG/M
3300024326|Ga0228652_1023451All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Thalassoglobus1771Open in IMG/M
(restricted) 3300024518|Ga0255048_10188045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp.1009Open in IMG/M
3300025103|Ga0208013_1081463Not Available836Open in IMG/M
3300025120|Ga0209535_1002377All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium12290Open in IMG/M
3300025508|Ga0208148_1007836All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3380Open in IMG/M
3300025508|Ga0208148_1027960All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium1542Open in IMG/M
3300025508|Ga0208148_1030267All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1462Open in IMG/M
3300025570|Ga0208660_1052924All Organisms → Viruses → Predicted Viral1006Open in IMG/M
3300025610|Ga0208149_1003609All Organisms → cellular organisms → Bacteria5252Open in IMG/M
3300025610|Ga0208149_1006035All Organisms → Viruses → Predicted Viral3917Open in IMG/M
3300025610|Ga0208149_1053809All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300025610|Ga0208149_1082643All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium789Open in IMG/M
3300025630|Ga0208004_1016340All Organisms → Viruses → Predicted Viral2380Open in IMG/M
3300025645|Ga0208643_1035162All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1626Open in IMG/M
3300025645|Ga0208643_1048620All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1310Open in IMG/M
3300025646|Ga0208161_1026031All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2120Open in IMG/M
3300025646|Ga0208161_1029403All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1953Open in IMG/M
3300025646|Ga0208161_1120133Not Available696Open in IMG/M
3300025646|Ga0208161_1123847Not Available679Open in IMG/M
3300025653|Ga0208428_1025253All Organisms → Viruses → Predicted Viral1932Open in IMG/M
3300025653|Ga0208428_1076137All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300025653|Ga0208428_1151114Not Available622Open in IMG/M
3300025655|Ga0208795_1061133All Organisms → Viruses → Predicted Viral1087Open in IMG/M
3300025671|Ga0208898_1006347All Organisms → cellular organisms → Bacteria6451Open in IMG/M
3300025671|Ga0208898_1020980All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2886Open in IMG/M
3300025674|Ga0208162_1007240All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4936Open in IMG/M
3300025674|Ga0208162_1092648All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium913Open in IMG/M
3300025674|Ga0208162_1180420All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025751|Ga0208150_1115111All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300025759|Ga0208899_1087513All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1196Open in IMG/M
3300025769|Ga0208767_1015370All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4481Open in IMG/M
3300025769|Ga0208767_1017544All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4107Open in IMG/M
3300025769|Ga0208767_1034418Not Available2561Open in IMG/M
3300025806|Ga0208545_1007813All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4038Open in IMG/M
3300025810|Ga0208543_1130475Not Available592Open in IMG/M
3300025828|Ga0208547_1070996All Organisms → Viruses → Predicted Viral1137Open in IMG/M
3300025828|Ga0208547_1212760All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300025853|Ga0208645_1126952All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300025889|Ga0208644_1087296All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1576Open in IMG/M
3300025889|Ga0208644_1144128All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1102Open in IMG/M
3300025889|Ga0208644_1315699Not Available613Open in IMG/M
3300027582|Ga0208971_1027423All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1796Open in IMG/M
3300029318|Ga0185543_1005586All Organisms → Viruses → Predicted Viral3304Open in IMG/M
3300031851|Ga0315320_10906057Not Available542Open in IMG/M
3300034374|Ga0348335_088336Not Available1019Open in IMG/M
3300034374|Ga0348335_151260All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium634Open in IMG/M
3300034375|Ga0348336_005651All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium8601Open in IMG/M
3300034375|Ga0348336_162809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium645Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous48.94%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine8.51%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.23%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.11%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.68%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient4.26%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.83%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater3.40%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.13%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.13%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.70%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.28%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.85%
Estuary WaterEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water0.85%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.43%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.43%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.43%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.43%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.43%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.43%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001347Pelagic Microbial community sample from North Sea - COGITO 998_met_06EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300002930Estuary water microbial communities from Pearl Estuary, Zhujiang, ChinaEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009757Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022058Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 (v2)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1002238953300000101MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDTNDLIEE*
DelMOSum2010_1003714333300000101MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKARGYLNAPTKKKDSDNNDLIEE*
DelMOSum2010_1005570133300000101MarineMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPQPKKETTENEE*
DelMOSum2010_1011643333300000101MarineMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE*
DelMOSum2011_1003952333300000115MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNELTEQ*
DelMOSum2011_1006048823300000115MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNDLXEE*
DelMOSum2011_1013193223300000115MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNDLIEE*
DelMOSpr2010_1001100323300000116MarineMKVTXQKACKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE*
DelMOSpr2010_1001530713300000116MarineMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDESNDITKE*
DelMOSpr2010_1019456523300000116MarineMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE*
DelMOWin2010_1001639563300000117MarineMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKNDSENNDLTEE*
DelMOWin2010_1002060843300000117MarineMKVTIQKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPQPKKETTENEE*
DelMOWin2010_1002694223300000117MarineMKVTIQKACKLRGNNWKKGSTPSVTSDFAAELKAKGYLNAPKKKTDSDNNDLTEE*
DelMOWin2010_1002908133300000117MarineMKVTIQKACKLHGNNWKKGDTPSVTAEFAKELKDKGYLGRSKEKNRIRK*
DelMOWin2010_1004981443300000117MarineMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDESNDITEE*
DelMOWin2010_1005948423300000117MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNDLTEE*
DelMOWin2010_1009485533300000117MarineMKVTIMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKETKESIESE*
DelMOWin2010_1009516033300000117MarineMKVTIMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKNTDESIEQE*
DelMOWin2010_1016325123300000117MarineMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDEFNDITKE*
DelMOWin2010_1022520713300000117MarineMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKNTDESIEQE*
JGI20151J14362_1003190523300001346Pelagic MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKERGYLDAPKKKTDSDNNDLTEE*
JGI20156J14371_1000558163300001347Pelagic MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIXE*
JGI24003J15210_10000573253300001460MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDLDNNELTEE*
Water_10037023300002930Estuary WaterMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKNDLENNDLTEE*
Water_10136133300002930Estuary WaterMKVTIQKACKLHGNNWKKGDTPSVTAEFAKELKDKGYLDAPKKKTESENNDLTKE*
Ga0055584_10017937333300004097Pelagic MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKNDSENNDLTEE*
Ga0068515_10908533300004829Marine WaterMKVTIMKACKLRGNNFKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE*
Ga0076924_123239313300005747MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE*
Ga0075474_1000424863300006025AqueousMKVTIMKACKLRGNNWKKGDTPNVDNEFAAELKEKGYLDAPKKKTENESIESE*
Ga0075474_1009470433300006025AqueousMKVTIMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKKTDDESIESE*
Ga0075474_1018586823300006025AqueousMKVTIMKACKLRGNNWKKGDTPSVTSEFAAELKAKGYLDAPKKKTDDESIESE*
Ga0075478_1002570443300006026AqueousMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKKTDDESIESE*
Ga0075478_1017767713300006026AqueousQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE*
Ga0075462_1006849943300006027AqueousMKVTIMKACKLRGNNWKKGATPSVTKEFAAELKEKGYLDAPKKKTDDESIESE*
Ga0075462_1010884533300006027AqueousMKVTIQKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPQPKKE
Ga0075462_1012947213300006027AqueousMKVTIMKACKLRGNNWKKGDTPSVTSEFAAELKKRGYLDAPKKKT
Ga0075462_1015519933300006027AqueousIAAMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE*
Ga0075466_103742233300006029AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNE
Ga0075461_1004702513300006637AqueousIAAMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEEESNDITEE*
Ga0075461_1018704323300006637AqueousMKVTIQKACKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE*
Ga0098038_107344253300006735MarineMKVTIMKACKLRGNNWKKGDTPSVTTDFAAELKEKGYLDATKKKTEKESIESE
Ga0098048_110797123300006752MarineMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPTKKKDSDNNDLIEE*
Ga0098054_101684153300006789MarineMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKKDSDNNDLIEE*
Ga0070749_1017144023300006802AqueousMKVTIQKACKLRGNNWKKGDQPTVTREFAAELKAKGYLDAPEPKKKTTENEE*
Ga0070749_1038082523300006802AqueousMKVIIMKACKLRGNNFKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE*
Ga0070749_1038166523300006802AqueousMKVTIQKTCKLRGNNWKKGATPTVTREFAAELKAKGYLDAPQPKKETTENEE*
Ga0070749_1040502723300006802AqueousMKVTIMKACKLRGNNWKKGDTPSVTSEFAAELKKRGYLDAPKKKTDDESIESE*
Ga0070749_1055893313300006802AqueousMKVTIQKACKLHGNNWKKGDTPTVTTAFAEKLKKKGYLDAPKKKTDEESNDITEE*
Ga0070754_1007226133300006810AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTD
Ga0070754_1014908743300006810AqueousMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDDESIESE*
Ga0070754_1015874513300006810AqueousVTIMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKKTDDESIESE*
Ga0070754_1022006133300006810AqueousRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKKTDEESIESE*
Ga0070754_1030763313300006810AqueousKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKNTDESIEQE*
Ga0070754_1048198713300006810AqueousMKVTIQKACKLRGNSWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEE
Ga0070754_1049389323300006810AqueousGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKETKESIESE*
Ga0075476_1021077813300006867AqueousMKVTIQKACKLRGNNWKKGATPAVTRDFAAELKAKGYLDAPEPKKETTENEE*
Ga0075481_1009888913300006868AqueousCKLRGNNFKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE*
Ga0075481_1015115323300006868AqueousMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPEPKKETTENEE*
Ga0075477_1010857333300006869AqueousMKVTIMKACKLRGNNWKKGDTPSVTSECAAEVKAKGYLDAPKKKTDDESIESE*
Ga0070750_1005627013300006916AqueousMKVTIMKACKLRGNNWKKGDTPSVTSEFAAELKKRGYLDAPKKKTD
Ga0070746_1001003573300006919AqueousMKACKLRGNNFKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE*
Ga0070746_1006487143300006919AqueousMKVTIMKACKLRGNNWKKGDTPNVDKEFAAELKEKGYLDAPKKKTDDESIESE*
Ga0070746_1019305433300006919AqueousMKVTIMKACKLRGNNWKKGDTPNVDKEFAAELKEKGYLDAPKKKTENESIESE*
Ga0098051_117864423300006924MarineMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPTKKKDSDNNDLIE
Ga0075468_1010103813300007229AqueousMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPKKKTDSDNNDLTEE*
Ga0075468_1016238213300007229AqueousMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNDLIEE*
Ga0075460_1012421523300007234AqueousMKVTIQKTCKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPEPKKETTENEE*
Ga0075463_1005716613300007236AqueousMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEEESNDITEE*
Ga0070745_113552743300007344AqueousNNWKKGAMPTVTKEFAAELKEKGYLDAPKKKTDEESIESE*
Ga0070752_112236333300007345AqueousMKVTIQKTCKLRGNNWKKGATPAVTRDFAAELKAKGYLDAPEPKKETTENEE*
Ga0070752_117772333300007345AqueousMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPQPKKE
Ga0070752_138610623300007345AqueousCKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITKE*
Ga0070753_105360813300007346AqueousIAAMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDDESIESE*
Ga0070753_130351713300007346AqueousKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPEPKKETTENEE*
Ga0070753_132211923300007346AqueousKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKKTDEESIESE*
Ga0099851_108550633300007538AqueousMKVTIQKACKLRGNNWKKGDQPTVTREFAAELKAKGYLDAPEPKKKTIENEE*
Ga0099851_124923023300007538AqueousMKVTIMKACKLRGNNWKKGATPTVTKEFAAELKEKGYLDAPKKETKESIESE*
Ga0099851_126741713300007538AqueousIQKTCKLRGNNWKKGATPTVTREFAAELKAKGYLDAPEQKKETTENEE*
Ga0099851_128178423300007538AqueousMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDEFNDITEE*
Ga0099847_105358123300007540AqueousMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKETKESIESE*
Ga0099848_119165023300007541AqueousMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPEQKKETTENEE*
Ga0099846_113542813300007542AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELIEE*
Ga0070751_105777343300007640AqueousMKVTIQKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPQPKKETTENE
Ga0075480_1020073713300008012AqueousQKACKLRGNNWKKGDQPTVTREFAAELKAKGYLDAPEPKKKTTENEE*
Ga0075480_1027877613300008012AqueousMKVTIMKACKLRGNNWKKGDTPNVDKEFAAELKEKGYLDAPKKKTENEYIESE*
Ga0075480_1060306813300008012AqueousKVTIQKACKLRGNNWKKGATPAVTRDFAAELKAKGYLDAPEPKKETTENEE*
Ga0115550_114285623300009076Pelagic MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELIEE*
Ga0115552_138332423300009077Pelagic MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIVE*
Ga0118687_1005138713300009124SedimentMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEEESNDITKE*
Ga0118687_1011574123300009124SedimentMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKKTDEESIESE*
Ga0115548_102915853300009423Pelagic MarineMKVTIQKACKLHGNNWKKGDTPSVTAEFAKELKDKGYLDAPKKKTESENND*
Ga0115565_1024821233300009467Pelagic MarineLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELIEE*
Ga0115565_1045888513300009467Pelagic MarineLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE*
Ga0115103_129798913300009599MarineMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNELTEE*
Ga0115103_183421233300009599MarineMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDINELTEE*
Ga0115102_1078811833300009606MarineQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNELTEE*
Ga0123367_107422233300009757MarineMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKKTDDESIESE*
Ga0129348_115036913300010296Freshwater To Marine Saline GradientMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKETKESIESE*
Ga0129348_115461413300010296Freshwater To Marine Saline GradientMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKNTDESIEQE*
Ga0129348_118455813300010296Freshwater To Marine Saline GradientMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKKTDDES
Ga0129342_125675023300010299Freshwater To Marine Saline GradientMKVTIQKACKLHGNNWKKGDTPTVTTAFAQELKKKGYLDAPKKKTDEESNDITEE*
Ga0129351_127961033300010300Freshwater To Marine Saline GradientMKVTIMKACKLRGNNWKKGATPTVTKEFAAELKEKGYLDAPKKKTDEESIESE*
Ga0129324_1023066113300010368Freshwater To Marine Saline GradientMKVTIQKSCKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPEPKKETTENEE*
Ga0129324_1025781733300010368Freshwater To Marine Saline GradientAMKVTIMKACKLRGNNFKKGDTPSVTSDFAAELKEKGYLDAPKKKTEKESIESE*
Ga0129324_1029251513300010368Freshwater To Marine Saline GradientMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLEAPEPKKETTENEE*
Ga0129324_1035840013300010368Freshwater To Marine Saline GradientMKVTIQKACKLHGNNWKKGDTPTVTTAFAQELKKKGYLDAPKKKTDEEANDITEE*
Ga0151671_100915573300011253MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPTKKKDSDNNELIEE*
Ga0151677_101738483300011258MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNELIEE*
Ga0129328_105086713300012472AqueousQKACKLRGNNWKKGSTPSVTSDFAAELKAKGYLNAPKKKTDSDNNDLTEE*
Ga0129327_1049520523300013010Freshwater To Marine Saline GradientMKVTIEKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDARTKKKDSDNNELTEQ*
Ga0182043_130362513300016748Salt MarshKACKLRGDNWKKGDTPTVTTAFAEELKKKGYLDVPKKKTEEESNDITEE
Ga0181369_111045713300017708MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKKDSDNNDLIEE
Ga0181403_100230013300017710SeawaterMKACKLRGNNFKKGDTPSVTTDFAAELKERGYLDAPKKKTEKESIETE
Ga0181404_103274123300017717SeawaterMKVTIMKACKLRGNNFKKGDTPSVTTDFAAELKERGYLDAPKKKTEKESIETE
Ga0181383_102370033300017720SeawaterMKVTIMKACKLRGNNFKKGATPSVTSEFAAELKAKGYLDAPKKKTDDESIESE
Ga0181383_102702733300017720SeawaterMKVTIMKACKLRGNNWKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE
Ga0181388_101099743300017724SeawaterMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKK
Ga0181388_104582023300017724SeawaterMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDINELTEE
Ga0181381_102940233300017726SeawaterMKVTIMKACKLRGNNFKKGDTPSVTTDFAAELKEKGYLDAPKKKTEKESIESE
Ga0181399_102440413300017742SeawaterKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELTEE
Ga0187217_121992623300017770SeawaterMKVTIEKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0181394_102571533300017776SeawaterMKVTIQKACKLRGKNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0181552_1004362033300017824Salt MarshMKVTIQKACKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEEESNDITEE
Ga0181577_1025188913300017951Salt MarshMKACKLRGNNWKKGDTPNVTTAFAEELKKKGYLDAPKKKT
Ga0181577_1050502223300017951Salt MarshMKVTIMKACKLRGNNWKKGDTPNVTTAFAEELKKKGYLDAPKKKTDEESNDITEE
Ga0181577_1067477823300017951Salt MarshMKVTIQKACKLRGNNWKKGATPTVTREFADELKAKGYLDAPAPKKETTENEE
Ga0181571_1031307033300017957Salt MarshMKVTIQKACKLRGNNWKKGATPSVTTDFAAELKRKGYLTAPAPKKETTETEE
Ga0181576_1047197023300017985Salt MarshMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKRKGYLTAPAPKKETTETEE
Ga0180433_1086380123300018080Hypersaline Lake SedimentMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKKTDDESIESE
Ga0181561_1023267823300018410Salt MarshMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEEESNDITEE
Ga0181561_1048681723300018410Salt MarshMKVTIQKACKLHGNNWKKGDTPTVTTAFAEKLKKKGYLDAPKKKTEDESNDITEE
Ga0181553_1006671253300018416Salt MarshMKVTIQKACKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE
Ga0181553_1006730353300018416Salt MarshMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKETKESIESE
Ga0181553_1008624923300018416Salt MarshMKVTIQKACKLRGNNWKKGATPSVTSYFAAELKRKGYLTAPAPKKETTDTEE
Ga0181568_1033399423300018428Salt MarshMKVTIQKACKLRGNNWKKGATPTVTREFADELKAKGYLDAPAPKKETTETEE
Ga0194023_106731833300019756FreshwaterMKVTIMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKNTDESIEQE
Ga0206125_10001949253300020165SeawaterMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELTEE
Ga0206125_1003816833300020165SeawaterMKVTIQKACKLHGNNWKKGDTPSVTAEFAKELKDKGYLDAPKKKTESENNDLTKE
Ga0206125_1017032333300020165SeawaterMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0181573_10008850113300020184Salt MarshMKACKLRGNNWKKGDTPNVTTAFAEELKKKGYLDAPKKKTDEESNDITEE
Ga0206131_1002444853300020185SeawaterMKVTIQKACKLRGNNWKKGATPSITSDFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0206131_1002741353300020185SeawaterMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIVE
Ga0206130_1007017733300020187SeawaterMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPKKKTDSDNNDLIEE
Ga0206130_1008506953300020187SeawaterTIQKACKLHGNNWKKGDTPSVTAEFAKELKDKGYLDAPKKKTESENNDLTKE
Ga0206677_10001226293300021085SeawaterMKVTIQKACKLRGHNWKKGATPSVTSEFAAELKAKGYLDAPKKKKDSDNNDLIEE
Ga0206677_1014916923300021085SeawaterMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0206682_1012874813300021185SeawaterMKVTIQKACKLRGHNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0213867_104775633300021335SeawaterMKVTIMKACKLRGNNFKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE
Ga0213862_1031985223300021347SeawaterMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPEPKKETTENEE
Ga0213858_1002207433300021356SeawaterMKVTIQKACKLRGNNWKKGATPTVTREFADELKAKGYLDAPAPKKETTENE
Ga0213859_1024300223300021364SeawaterMKVTIMKACKLRGNNFKKGDTPSVTSDFAAELKEKGFLDAPKKKTEKESIESE
Ga0213859_1036526613300021364SeawaterMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE
Ga0206123_1031853313300021365SeawaterMKVKIQKACKLHGNNWKKGDTPSVTAEFAKELKDKGYLDAPKKKTESENNDLTKE
Ga0213863_1006058423300021371SeawaterMKVTIQKACKLRGKNWKKGATPSVTSEFAAELKAKGYLDAPKKKNDSDNNDLTEE
Ga0213861_1039562413300021378SeawaterVTIQKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPEPKKETTENEE
Ga0213864_1007372333300021379SeawaterMKVTIMKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDDESIESE
Ga0213868_1023965133300021389SeawaterMKVTIQKACKLRGKNWKKGATPSVTSEFAAELKAKGYLDAPKKKNDSENNDLTEE
Ga0213868_1045737613300021389SeawaterMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNDLTEE
Ga0222718_1032166013300021958Estuarine WaterMKVTIMKACKLRGNNWKKGATPSVTPEFAAELKEKGYLDAPKKKTDESIESE
Ga0222718_1054564923300021958Estuarine WaterMKVTIQKTCKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPQPKKETTENEE
Ga0222718_1059511513300021958Estuarine WaterVTIQKACKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEEESNDITE
Ga0222715_1045025333300021960Estuarine WaterMKVTIQKACKLRGNNWKKGDQPTVTREFAAELKEKGYLDAPKAKQETKETEE
Ga0222719_1021696023300021964Estuarine WaterMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDEFNDITEE
Ga0196883_101960133300022050AqueousPMKVTIMKACKLRGNNWKKGDTPNVDNEFAAELKEKGYLDAPKKKTENESIESE
Ga0212030_105346223300022053AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKNDLENNDLTEE
Ga0212025_100760433300022057AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0224905_10123223300022058SeawaterMKACKLRGNNFKKGDTPSVTTDFAAELKEKGYLDAPKKKTEKESIESE
Ga0212029_102424013300022063AqueousMKVTIQKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPEPKKETTENEE
Ga0196895_103583123300022067AqueousMKACKLRGNNWKKGDTPSVTSEFAAELKAKGYLDAPKKKTDDESIESE
Ga0212021_100574923300022068AqueousMKVTIMKACKLRGNNWKKGDTPSVTSEFAAELKKRGYLDAPKKKTDDESIESE
Ga0212021_111913223300022068AqueousMKACKLRGNNWKKGDTPSVTSEFAAELKKRGYLDAPKKKTDDESIESE
Ga0196889_100150173300022072AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELIEE
Ga0196889_105237033300022072AqueousMKVTIQKACKLRGNNWKKGSTPSVTSDFAAELKAKGYLNAPKKKTDSDNNDLTEE
Ga0212022_103505533300022164AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNEL
Ga0196887_111717913300022178AqueousMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSD
Ga0196891_103255513300022183AqueousIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPQPKKETTENEE
Ga0196891_107714823300022183AqueousMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDESNDITKE
Ga0196899_100383553300022187AqueousMKACKLRGNNWKKGDTPNVDNEFAAELKEKGYLDAPKKKTENESIESE
Ga0196899_111671113300022187AqueousNWKKGAMPTVTKEFAAELKEKGYLDAPKKKTDDESIESE
Ga0196899_116922823300022187AqueousVMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPQPKKETTENEE
Ga0196905_104898323300022198AqueousMKVTIQKTCKLRGNNWKKGDQPTVTREFAAELKAKGYLDAPEPKKKTTENEE
Ga0196901_108982813300022200AqueousVMKVTIQKTCKLRGNNWKKGDQPTVTREFAAELKAKGYLDAPEPKKKTTENEE
Ga0196901_113908313300022200AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDS
Ga0255755_111780013300022909Salt MarshCKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEEESNDITEE
Ga0255781_1000252583300022934Salt MarshMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKETKESIESE
Ga0232123_105031913300023706Salt MarshQKACKLHGNNWKKGDTPTVTTAFAEKLKKKGYLDAPKKKTEDESNDITEE
(restricted) Ga0255039_1004807133300024062SeawaterMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLTEE
Ga0228652_102345113300024326SeawaterTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE
(restricted) Ga0255048_1018804533300024518SeawaterMKVTIQKACKLRGNNWKKGDQPTVTREFAAELKEKGYLDAPKAKEETKETEK
Ga0208013_108146313300025103MarineMKVTIQKACKLRGNNWKKGATPSVTSEFAAELKAKGYLDAPTKKKDSDNNDLIEE
Ga0209535_100237793300025120MarineMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDLDNNELTEE
Ga0208148_100783633300025508AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELI
Ga0208148_102796013300025508AqueousRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELIEE
Ga0208148_103026733300025508AqueousMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPKKKTDSDNNDLTEE
Ga0208660_105292433300025570AqueousMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNDLIEE
Ga0208149_100360963300025610AqueousMKVTIMKACKLRGNNWKKGDTPSVTSEFAAELKAKGYLDAPKKKTDDESIESE
Ga0208149_100603563300025610AqueousMKVTIMKACKLRGNNWKKGDTPNVDNEFAAELKEKGYLDAPKKKTENESIESE
Ga0208149_105380943300025610AqueousSIMKACKLRGNNFKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE
Ga0208149_108264333300025610AqueousMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPQPKKETTENEE
Ga0208004_101634053300025630AqueousMKVTIMKACKLRGNNWKKGDTPNVDKEFAAELKEKGYLDAPKKNTDESIEQE
Ga0208643_103516223300025645AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKNDSENNDLTEE
Ga0208643_104862013300025645AqueousMKVTIQKACKLRGNNWKKGATPSVTSDFAAELKAKGYLNAPTKKKDSDNNDIIE
Ga0208161_102603143300025646AqueousMKVTIQKACKLRGNNWKKGDQPTVTREFAAELKAKGYLDAPEPKKKTTENEE
Ga0208161_102940333300025646AqueousMKVTIQKACKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDESNDITEE
Ga0208161_112013313300025646AqueousMKVTIHKACKLRGNNWKKGATPTVTLEFAAELKAKGYLDAPEQKKETTENEE
Ga0208161_112384723300025646AqueousMKVTIQKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPEQKKETTENEE
Ga0208428_102525343300025653AqueousMKVTIQKACKLRGNSWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE
Ga0208428_107613713300025653AqueousLRGNNFKKGDTPSVTTDFAAELKEKGFLDAPKKKTEKESIESE
Ga0208428_115111413300025653AqueousKACKLRGNNWKKGATPTVTRDFAAELKAKGYLDAPEPKKETTENEE
Ga0208795_106113333300025655AqueousMKVTIQKACKLRGNNWKKGDQPTVTREFAAELKAKGYLDAPEPKKKTIENEE
Ga0208898_100634713300025671AqueousMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTEDESNDITEE
Ga0208898_102098043300025671AqueousMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKKTDDESIESE
Ga0208162_100724023300025674AqueousMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKNTDESIEQE
Ga0208162_109264833300025674AqueousMKVTIMKACKLRGNNWKKGATPTVTKEFAAELKEKGYLDAPKKKTDEESIESE
Ga0208162_118042023300025674AqueousMKVTIMKACKLRGNNWKKGATPSVTKEFAAELKEKGYLDAPKKKTDDESIESE
Ga0208150_111511123300025751AqueousMKVTIMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKKTDDESIESE
Ga0208899_108751333300025759AqueousMKVTIQKACKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTD
Ga0208767_101537033300025769AqueousMKVTIQKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPQPKKETTENEE
Ga0208767_101754413300025769AqueousMKACKLRGNNWKKGATPSVTSEFAAELKEKGYLDAPKKKTDDESIESE
Ga0208767_103441853300025769AqueousQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0208545_100781343300025806AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNND
Ga0208543_113047513300025810AqueousMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKT
Ga0208547_107099613300025828AqueousMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKT
Ga0208547_121276023300025828AqueousNNWKKGATPSVTSEFAAELKAKGYLDAPKKKTDDESIESE
Ga0208645_112695213300025853AqueousVTIMKACKLRGNNWKKGAMPTVTKEFAAELKEKGYLDAPKKETKESIESE
Ga0208644_108729623300025889AqueousMKVTIQKACKLHGNNWKKGDTPTVTTAFAEKLKKKGYLDAPKKKTDEESNDITEE
Ga0208644_114412843300025889AqueousYKLHGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE
Ga0208644_131569913300025889AqueousKVTIQKACKLRGNNWKKGATPTVTREFAAELKAKGYLDAPQPKKETTENEE
Ga0208971_102742333300027582MarineMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNELTEE
Ga0185543_100558663300029318MarineMKACKLRGNNFKKGDTPSVTSDFAAELKEKGFLDAPKKKTEKESIESE
Ga0315320_1090605723300031851SeawaterAGMKVTIQKACKLRGKNWKKGATPSVTSDFAAELKAKGYLDAPKKKTDSDNNDLIEE
Ga0348335_088336_862_10173300034374AqueousMKVTIMKACKLRGNNWKKGDTPNVDNEFAAELKEKGYLDAPKKKTENESIES
Ga0348335_151260_1_1593300034374AqueousTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE
Ga0348336_005651_2346_25133300034375AqueousMKVTIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITKE
Ga0348336_162809_2_1573300034375AqueousIQKACKLRGNNWKKGDTPTVTTAFAEELKKKGYLDAPKKKTDEESNDITEE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.