Basic Information | |
---|---|
Family ID | F018211 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 236 |
Average Sequence Length | 47 residues |
Representative Sequence | MLDLQVGLHVFMTVLIFGTLWRVIQYHLMASPNTGLQHVGKAMSTQY |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 236 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 88.14 % |
% of genes near scaffold ends (potentially truncated) | 14.41 % |
% of genes from short scaffolds (< 2000 bps) | 72.03 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.68 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.780 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (31.356 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.424 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.068 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.67% β-sheet: 0.00% Coil/Unstructured: 49.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 236 Family Scaffolds |
---|---|---|
PF13578 | Methyltransf_24 | 8.05 |
PF01464 | SLT | 4.66 |
PF00534 | Glycos_transf_1 | 1.27 |
PF04989 | CmcI | 1.27 |
PF00877 | NLPC_P60 | 0.85 |
PF13692 | Glyco_trans_1_4 | 0.85 |
PF05866 | RusA | 0.42 |
PF00098 | zf-CCHC | 0.42 |
PF01870 | Hjc | 0.42 |
PF00145 | DNA_methylase | 0.42 |
PF00041 | fn3 | 0.42 |
PF05050 | Methyltransf_21 | 0.42 |
PF12728 | HTH_17 | 0.42 |
PF13313 | DUF4082 | 0.42 |
PF02475 | Met_10 | 0.42 |
PF13560 | HTH_31 | 0.42 |
PF13229 | Beta_helix | 0.42 |
PF01176 | eIF-1a | 0.42 |
PF02467 | Whib | 0.42 |
PF01476 | LysM | 0.42 |
PF04724 | Glyco_transf_17 | 0.42 |
COG ID | Name | Functional Category | % Frequency in 236 Family Scaffolds |
---|---|---|---|
COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 1.27 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.42 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.42 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG2520 | tRNA G37 N-methylase Trm5 | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.78 % |
All Organisms | root | All Organisms | 43.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000651|AP72_2010_repI_A10DRAFT_1003066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2350 | Open in IMG/M |
3300000651|AP72_2010_repI_A10DRAFT_1009113 | Not Available | 1309 | Open in IMG/M |
3300003368|JGI26340J50214_10002845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 5615 | Open in IMG/M |
3300003368|JGI26340J50214_10086520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 815 | Open in IMG/M |
3300004080|Ga0062385_10198583 | Not Available | 1081 | Open in IMG/M |
3300004082|Ga0062384_100145065 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
3300004082|Ga0062384_100451867 | Not Available | 840 | Open in IMG/M |
3300004082|Ga0062384_101330382 | Not Available | 527 | Open in IMG/M |
3300004091|Ga0062387_100679637 | Not Available | 750 | Open in IMG/M |
3300004152|Ga0062386_100209613 | Not Available | 1535 | Open in IMG/M |
3300004152|Ga0062386_100519469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 968 | Open in IMG/M |
3300004152|Ga0062386_100972348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 703 | Open in IMG/M |
3300004152|Ga0062386_101488624 | Not Available | 564 | Open in IMG/M |
3300004629|Ga0008092_10719391 | Not Available | 519 | Open in IMG/M |
3300004629|Ga0008092_11209946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1418 | Open in IMG/M |
3300004629|Ga0008092_11268778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1746 | Open in IMG/M |
3300004629|Ga0008092_11309101 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300004633|Ga0066395_10143605 | Not Available | 1202 | Open in IMG/M |
3300004633|Ga0066395_10787605 | Not Available | 570 | Open in IMG/M |
3300004807|Ga0007809_10237692 | Not Available | 519 | Open in IMG/M |
3300005363|Ga0008090_10158101 | Not Available | 1292 | Open in IMG/M |
3300005363|Ga0008090_14561562 | Not Available | 911 | Open in IMG/M |
3300005363|Ga0008090_15571275 | Not Available | 541 | Open in IMG/M |
3300005437|Ga0070710_10313730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1027 | Open in IMG/M |
3300005468|Ga0070707_100015758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 7095 | Open in IMG/M |
3300005534|Ga0070735_10254181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1065 | Open in IMG/M |
3300005537|Ga0070730_10128382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1734 | Open in IMG/M |
3300005537|Ga0070730_10709145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 637 | Open in IMG/M |
3300005577|Ga0068857_100003520 | Not Available | 13087 | Open in IMG/M |
3300005610|Ga0070763_11001126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300005614|Ga0068856_102263215 | Not Available | 552 | Open in IMG/M |
3300005764|Ga0066903_100587770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1924 | Open in IMG/M |
3300005764|Ga0066903_101612653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1231 | Open in IMG/M |
3300005764|Ga0066903_102309473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1039 | Open in IMG/M |
3300005764|Ga0066903_105423989 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006176|Ga0070765_101730425 | Not Available | 587 | Open in IMG/M |
3300006805|Ga0075464_10673151 | Not Available | 639 | Open in IMG/M |
3300007265|Ga0099794_10002822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6502 | Open in IMG/M |
3300009088|Ga0099830_10055440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2812 | Open in IMG/M |
3300009088|Ga0099830_11863322 | Not Available | 503 | Open in IMG/M |
3300009090|Ga0099827_10195505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1680 | Open in IMG/M |
3300009090|Ga0099827_11528439 | Not Available | 581 | Open in IMG/M |
3300009792|Ga0126374_10357480 | Not Available | 1004 | Open in IMG/M |
3300010043|Ga0126380_10032536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 2651 | Open in IMG/M |
3300010043|Ga0126380_10229410 | Not Available | 1268 | Open in IMG/M |
3300010043|Ga0126380_11233645 | Not Available | 647 | Open in IMG/M |
3300010043|Ga0126380_12051394 | Not Available | 525 | Open in IMG/M |
3300010048|Ga0126373_10001590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 16238 | Open in IMG/M |
3300010048|Ga0126373_10002043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14724 | Open in IMG/M |
3300010048|Ga0126373_10002342 | All Organisms → cellular organisms → Bacteria | 13963 | Open in IMG/M |
3300010048|Ga0126373_10005769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 9638 | Open in IMG/M |
3300010048|Ga0126373_10028958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 4772 | Open in IMG/M |
3300010048|Ga0126373_10058622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 3446 | Open in IMG/M |
3300010048|Ga0126373_10116901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2489 | Open in IMG/M |
3300010048|Ga0126373_10139325 | Not Available | 2293 | Open in IMG/M |
3300010048|Ga0126373_10267516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1690 | Open in IMG/M |
3300010048|Ga0126373_10289627 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
3300010048|Ga0126373_10377566 | Not Available | 1437 | Open in IMG/M |
3300010048|Ga0126373_10572879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1179 | Open in IMG/M |
3300010048|Ga0126373_10601302 | Not Available | 1152 | Open in IMG/M |
3300010048|Ga0126373_10756879 | Not Available | 1032 | Open in IMG/M |
3300010048|Ga0126373_10815064 | Not Available | 996 | Open in IMG/M |
3300010048|Ga0126373_11105747 | Not Available | 858 | Open in IMG/M |
3300010048|Ga0126373_11272635 | Not Available | 801 | Open in IMG/M |
3300010048|Ga0126373_11298654 | Not Available | 794 | Open in IMG/M |
3300010048|Ga0126373_11323404 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300010048|Ga0126373_11353618 | Not Available | 778 | Open in IMG/M |
3300010048|Ga0126373_11459175 | Not Available | 749 | Open in IMG/M |
3300010048|Ga0126373_11643923 | Not Available | 707 | Open in IMG/M |
3300010048|Ga0126373_11825270 | Not Available | 671 | Open in IMG/M |
3300010048|Ga0126373_12566967 | Not Available | 568 | Open in IMG/M |
3300010048|Ga0126373_12629995 | Not Available | 561 | Open in IMG/M |
3300010152|Ga0126318_10585881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1001 | Open in IMG/M |
3300010152|Ga0126318_10644938 | Not Available | 597 | Open in IMG/M |
3300010339|Ga0074046_10316603 | Not Available | 956 | Open in IMG/M |
3300010341|Ga0074045_11077360 | Not Available | 502 | Open in IMG/M |
3300010343|Ga0074044_10281218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1096 | Open in IMG/M |
3300010358|Ga0126370_11511391 | Not Available | 639 | Open in IMG/M |
3300010359|Ga0126376_10001443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 12833 | Open in IMG/M |
3300010360|Ga0126372_10281532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1448 | Open in IMG/M |
3300010360|Ga0126372_11757584 | Not Available | 662 | Open in IMG/M |
3300010360|Ga0126372_12133863 | Not Available | 609 | Open in IMG/M |
3300010361|Ga0126378_10013942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 6701 | Open in IMG/M |
3300010361|Ga0126378_10018232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5982 | Open in IMG/M |
3300010361|Ga0126378_10116955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2662 | Open in IMG/M |
3300010361|Ga0126378_10182389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2165 | Open in IMG/M |
3300010361|Ga0126378_10299049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1712 | Open in IMG/M |
3300010361|Ga0126378_10621979 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
3300010361|Ga0126378_10777864 | Not Available | 1067 | Open in IMG/M |
3300010361|Ga0126378_10865379 | Not Available | 1011 | Open in IMG/M |
3300010361|Ga0126378_11111413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 891 | Open in IMG/M |
3300010361|Ga0126378_13193187 | Not Available | 521 | Open in IMG/M |
3300010366|Ga0126379_13453388 | Not Available | 529 | Open in IMG/M |
3300010371|Ga0134125_10033622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 5714 | Open in IMG/M |
3300010376|Ga0126381_100001994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 21995 | Open in IMG/M |
3300010376|Ga0126381_100005590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 13854 | Open in IMG/M |
3300010376|Ga0126381_100011205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 10129 | Open in IMG/M |
3300010376|Ga0126381_100034909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 6037 | Open in IMG/M |
3300010376|Ga0126381_100528826 | Not Available | 1668 | Open in IMG/M |
3300010376|Ga0126381_100656206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1497 | Open in IMG/M |
3300010376|Ga0126381_100761396 | Not Available | 1388 | Open in IMG/M |
3300010376|Ga0126381_101037949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1183 | Open in IMG/M |
3300010376|Ga0126381_103898181 | Not Available | 582 | Open in IMG/M |
3300010376|Ga0126381_104327449 | Not Available | 550 | Open in IMG/M |
3300010396|Ga0134126_10180242 | Not Available | 2541 | Open in IMG/M |
3300010396|Ga0134126_11010883 | Not Available | 931 | Open in IMG/M |
3300010396|Ga0134126_11840218 | Not Available | 663 | Open in IMG/M |
3300010396|Ga0134126_12551930 | Not Available | 555 | Open in IMG/M |
3300010398|Ga0126383_10000422 | All Organisms → cellular organisms → Bacteria | 23129 | Open in IMG/M |
3300010398|Ga0126383_10000490 | All Organisms → cellular organisms → Bacteria | 22156 | Open in IMG/M |
3300010398|Ga0126383_11586259 | Not Available | 744 | Open in IMG/M |
3300010398|Ga0126383_12149729 | Not Available | 645 | Open in IMG/M |
3300011269|Ga0137392_10196208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1649 | Open in IMG/M |
3300011269|Ga0137392_10224263 | Not Available | 1543 | Open in IMG/M |
3300011271|Ga0137393_10522917 | Not Available | 1018 | Open in IMG/M |
3300012096|Ga0137389_10021041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 4585 | Open in IMG/M |
3300012362|Ga0137361_10129726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2231 | Open in IMG/M |
3300012924|Ga0137413_10000116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 20766 | Open in IMG/M |
3300012971|Ga0126369_10000777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 21422 | Open in IMG/M |
3300014203|Ga0172378_10024415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 5392 | Open in IMG/M |
3300014205|Ga0172380_10003772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 20315 | Open in IMG/M |
3300014498|Ga0182019_10014516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 4208 | Open in IMG/M |
3300016357|Ga0182032_11418079 | Not Available | 602 | Open in IMG/M |
3300017822|Ga0187802_10291061 | Not Available | 636 | Open in IMG/M |
3300017926|Ga0187807_1341082 | Not Available | 503 | Open in IMG/M |
3300017943|Ga0187819_10264589 | Not Available | 1004 | Open in IMG/M |
3300017959|Ga0187779_10910961 | Not Available | 606 | Open in IMG/M |
3300017966|Ga0187776_10032219 | All Organisms → cellular organisms → Bacteria | 2920 | Open in IMG/M |
3300017966|Ga0187776_10344924 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300017970|Ga0187783_10047185 | Not Available | 3182 | Open in IMG/M |
3300017970|Ga0187783_10081289 | Not Available | 2388 | Open in IMG/M |
3300017970|Ga0187783_10464542 | Not Available | 918 | Open in IMG/M |
3300017970|Ga0187783_11150532 | Not Available | 559 | Open in IMG/M |
3300017973|Ga0187780_11121951 | Not Available | 575 | Open in IMG/M |
3300018007|Ga0187805_10458622 | Not Available | 595 | Open in IMG/M |
3300018060|Ga0187765_10467750 | Not Available | 792 | Open in IMG/M |
3300018085|Ga0187772_10986698 | Not Available | 615 | Open in IMG/M |
3300018086|Ga0187769_10118375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1917 | Open in IMG/M |
3300020579|Ga0210407_10696902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 788 | Open in IMG/M |
3300020582|Ga0210395_11399708 | Not Available | 510 | Open in IMG/M |
3300020583|Ga0210401_11414068 | Not Available | 553 | Open in IMG/M |
3300021086|Ga0179596_10000382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 13586 | Open in IMG/M |
3300021086|Ga0179596_10063524 | Not Available | 1577 | Open in IMG/M |
3300021088|Ga0210404_10001948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 8602 | Open in IMG/M |
3300021178|Ga0210408_10125723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2024 | Open in IMG/M |
3300021180|Ga0210396_10786833 | Not Available | 817 | Open in IMG/M |
3300021180|Ga0210396_10939826 | Not Available | 735 | Open in IMG/M |
3300021405|Ga0210387_11089881 | Not Available | 697 | Open in IMG/M |
3300021407|Ga0210383_10492472 | Not Available | 1058 | Open in IMG/M |
3300021420|Ga0210394_10016962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 6863 | Open in IMG/M |
3300021474|Ga0210390_10724101 | Not Available | 828 | Open in IMG/M |
3300021476|Ga0187846_10413307 | Not Available | 554 | Open in IMG/M |
3300021478|Ga0210402_10010177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus carbonis | 8129 | Open in IMG/M |
3300021479|Ga0210410_11209858 | Not Available | 647 | Open in IMG/M |
3300021560|Ga0126371_10018977 | Not Available | 6326 | Open in IMG/M |
3300021560|Ga0126371_10200095 | Not Available | 2092 | Open in IMG/M |
3300021560|Ga0126371_10371030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1569 | Open in IMG/M |
3300021560|Ga0126371_10386022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 1540 | Open in IMG/M |
3300021560|Ga0126371_10610431 | Not Available | 1240 | Open in IMG/M |
3300021560|Ga0126371_10650388 | Not Available | 1203 | Open in IMG/M |
3300021560|Ga0126371_10768051 | Not Available | 1111 | Open in IMG/M |
3300021560|Ga0126371_10893722 | Not Available | 1032 | Open in IMG/M |
3300021560|Ga0126371_10939531 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
3300021560|Ga0126371_11911219 | Not Available | 713 | Open in IMG/M |
3300021560|Ga0126371_12288585 | Not Available | 653 | Open in IMG/M |
3300021560|Ga0126371_13102065 | Not Available | 562 | Open in IMG/M |
3300021560|Ga0126371_13177047 | Not Available | 556 | Open in IMG/M |
3300024310|Ga0247681_1000134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 7141 | Open in IMG/M |
3300025922|Ga0207646_10002377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 22224 | Open in IMG/M |
3300026116|Ga0207674_10007057 | Not Available | 13132 | Open in IMG/M |
3300026304|Ga0209240_1000369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 18850 | Open in IMG/M |
3300026374|Ga0257146_1034953 | Not Available | 815 | Open in IMG/M |
3300026469|Ga0257169_1073766 | Not Available | 553 | Open in IMG/M |
3300026508|Ga0257161_1000494 | Not Available | 9574 | Open in IMG/M |
3300027671|Ga0209588_1006258 | All Organisms → Viruses → Predicted Viral | 3451 | Open in IMG/M |
3300027729|Ga0209248_10212976 | Not Available | 568 | Open in IMG/M |
3300027768|Ga0209772_10075994 | Not Available | 1016 | Open in IMG/M |
3300027812|Ga0209656_10000724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 21456 | Open in IMG/M |
3300027812|Ga0209656_10012628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 5292 | Open in IMG/M |
3300027812|Ga0209656_10265533 | Not Available | 805 | Open in IMG/M |
3300027824|Ga0209040_10050741 | Not Available | 2502 | Open in IMG/M |
3300027824|Ga0209040_10227871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 948 | Open in IMG/M |
3300027824|Ga0209040_10430408 | Not Available | 606 | Open in IMG/M |
3300027857|Ga0209166_10080657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1839 | Open in IMG/M |
3300027862|Ga0209701_10007775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6992 | Open in IMG/M |
3300027869|Ga0209579_10570499 | Not Available | 614 | Open in IMG/M |
3300027908|Ga0209006_10302243 | Not Available | 1365 | Open in IMG/M |
3300028601|Ga0265295_1082620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1694 | Open in IMG/M |
3300028601|Ga0265295_1350888 | Not Available | 506 | Open in IMG/M |
3300028906|Ga0308309_11413657 | Not Available | 596 | Open in IMG/M |
3300030511|Ga0268241_10033990 | Not Available | 1047 | Open in IMG/M |
3300031057|Ga0170834_104701695 | Not Available | 597 | Open in IMG/M |
3300031543|Ga0318516_10007465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 5114 | Open in IMG/M |
3300031543|Ga0318516_10213341 | Not Available | 1116 | Open in IMG/M |
3300031544|Ga0318534_10058040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2177 | Open in IMG/M |
3300031544|Ga0318534_10068579 | Not Available | 2005 | Open in IMG/M |
3300031564|Ga0318573_10039967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2243 | Open in IMG/M |
3300031708|Ga0310686_112677505 | Not Available | 2124 | Open in IMG/M |
3300031708|Ga0310686_116992267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
3300031719|Ga0306917_11138583 | Not Available | 607 | Open in IMG/M |
3300031720|Ga0307469_11859330 | Not Available | 583 | Open in IMG/M |
3300031724|Ga0318500_10028149 | Not Available | 2224 | Open in IMG/M |
3300031747|Ga0318502_10453687 | Not Available | 766 | Open in IMG/M |
3300031754|Ga0307475_10367687 | Not Available | 1156 | Open in IMG/M |
3300031763|Ga0318537_10054859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1450 | Open in IMG/M |
3300031779|Ga0318566_10222802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 936 | Open in IMG/M |
3300031781|Ga0318547_10398439 | Not Available | 844 | Open in IMG/M |
3300031792|Ga0318529_10449751 | Not Available | 599 | Open in IMG/M |
3300031795|Ga0318557_10064341 | Not Available | 1572 | Open in IMG/M |
3300031799|Ga0318565_10571395 | Not Available | 544 | Open in IMG/M |
3300031831|Ga0318564_10183166 | Not Available | 933 | Open in IMG/M |
3300031912|Ga0306921_10577474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1302 | Open in IMG/M |
3300031941|Ga0310912_10643267 | Not Available | 824 | Open in IMG/M |
3300031947|Ga0310909_10811796 | Not Available | 772 | Open in IMG/M |
3300031959|Ga0318530_10376709 | Not Available | 588 | Open in IMG/M |
3300031962|Ga0307479_10936635 | Not Available | 837 | Open in IMG/M |
3300032001|Ga0306922_10062561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 3875 | Open in IMG/M |
3300032008|Ga0318562_10427214 | Not Available | 770 | Open in IMG/M |
3300032035|Ga0310911_10333788 | Not Available | 874 | Open in IMG/M |
3300032090|Ga0318518_10647929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 538 | Open in IMG/M |
3300032562|Ga0316226_1398224 | Not Available | 502 | Open in IMG/M |
3300032770|Ga0335085_10472526 | Not Available | 1437 | Open in IMG/M |
3300032782|Ga0335082_10558483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1006 | Open in IMG/M |
3300032805|Ga0335078_10007405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 16285 | Open in IMG/M |
3300032893|Ga0335069_10492988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1422 | Open in IMG/M |
3300032895|Ga0335074_10070742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 4714 | Open in IMG/M |
3300032895|Ga0335074_10326940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 1728 | Open in IMG/M |
3300032895|Ga0335074_10498569 | Not Available | 1265 | Open in IMG/M |
3300032895|Ga0335074_10808986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 873 | Open in IMG/M |
3300032895|Ga0335074_11438041 | Not Available | 555 | Open in IMG/M |
3300032896|Ga0335075_10014022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 12060 | Open in IMG/M |
3300032896|Ga0335075_11486574 | Not Available | 565 | Open in IMG/M |
3300033134|Ga0335073_11449801 | Not Available | 666 | Open in IMG/M |
3300033289|Ga0310914_11178804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 668 | Open in IMG/M |
3300033290|Ga0318519_10038927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis alkalitolerans | 2306 | Open in IMG/M |
3300033827|Ga0334848_103355 | Not Available | 504 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 31.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.53% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 8.05% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.08% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.66% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 2.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.54% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.12% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.69% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.27% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.27% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.27% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.27% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.27% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.42% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.42% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.42% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.42% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.42% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028601 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Methane capture system biofilm | Engineered | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033827 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A10DRAFT_10030666 | 3300000651 | Forest Soil | MLDLQVGLHVFMSVLILGTIWRLISFHLAASSNTGISHVGRAMAVQY* |
AP72_2010_repI_A10DRAFT_10091132 | 3300000651 | Forest Soil | VLDLQVGLHVFLSVLILGTIWRVVQYHLMASSNTGLQHVGKAMSTQF* |
JGI26340J50214_100028459 | 3300003368 | Bog Forest Soil | MIDAQVALHVFMIVLIVGTLWRILQVHAMASPSPWLXHLGMAMSIQY* |
JGI26340J50214_100865201 | 3300003368 | Bog Forest Soil | MNDLLTGLGIFATVLVFGTLFRISQFHLMASPNPSLQHLGKAMSIQY* |
Ga0062385_101985832 | 3300004080 | Bog Forest Soil | MIDAQVALHVFMIVLVVGTLWRLLQFHAMASPSPWLSHLGMAMSIQY* |
Ga0062384_1001450652 | 3300004082 | Bog Forest Soil | MIDAQVALHVFMIVLIVGTLWRIFQVHAMAAGSPWLQHLGMAMSVQY* |
Ga0062384_1004518673 | 3300004082 | Bog Forest Soil | VNDLLTGLGIFATVLVFGTLFRVSQFHLMASPNPSLQHLGKAMSIQY* |
Ga0062384_1013303821 | 3300004082 | Bog Forest Soil | MIDAQVALHVFMIVLVMGTLWRLLQFHAMASPSPWLHNLGMAMSTQY* |
Ga0062387_1006796372 | 3300004091 | Bog Forest Soil | MLDLQVSLHVFMSVLILGTIFRLVSYHLMASSNPGVQHIGKAMSTQY* |
Ga0062386_1002096133 | 3300004152 | Bog Forest Soil | VIDIQVGLHVFFIVLIMGTLWRIASFHLMASPNTALQHAGKAMSIQY* |
Ga0062386_1005194692 | 3300004152 | Bog Forest Soil | VIDLQVALHVFMSVLILGTVFRLVQYHLMASPNPGLQHVGKAMSTQY* |
Ga0062386_1009723481 | 3300004152 | Bog Forest Soil | HVFMIVLIVGTLWRILQVHAMASPSPWLSHLGMAMSIQY* |
Ga0062386_1014886242 | 3300004152 | Bog Forest Soil | MIDAQVGLHVFMIVLIFGTLWRLLQFHAMASPSPWLSHLGMAMSLQY* |
Ga0008092_107193911 | 3300004629 | Tropical Rainforest Soil | KASAPMIDLQVGLHVFMIILIFGTVWRVSQFHLMASANPALQHLGKAMSIQY* |
Ga0008092_112099461 | 3300004629 | Tropical Rainforest Soil | QVGLHVFLSVLILGTIWRVVQYHLMASSNSGLQHVGKAMSTQY* |
Ga0008092_112687781 | 3300004629 | Tropical Rainforest Soil | QVGLHVFLSVLILGTIWRVVQYHLMASSNTGLQHVGKAMSTQY* |
Ga0008092_113091012 | 3300004629 | Tropical Rainforest Soil | MLDLQVGLHVFMSVLILGTIFRIVSYHLMASPNAGIQHIGKAMSTQY* |
Ga0066395_101436052 | 3300004633 | Tropical Forest Soil | MIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNPGIQHIGKAMSTQY* |
Ga0066395_107876052 | 3300004633 | Tropical Forest Soil | VIDARTSLYIFLAVLILGTLWRVSQFHLMASPNPSLQHLGKAMSVQY* |
Ga0007809_102376922 | 3300004807 | Freshwater | VIDLQVGLHVFLIVLVFGTLWRISQFHLMASPNPSLQHLGKAMSTQY* |
Ga0008090_101581013 | 3300005363 | Tropical Rainforest Soil | MFVDLQVALHVFMSVLIMGTIWRVLQYHLMASPNAHAQHVGKAMATQY* |
Ga0008090_145615622 | 3300005363 | Tropical Rainforest Soil | MLDLQVALHVFMSVLILGTIFRLVQYHLMASSNTGLQHVGKAMSTQY* |
Ga0008090_155712751 | 3300005363 | Tropical Rainforest Soil | VTEAKIGLHVFMIVLVFGTLWRLLSFHAIASPNQAVSHLGRAMSLQY* |
Ga0070710_103137301 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PSYSRRTPVLDLQVSLHVFLSVLILGTLWRVIQYHLMASSNSGLSHVGKAMSTQY* |
Ga0070707_1000157586 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEWIDVQVGLHVFMIVLVFGTVWRVSQYHLMASPNAHLQHLGMAMSTQY* |
Ga0070735_102541811 | 3300005534 | Surface Soil | MLDLQVSLHVFMSVLILGTIFRLISYHLMASSNPGVQHIGKAMSTQY* |
Ga0070730_101283822 | 3300005537 | Surface Soil | MWIDVQVGLHVFMIVLVFGTIWRVSQYHLMASPNAHLQHIGMAMATQY* |
Ga0070730_107091451 | 3300005537 | Surface Soil | VIDVQVGLHVFMIVLVFGTLWRLLSFHAMASPNVHLQHIGMAMSV |
Ga0068857_10000352028 | 3300005577 | Corn Rhizosphere | VLDLQVSLHVFLSVLILGTLWRVIQYHLMASSNSGLSHIGKAMSTQY* |
Ga0070763_110011261 | 3300005610 | Soil | MSDWIDLQVGLHVFMLVLVFGTLWRVGQYHLMAHPSVHLQHLGMAMATQY* |
Ga0068856_1022632152 | 3300005614 | Corn Rhizosphere | MIDLQVGLHVFMVVLVFGTLFRLLEFHAMASPNSGLQHLGRAMAIQY* |
Ga0066903_1005877704 | 3300005764 | Tropical Forest Soil | MLDLQVGIHVFMTVLVLGTLWRVTQYHLMASPNPGIQHIGKAMSTQY* |
Ga0066903_1016126532 | 3300005764 | Tropical Forest Soil | HVFMSVLILGTIFRIVSFHLMASPNQGVQHIGKAMSTQY* |
Ga0066903_1023094732 | 3300005764 | Tropical Forest Soil | VIDLGVGVHVFLIVLVLGTLWRISQFHLMASANPSLQHLGKAMSTQY* |
Ga0066903_1054239892 | 3300005764 | Tropical Forest Soil | VIDARTSLYIFLAVLILGTLWRVSQFHLMASPNPSLQHLGKAMSVQF* |
Ga0070765_1017304251 | 3300006176 | Soil | RDLSAPGTKGQFMLDLQVSLHVFMSVLILGTIFRLVSYHLMASSNPGVQHIGKAMSTQY* |
Ga0075464_106731512 | 3300006805 | Aqueous | MLDLQVGLHVFLSVLILGTIWRVIQYHLMASGNTGLQHVGKAMSTQY* |
Ga0099794_100028228 | 3300007265 | Vadose Zone Soil | LLDLQVGLHVFLSVLILGTIWRVVQYHFMASSNPGIQHVGKAMSTQY* |
Ga0099830_100554406 | 3300009088 | Vadose Zone Soil | MLDLQVGLHVFLSVLILGTIWRVVQYHFMASSNPGIQHVGKAMSTQY* |
Ga0099830_118633222 | 3300009088 | Vadose Zone Soil | MVDAQVGLHVFMIVLIFGTLWRVLQYHAMASPSPWLGHLGAAMSTQY* |
Ga0099827_101955051 | 3300009090 | Vadose Zone Soil | MLDLQVGLHVFLSVLILGTIWRVTQYHFMASSNPGIQHVGKAMSTQY* |
Ga0099827_115284392 | 3300009090 | Vadose Zone Soil | MVDAQVGLHVFMIVLIFGTLWRVLQYHAMASPSPWLSHLGAAMSTQY* |
Ga0126374_103574802 | 3300009792 | Tropical Forest Soil | MFVDLQVALHVFMSVLIMGTIWRILQYHMMASPNAQVQHVGKAMSTQY* |
Ga0126380_100325362 | 3300010043 | Tropical Forest Soil | MLDLQVGLHVFMSVLILGTIFRIVSYHLMASPNTGVQHIGKAMTIQY* |
Ga0126380_102294102 | 3300010043 | Tropical Forest Soil | MIDVQVGLHVFLVVLIFGTLWRLLSFHAMASDNPAIQHAGKAMAVQY* |
Ga0126380_112336452 | 3300010043 | Tropical Forest Soil | VIDLGVGAHVFLIVLVFGTLWRVSQFHLMASPNPSLQHLGKAMSTQY* |
Ga0126380_120513942 | 3300010043 | Tropical Forest Soil | MLDLQVGLHVFLSVLILGTIWRVVQYHLMASSNTGLQHVGKAMSTQY* |
Ga0126373_1000159019 | 3300010048 | Tropical Forest Soil | VIDVQVGLHVFLIVLIFGTLWRVSQFHLMASPNPSLQHLGKAMSTQY* |
Ga0126373_1000204332 | 3300010048 | Tropical Forest Soil | MLDLQVGIHVFMTVLVLGTLWRVIQYHLMASPNPGIQHIGKAMSTQY* |
Ga0126373_100023422 | 3300010048 | Tropical Forest Soil | VDDIKIGLHVFLIVVVFGTLWRVSQFHLMASPNPSLQHLGKAMSIQY* |
Ga0126373_1000576921 | 3300010048 | Tropical Forest Soil | MNEWIDLQMGLHVFMLVLVFGTIWRVLQYHAMAHPSPHLQHLGMAMSTQY* |
Ga0126373_100289589 | 3300010048 | Tropical Forest Soil | MWVDLQVALHVFMSVLVMGTIWRILQYHLMASPNVHAQHVGKAMSTQY* |
Ga0126373_100586227 | 3300010048 | Tropical Forest Soil | MIDLQISLHVFMGVLILGTIFRLVSYHLMASPNPGVQHIGKAMSTQY* |
Ga0126373_101169013 | 3300010048 | Tropical Forest Soil | MIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNTGIQHIGKAMSTQY* |
Ga0126373_101393254 | 3300010048 | Tropical Forest Soil | VLDLQVGLHVFMTVLIFGTLWRVIQYHLMASPNAGLQHVGKAMSTQY* |
Ga0126373_102675162 | 3300010048 | Tropical Forest Soil | MIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNTGIEHIGKAMSTQY* |
Ga0126373_102896273 | 3300010048 | Tropical Forest Soil | MLDLKIGIHVFFTVLVLGTIWRVLQYHLMASPNPGIQHIGKAMSTQY* |
Ga0126373_103775663 | 3300010048 | Tropical Forest Soil | VIELKVGLHVFFIVLVFGTLWRVSQFHLMASPNPSLQHLGKAMSTQY* |
Ga0126373_105728792 | 3300010048 | Tropical Forest Soil | MPIDLQVALHVFMSVLILGTLFRLVSYHLMASDNPGIQHVGKAMSTQY* |
Ga0126373_106013022 | 3300010048 | Tropical Forest Soil | MLDLQVGLHVFMTVLIFGTLWRVIQYHLMASPNTGLQHVGKAMSTQY* |
Ga0126373_107568791 | 3300010048 | Tropical Forest Soil | MFVDLQVALHVFMSVLIMGTIWRILQYHMMASPNAHVQHVGKAMSTQY* |
Ga0126373_108150643 | 3300010048 | Tropical Forest Soil | MLDLKIGIHVFFTVLVLGTIWRVLQYHLMASPNPGVQHIGKAMSTQY* |
Ga0126373_111057472 | 3300010048 | Tropical Forest Soil | VNDLLAGLGIFATVLVFGTLFRISQFHLMASPNPSLQHLGKAMSIQY* |
Ga0126373_112726352 | 3300010048 | Tropical Forest Soil | VIDLQVGAHVFMIILIFGTMWRLLQFHFMASPNTALQHLGKAMSIQY* |
Ga0126373_112986542 | 3300010048 | Tropical Forest Soil | MLDLQVGVHVFVTVLILGTIWRILQYHLMASPNPGIQHIGKAMSVQY* |
Ga0126373_113234042 | 3300010048 | Tropical Forest Soil | VLDLQVALHVFMSVLILGTVFRLVQYHLMASSNTGLQHIGKAMSTQY* |
Ga0126373_113536182 | 3300010048 | Tropical Forest Soil | WPGPPHLDGGIPVLDLQVGLHVFMTVLIFGTLWRVIQYHLMASPNTGLQHVGKAMSTQY* |
Ga0126373_114591752 | 3300010048 | Tropical Forest Soil | VIDTQVGLHVFMIVLIFGTLWRLSQFHLMASPNPSLQHLGKAMSVQY* |
Ga0126373_116439232 | 3300010048 | Tropical Forest Soil | MWIDVQVGLHVFMIVLVFGTVWRLLQYHFIASPNVHLQHVGMAMSTQY* |
Ga0126373_118252702 | 3300010048 | Tropical Forest Soil | LHVFMSVLILGTIFRIVSYHLMASPNTGIQHIGKAMSTQY* |
Ga0126373_125669672 | 3300010048 | Tropical Forest Soil | VIDFQVGLHVFLIVLVLGTLWRVSQFHLMASPNPSLQHLGKAMSVQY* |
Ga0126373_126299951 | 3300010048 | Tropical Forest Soil | QVALHVFMSVLIMGTIWRILQYHMMASPNAHVQHVGKAMSTQY* |
Ga0126318_105858812 | 3300010152 | Soil | VIDLQVGLHVFMSVLILGTIWRLVSFHLAASDNPGVNHVGRAMGIQY* |
Ga0126318_106449382 | 3300010152 | Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHLMASPNSGLQHVGKAMSTQY* |
Ga0074046_103166033 | 3300010339 | Bog Forest Soil | MIDAQVALHVFMIVLIVGTLWRILQVHAMASPSPWLSHLGMAMSIQY* |
Ga0074045_110773602 | 3300010341 | Bog Forest Soil | VIDLQVALHVFMSVLILGTIWRVLQYHLMASSNPGVQHVGKAMSTQY* |
Ga0074044_102812182 | 3300010343 | Bog Forest Soil | SGCLDTGTKGQSMLDLQVSLHVFMSVLILGTIFRLISYHLMASSNPGVQHIGKAMSTQY* |
Ga0126370_115113912 | 3300010358 | Tropical Forest Soil | LTEIKVGLHVFFIVLVFGTIWRVSQFHLMASGNPMWQHLGKAMSVQY* |
Ga0126376_1000144310 | 3300010359 | Tropical Forest Soil | VIDLKVGAHVFLIVLIFGTLWRVSQFHLMASPNPSLQHLGKAMSVQF* |
Ga0126372_102815322 | 3300010360 | Tropical Forest Soil | VLDLQVGLHVFMTVLILGTIFRLVSYHLMASDNPGLQHVGKAMSTQY* |
Ga0126372_117575842 | 3300010360 | Tropical Forest Soil | VIDLQVGLHVFMIVLVFGTLWRVSQFHLMASPNPSLQHLGKAMSIQY* |
Ga0126372_121338631 | 3300010360 | Tropical Forest Soil | HVIDIRTSAYIFLAVLIFGTLWRVSQFHAMASPNPSIQHLGKAMSVQY* |
Ga0126378_100139428 | 3300010361 | Tropical Forest Soil | MWIDVQVGLHVFMIVLVFGTVWRVGQYHLMAHPNPHLQHLGMAMATQY* |
Ga0126378_1001823214 | 3300010361 | Tropical Forest Soil | MSKWIDVQVGLHVFMIVLVFGTIWRVGQYHLMASPNPHLQHLGMAMSTQY* |
Ga0126378_101169558 | 3300010361 | Tropical Forest Soil | VIDLQVGLHVFFIVLVLGTLWRVSQFHLMASPNPSLQHLGKAMSVQY* |
Ga0126378_101823893 | 3300010361 | Tropical Forest Soil | MLDLQVGLHVFMSVLILGTIFRIVSFHLMASPNQGVQHIGKAMSTQY* |
Ga0126378_102990491 | 3300010361 | Tropical Forest Soil | GKPTEGRAPMIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNPGIQHIGKAMSTQY* |
Ga0126378_106219792 | 3300010361 | Tropical Forest Soil | VWIDFGVALHVFMSVLVMGTLWRVIQYHLMASPNAHAQHVGKAMSTQY* |
Ga0126378_107778641 | 3300010361 | Tropical Forest Soil | MIDLQVGLHVFMSVLILGTIFRVVSYHLMASPNPGIQHIGKAMSTQY* |
Ga0126378_108653792 | 3300010361 | Tropical Forest Soil | MIDMQVGLHVFMIVLVFGTLWRVSQFHLMASANPSLQHLGKAMSIQY* |
Ga0126378_111114132 | 3300010361 | Tropical Forest Soil | MIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNAGIQHIGKAMSTQY* |
Ga0126378_131931871 | 3300010361 | Tropical Forest Soil | MLDLEVGLHVFMTVLVLGTLWRVLQYHLMASPNPGIQHIGKAMSTQY* |
Ga0126379_134533881 | 3300010366 | Tropical Forest Soil | VFVDLQVALHVFMSVLIMGTIWRILQYHMMASPNAHVQHVGKAMSTQY* |
Ga0134125_100336227 | 3300010371 | Terrestrial Soil | MLDLQVGLHVFLTVLILGTLWRLLQYHLMASPNVHLQHVGMAMSQQY* |
Ga0126381_10000199430 | 3300010376 | Tropical Forest Soil | MIDVQVGLHVFLIVLVFGTLWRLLSFHAMASSNPAVQHAGKAMSIQY* |
Ga0126381_10000559016 | 3300010376 | Tropical Forest Soil | MIDAQVGLHVFMIVLIFGTLWRVLQYHAMASPSPWLSHLGQAMSTQY* |
Ga0126381_1000112052 | 3300010376 | Tropical Forest Soil | VIDIQVGLHVFLIVLVFGTMWRLLSFHAMASSNTAVQHAGKAMSIQY* |
Ga0126381_10003490912 | 3300010376 | Tropical Forest Soil | LIDIQVGLHVFMIVLIFGTLWRISQFHLMASPNPSLQHLGKAMSIQY* |
Ga0126381_1005288262 | 3300010376 | Tropical Forest Soil | MLDMKIGLHVFAVILIFGTLWRVSQFHLMASANPALQHLGKAMSIQY* |
Ga0126381_1006562063 | 3300010376 | Tropical Forest Soil | VIELKIGLHVFFMVLVFGTLWRVSQFHLMASPNPSLQHLGKAMSTQY* |
Ga0126381_1007613962 | 3300010376 | Tropical Forest Soil | MLDLQVGLHVFVTVLILGTIWRILQYHLMASPNPGIQHIGKAMSVQY* |
Ga0126381_1010379492 | 3300010376 | Tropical Forest Soil | VIDVQVGLHVFMVVLVFGTLFRLLSFHAMASPNVHLQHLGMAMAVQY* |
Ga0126381_1038981812 | 3300010376 | Tropical Forest Soil | MFVDLQVALHVFMSVLIMGTIWRILQYHFMASPSAGVQHLGKAMSTQY* |
Ga0126381_1043274492 | 3300010376 | Tropical Forest Soil | MFVDLQVALHVFMSVLIMGTVWRILQYHLMASPNASAQHLGKAMSTQY* |
Ga0134126_101802422 | 3300010396 | Terrestrial Soil | MIDLQVGTHVFLVVLIFGTLWRLLSFHAMASANPAISHAGKAMSIQY* |
Ga0134126_110108832 | 3300010396 | Terrestrial Soil | VIDIQIALHVFMAVLVIGTVFRLLSYHAMASPNAHLQHLGMAMSTQY* |
Ga0134126_118402182 | 3300010396 | Terrestrial Soil | MLDLQVALHVFLSVLILGTLWRVAQYHLMASSNPGIQHVGKAMSTQY* |
Ga0134126_125519302 | 3300010396 | Terrestrial Soil | LIDVQVGLHVFMIVLIFGTLWRLLSFHAMASPNVHLQHVGMAMTTQY* |
Ga0126383_1000042228 | 3300010398 | Tropical Forest Soil | MLDLQVGLHVFLTVLILGTLWRVLQYHLMASPNEHLQHLGQAMSTQY* |
Ga0126383_1000049034 | 3300010398 | Tropical Forest Soil | VIDAQVGLHVFLIVLIFGTLWRLLSFHAMASSNPAVQHAGKAMSIQY* |
Ga0126383_115862592 | 3300010398 | Tropical Forest Soil | VAVIDLQVGLHVFLIVLVFGTLWRVSQFHLMASPNPSLQHLGKAMSTQY* |
Ga0126383_121497292 | 3300010398 | Tropical Forest Soil | MSKWIDVQVGLHVFMIVLVFGTIWRVGQYHLMASPNAHLQHLGMAMSTQY* |
Ga0137392_101962083 | 3300011269 | Vadose Zone Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHFMASSNPGIQHVGKAMSTQY* |
Ga0137392_102242632 | 3300011269 | Vadose Zone Soil | MRPSGQYVSRRFAVIDLQVGLHVFLVVLVFGTLWRVSQFHLMASPNPSLQHLGKAMSVQY |
Ga0137393_105229174 | 3300011271 | Vadose Zone Soil | MEERPPMVDAQVGLHVFMIVLIFGTLWRVLQYHAMASPSPWLSHLGAAMSTQY* |
Ga0137389_1002104111 | 3300012096 | Vadose Zone Soil | MLDLQVGLPVFLSVLILGTIWRDIQYHFMASSNPGIQHVGKAMSTQY* |
Ga0137361_101297265 | 3300012362 | Vadose Zone Soil | LLDLQVGLHVFLSVLILGTIWRVIQYHFMASSNPGIQHVGKAMSTQY* |
Ga0137413_1000011618 | 3300012924 | Vadose Zone Soil | MQYLKIGVHMWVSVLIVGTLWRLLSFHAIASPNVHLQHAGKAMSIQY* |
Ga0126369_1000077717 | 3300012971 | Tropical Forest Soil | MEVPMFVDLQVALHVFMSVLIMGTIWRVLQYHLMASPNAHAQHVGKAMATQY* |
Ga0172378_100244158 | 3300014203 | Groundwater | MDDIKVGLHIFLVVLVFGTLWRLSSYHLMASQNPRAQNLGKAMVTQY* |
Ga0172380_1000377227 | 3300014205 | Landfill Leachate | MDDIKVGLHIFLVVLVIGTLWRLSSYHLMASQNPRAQHLGKAMVTQY* |
Ga0182019_100145167 | 3300014498 | Fen | MDDIKVAVHIFLIVLIMGTLWRVSTFHLMASANTNLQHLGKGMSLQF* |
Ga0182032_114180792 | 3300016357 | Soil | LHVFLTVLILGTLWRVLQYHLMGSSNVHLAHVGMAMSTQY |
Ga0187802_102910612 | 3300017822 | Freshwater Sediment | VPIDAQVGLHVFMIVLIFGTLWRLLQFHAMASGTPWLQHLGMAMAVQY |
Ga0187807_13410821 | 3300017926 | Freshwater Sediment | MIDAQVGLHVFMIVLIFGTLWRLLQFHAMASPSPWLSHLGQAMSVQY |
Ga0187819_102645891 | 3300017943 | Freshwater Sediment | MLDLQVGLHVFLSVLILGTIWRVIQYHLMASNNPGIAHIGKAMSTQY |
Ga0187779_109109612 | 3300017959 | Tropical Peatland | MLDLQVGLHVFMSVLILGTVWRLLSYHLAASSNTGVSHVGRAMLIQY |
Ga0187776_100322195 | 3300017966 | Tropical Peatland | MVDLQVALHVFMSVLIIGTLWRVIQYHLMASGNAGIQHVGKAMSTQY |
Ga0187776_103449242 | 3300017966 | Tropical Peatland | MLDVQVGLHVFMTVLIFGTLWRVIQYHLMASPNTGLQHVGKAMSTQY |
Ga0187783_100471857 | 3300017970 | Tropical Peatland | MLDIQVGLHVFMIVLILGTVWRLTSFHLIAAGSPWLQHLGVAMSLQY |
Ga0187783_100812892 | 3300017970 | Tropical Peatland | LIDLQVGLHVFLCVLILGTIWRLSQYHLVAAQSPWLQHLGVAMAVQY |
Ga0187783_104645423 | 3300017970 | Tropical Peatland | MIDLQVGLHVFMIVLILGTVWRLTSFHLIATQSPWLQHLGVAMSVQY |
Ga0187783_111505322 | 3300017970 | Tropical Peatland | VIDLQVALHVFMSVLILGTVWRLLSFHLAASQNTGISHVGRAMGIQY |
Ga0187780_111219511 | 3300017973 | Tropical Peatland | MLDLQVALHVFMSVLILGTVFRLVQYHLMASSNTGLQHVGKAMSTQY |
Ga0187805_104586222 | 3300018007 | Freshwater Sediment | VVDAQVGLHVFMIVLIFGTLWRLLQFHAMASPSPWLNHLGKAMAVQY |
Ga0187765_104677502 | 3300018060 | Tropical Peatland | VIDLQVGLHVFLIVLIFGTVWRLLSFHALASPNSAVQHAGKAMAIQY |
Ga0187772_109866981 | 3300018085 | Tropical Peatland | MLDLQVGLHVFMSVLILGTVWRLLSYHLAANSNTGVSHVGRAMLIQY |
Ga0187769_101183755 | 3300018086 | Tropical Peatland | MEHLAVALHIFFIVLALGTLWRLGTLHCLASSNPHVQHVGKAMSLQY |
Ga0210407_106969022 | 3300020579 | Soil | MLDLQVSLHVFMSVLILGTIFRLISYHLMASSNPGVQHIGKAMSTQY |
Ga0210395_113997082 | 3300020582 | Soil | MLDLQVSLHVFMSVLILGTIFRLVSYHLMASSNPGVQHIGKAMSTQY |
Ga0210401_114140681 | 3300020583 | Soil | MIDIQVGLHVFMIVLIFGTLWRISQFHLMASPNPSLQHLGKAMSIQY |
Ga0179596_1000038226 | 3300021086 | Vadose Zone Soil | MQYLKIGVHMWVSVLIVGTLWRLLSFHAIASPNVHLQHAGKAMSIQY |
Ga0179596_100635245 | 3300021086 | Vadose Zone Soil | MVDAQVGLHVFMIVLIFGTLWRVLQYHAMASPSPWLSHLGAAMSTQY |
Ga0210404_100019482 | 3300021088 | Soil | VIDLQVGLHVFLVVLVFGTLWRVGQFHLMASPNPSLQHLGKAMSVQY |
Ga0210408_101257232 | 3300021178 | Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHLMASGNTGLQHVGKAMSTQY |
Ga0210396_107868332 | 3300021180 | Soil | VNDLLAGLGIFATVLVFGTLFRVSQFHLMASPNPSLQHLGKAMSIQY |
Ga0210396_109398263 | 3300021180 | Soil | MIDAQVALHVFMIVLVMGTLWRLLQFHAMASPSPWLSHLGRAMSVQY |
Ga0210387_110898812 | 3300021405 | Soil | MLDLQVSLHVFASVLILGTIFRLVSYHLMASTNPGVQHIGKAMSTQY |
Ga0210383_104924722 | 3300021407 | Soil | MLDLQVSLHVFMSVLILGTIFRLISYHLMASSNPGVQHVGKAMSTQY |
Ga0210394_100169622 | 3300021420 | Soil | MLDLQVALHVFLSVLILGTLWRVAQYHLMASSNPGIQHVGKAMSTQY |
Ga0210390_107241012 | 3300021474 | Soil | MLDLQVGLHVFLSVLILGTIWRVLQYHAMASSNAGIQHIGKAMSTQY |
Ga0187846_104133071 | 3300021476 | Biofilm | MLDLQVGLHVFMTVLIFGTLWRVIQYHLMASGNPGVQHIGKAMSTQY |
Ga0210402_100101772 | 3300021478 | Soil | VIDVGVGLHVFMIILIFGTIWRVSQFHLMASPNPALQHLGKAMSIQY |
Ga0210410_112098582 | 3300021479 | Soil | VIDLQVALHVFMSVLILGTIWRVLQYHLMASGNPGIQHVGKAMSTQY |
Ga0126371_100189777 | 3300021560 | Tropical Forest Soil | MIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNTGIQHIGKAMSTQY |
Ga0126371_102000956 | 3300021560 | Tropical Forest Soil | VIDLGVGVHVFLIVLVLGTLWRISQFHLMASANPSLQHLGKAMSTQY |
Ga0126371_103710301 | 3300021560 | Tropical Forest Soil | MIDLKIGLHVFAVILIFGTLWRVSQFHLMASPNPALQHLGKAMSIQY |
Ga0126371_103860223 | 3300021560 | Tropical Forest Soil | MIDLQVGLHVFMSVLILGTIFRIVSYHLIASPNAGIQHIGKAMSTQY |
Ga0126371_106104312 | 3300021560 | Tropical Forest Soil | VIDARTSLYIFLAVLILGTLWRVSQFHLMASPNPSLQHLGKAMSVQY |
Ga0126371_106503882 | 3300021560 | Tropical Forest Soil | MLDLQVGIHVFMTVLVLGTIWRVTQYHLMASPNPGIQHIGKAMSTQY |
Ga0126371_107680512 | 3300021560 | Tropical Forest Soil | VIDLKVGLHVFMIVLIFGTLWRVSQFHLMASPNPSLQHLGKAMSTQY |
Ga0126371_108937222 | 3300021560 | Tropical Forest Soil | MLDLQVGIHVFMTVLVLGTLWRVTQYHLMASPNPGIQHIGKAMSTQY |
Ga0126371_109395312 | 3300021560 | Tropical Forest Soil | MLDLEVGLHVFMTVLVLGTLWRVLQYHLMASPNPGIQHVGKAMSTQY |
Ga0126371_119112191 | 3300021560 | Tropical Forest Soil | VIDLQVGLHVFFIVLVLGTLWRVSQFHLMASPNPSLQHLGKAMSVQY |
Ga0126371_122885852 | 3300021560 | Tropical Forest Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHLMASPNAGLQHVGKAMSTQY |
Ga0126371_131020652 | 3300021560 | Tropical Forest Soil | VNDLLAGLGIFATVLVFGTLFRISQFHLMASPNPSLQHLGKAMSIQY |
Ga0126371_131770472 | 3300021560 | Tropical Forest Soil | VFVDLQVALHVFMSVLIMGTIWRILQYHMMASPNAHVQHVGKAMSTQY |
Ga0247681_100013413 | 3300024310 | Soil | VDDIKVAIHIFLVVLVLGTLWRLTSYHLMAASDERLQHLGKAMVTQY |
Ga0207646_1000237723 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEWIDVQVGLHVFMIVLVFGTVWRVSQYHLMASPNAHLQHLGMAMSTQY |
Ga0207674_1000705728 | 3300026116 | Corn Rhizosphere | VLDLQVSLHVFLSVLILGTLWRVIQYHLMASSNSGLSHIGKAMSTQY |
Ga0209240_100036922 | 3300026304 | Grasslands Soil | VLDLQVGLHVFLSVLVLGTVWRLVQYHAMASSNPGIQHVGKAMSTQY |
Ga0257146_10349531 | 3300026374 | Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHLMASDNAGLQHVGKAMSTQY |
Ga0257169_10737662 | 3300026469 | Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHFMASPNAGIQHVGKAMSTQY |
Ga0257161_10004948 | 3300026508 | Soil | VIDLQVALHVFMSVLILGTIWRVLQYHLMASPHPGVQHVGKAMSTQY |
Ga0209588_10062586 | 3300027671 | Vadose Zone Soil | LLDLQVGLHVFLSVLILGTIWRVVQYHFMASSNPGIQHVGKAMSTQY |
Ga0209248_102129762 | 3300027729 | Bog Forest Soil | MIDAQVALHVFMIVLVVGTLWRLLQFHAMASPSPWLSHLGMAMSIQY |
Ga0209772_100759942 | 3300027768 | Bog Forest Soil | MIDAQVALHVFMIVLIVGTLWRIFQVHAMAAGSPWLQHLGMAMSVQY |
Ga0209656_1000072426 | 3300027812 | Bog Forest Soil | MNDLLTGLGIFATVLVFGTLFRISQFHLMASPNPSLQHLGKAMSIQY |
Ga0209656_100126284 | 3300027812 | Bog Forest Soil | MIDAQVALHVFMIVLIVGTLWRILQVHAMASPSPWLSHLGMAMSIQY |
Ga0209656_102655332 | 3300027812 | Bog Forest Soil | VIDVGVGLHVFMIILIFGTIWRVSQFHLMASSNPALQHLGKAMSIQY |
Ga0209040_100507411 | 3300027824 | Bog Forest Soil | VIDIQVGLHVFFIVLIMGTLWRIASFHLMASPNTALQHAGKAMSIQY |
Ga0209040_102278712 | 3300027824 | Bog Forest Soil | TGLGIFATVLVFGTLFRISQFHLMASPNPSLQHLGKAMSIQY |
Ga0209040_104304081 | 3300027824 | Bog Forest Soil | MIDAQVGLHVFMIVLIFGTLWRLLQFHAMASPSPWLSHLGMAMSLQY |
Ga0209166_100806572 | 3300027857 | Surface Soil | MWIDVQVGLHVFMIVLVFGTIWRVSQYHLMASPNAHLQHIGMAMATQY |
Ga0209701_100077752 | 3300027862 | Vadose Zone Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHFMASSNPGIQHVGKAMSTQY |
Ga0209579_105704992 | 3300027869 | Surface Soil | VLDLQVGLHVFMTVLILGTIWRVIQYHLMASSNAGIQHIGKAMSTQY |
Ga0209006_103022432 | 3300027908 | Forest Soil | VIDLQVALHVFMSVLILGTIWRVVQYHLMASGNPGVQHVGKAMSTQY |
Ga0265295_10826202 | 3300028601 | Landfill Leachate | MDDIKVGLHIFLVVLVFGTLWRLSSYHLMASQNPRAQNLGKAMVTQY |
Ga0265295_13508882 | 3300028601 | Landfill Leachate | MDDIKVGLHIFLVVLVIGTLWRLSSYHLMASQNPRAQHLGKAMVTQY |
Ga0308309_114136571 | 3300028906 | Soil | MSDWIDLQVGLHVFMLVLVFGTLWRVGQYHLMAHPSVHLQHLGMAMATQY |
Ga0268241_100339903 | 3300030511 | Soil | MIDLGVGAHVFLIVLVFGTLWRISQFHLMASPNPSLQHLGKAMSTQY |
Ga0170834_1047016952 | 3300031057 | Forest Soil | MLDLQVGLHVFLSVLILGTIWRVVQYHAMASSNAGIQHIGKAMSTQY |
Ga0318516_100074655 | 3300031543 | Soil | VLDIQVGLHVFLTVLILGTLWRVLQYHLMASSNVHLAHVGMAMSTQY |
Ga0318516_102133412 | 3300031543 | Soil | MLDLQVGLHVFLSVLILGTIWRVVQYHLMASSNTGLQHVGKAMSTQY |
Ga0318534_100580401 | 3300031544 | Soil | MPIDLQVALHVFMSVLILGTLFRLVSYHLMASPNPGIQHVGKAMSTQY |
Ga0318534_100685796 | 3300031544 | Soil | MPIDLQVALHVFMSVLILGTLFRLVSYHLMASSNPGVQHVGKAMSTQY |
Ga0318573_100399677 | 3300031564 | Soil | VKGHLPMIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNTGIQHIGKAMSTQY |
Ga0310686_1126775052 | 3300031708 | Soil | VDDVKVGLHIFMVVLIYGTLWRLLQYHAMASPNAHIQHIGMAMSTQY |
Ga0310686_1169922672 | 3300031708 | Soil | MIDAQVGLHVFMIVLIFGTLWRLIQFHAMASPSPWLSHLGMAMSVQY |
Ga0306917_111385831 | 3300031719 | Soil | ASRTSGGPAVIDVQVGLHVFLIVLVFGTLWRLLSFHAMASSNPAVQHAGKAMSIQY |
Ga0307469_118593302 | 3300031720 | Hardwood Forest Soil | MIDLQVGTHVFLVVLIFGTLWRLLSFHAMASANPAISHAGKAMSIQY |
Ga0318500_100281495 | 3300031724 | Soil | MPIDQVALHVFMSVLILGTLFRLVSYHLMASPNPGIQHVGKAMSTQY |
Ga0318502_104536872 | 3300031747 | Soil | VTDAKIGLHVFMLVLIFGTLWRLLSFHAIASPNTAVSHLGRAMSLQY |
Ga0307475_103676872 | 3300031754 | Hardwood Forest Soil | VIDVQVGLHVFMVVLIFGTLWRVLQYHAMASPNPWLSHLGQAMSTQY |
Ga0318537_100548591 | 3300031763 | Soil | QVGLHVFLTVLILGTLWRVLQYHLMASSNVHLAHVGMAMSTQY |
Ga0318566_102228022 | 3300031779 | Soil | VLDLQVGLHVFLTVLILGTLWRVLQYHLMASSNLHLQHVGMAMSTQY |
Ga0318547_103984392 | 3300031781 | Soil | LPDREAAPMPIDLQVALHVFMSVLILGTLFRLVSYHLMASPNPGIQHVGKAMSTQY |
Ga0318529_104497511 | 3300031792 | Soil | VLDIQVGLHVFLTVLILGTLWRVLQYHLMASSNVHLAHVG |
Ga0318557_100643411 | 3300031795 | Soil | VIDVQVGLHVFLIVLVFGTLWRLLSFHAMASSNPAVQHAGKAMSI |
Ga0318565_105713952 | 3300031799 | Soil | EAPAMLDLQVGLHVFLSVLILGTIWRVVQYHLMASSNTGLQHVGKAMSTQY |
Ga0318564_101831664 | 3300031831 | Soil | VLDIQVGLHVFLTVLILGTLWRVLQYHLMASSNVHLAHVGMAM |
Ga0306921_105774742 | 3300031912 | Soil | LAGGASRTSGGPAVIDVQVGLHVFLIVLVFGTLWRLLSFHAMASSNPAVQHAGKAMSIQY |
Ga0310912_106432672 | 3300031941 | Soil | VIDVQVGLHVFLIVLVFGTLWRLLSFHAMASSNPAVQHAGKAMSIQY |
Ga0310909_108117963 | 3300031947 | Soil | VLDLQVGLHVFMSVLILGTVFRLVQYHLMASPNPGLQHVGKAMSTQY |
Ga0318530_103767092 | 3300031959 | Soil | VTDAKIGLHVFMLVLIFGTLWRLLSFHAIASPNTAISHVGRAMSLQY |
Ga0307479_109366351 | 3300031962 | Hardwood Forest Soil | VLDLQVGLHVFMTVLIFGTLWRVIQYHLMASPNTGLQHVGKAMSTQY |
Ga0306922_100625618 | 3300032001 | Soil | WLGGPPGLPGGPAVIDVQVGLHVFLIVLVFGTLWRLLSFHAMASSNPAVQHAGKAMSIQY |
Ga0318562_104272142 | 3300032008 | Soil | MLDLKIGIHVFATVLVLGTLWRVLQYHLMASPNPGVQHIGKAMSTQY |
Ga0310911_103337882 | 3300032035 | Soil | QCPGGFAKVKGHLPMIDLQVGLHVFMSVLILGTIFRIVSYHLMASPNTGIQHIGKAMSTQ |
Ga0318518_106479292 | 3300032090 | Soil | VLDLQVGLHVFLTVLILGTLWRVLQYHLMASSNLHLQHVGMAMST |
Ga0316226_13982242 | 3300032562 | Freshwater | VIDLQVGLHVFLIVLVFGTLWRISQFHLMASPNPSLQHLGKAMSTQY |
Ga0335085_104725265 | 3300032770 | Soil | VIDIQVGLHVFLIVLIFGTVWRLLSFHALASPNPAIQHAGKAMAIQY |
Ga0335082_105584832 | 3300032782 | Soil | GRYPAVIDIQVGLHVFLIVLIFGTVWRLLSFHALASPNPAIQHAGKAMAIQY |
Ga0335078_1000740516 | 3300032805 | Soil | MLDVQVGLHIFMVVLIFGTLWRLLQYHAMASPNPHVQHIGMAMATQY |
Ga0335069_104929881 | 3300032893 | Soil | MLDLQVGLHVFLSVLILGTIWRVIQYHLMASPNSGLQHVGKAMSTQY |
Ga0335074_100707427 | 3300032895 | Soil | VLDLQVALHVFLSVLILGTLWRVIQYHLMASSNPGIQHVGKAMSTQY |
Ga0335074_103269402 | 3300032895 | Soil | MDEIKVGAHVFLIVLVFGTGFRLATYHLMASRNPQLQHLGAAMAVQY |
Ga0335074_104985692 | 3300032895 | Soil | MLDLQVSIHVFMSVLILGTIFRLVSYHLMASSNPGIQHIGKAMSTQY |
Ga0335074_108089862 | 3300032895 | Soil | MDEIKVGAHVFLIVLVFGTGFRLATYHLMASRNPHLQHLGEAMAIQY |
Ga0335074_114380412 | 3300032895 | Soil | IQVALHVFMIVLILGTVWRLTSFHLVAAQSPWLQHLGIAMNLQY |
Ga0335075_1001402216 | 3300032896 | Soil | MDEIKVGLHVFLIVVVFGTGWRLGTYHLMASRNPVLQHLGNAMAIQY |
Ga0335075_114865742 | 3300032896 | Soil | VVDIQVALHVFMIVLILGTVWRLTSFHLVAAQSPWLQHLGIAMNLQY |
Ga0335073_114498012 | 3300033134 | Soil | SGMLDLQVSLHVFMSVLILGTIFRLISYHLMASSNPGVQHIGKAMSTQY |
Ga0310914_111788041 | 3300033289 | Soil | VLDLQVGLHVFLTVLILGTLWRVLQYHLMASSNLHLQHVG |
Ga0318519_100389276 | 3300033290 | Soil | DLQVALHVFMSVLILGTLFRLVSYHLMASSNPGVQHVGKAMSTQY |
Ga0334848_103355_224_367 | 3300033827 | Soil | MDDIKVAVHIFLIVLIMGTLWRVSTFHLMASANTNLQHLGKGMSLQF |
⦗Top⦘ |