Basic Information | |
---|---|
Family ID | F018010 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 237 |
Average Sequence Length | 43 residues |
Representative Sequence | IKCRPLEMRVGEPISTAGLAMRDMEALSATVQKALEDLYYRP |
Number of Associated Samples | 205 |
Number of Associated Scaffolds | 237 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.62 % |
% of genes from short scaffolds (< 2000 bps) | 87.76 % |
Associated GOLD sequencing projects | 188 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.359 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.236 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.675 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.055 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 5.71% Coil/Unstructured: 65.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 237 Family Scaffolds |
---|---|---|
PF04545 | Sigma70_r4 | 10.97 |
PF04542 | Sigma70_r2 | 8.86 |
PF03544 | TonB_C | 7.59 |
PF01401 | Peptidase_M2 | 6.75 |
PF01926 | MMR_HSR1 | 4.64 |
PF01850 | PIN | 3.80 |
PF02824 | TGS | 3.80 |
PF08281 | Sigma70_r4_2 | 3.38 |
PF00903 | Glyoxalase | 3.38 |
PF01712 | dNK | 1.27 |
PF00117 | GATase | 0.84 |
PF00248 | Aldo_ket_red | 0.84 |
PF03412 | Peptidase_C39 | 0.84 |
PF12867 | DinB_2 | 0.84 |
PF13411 | MerR_1 | 0.84 |
PF10662 | PduV-EutP | 0.42 |
PF11146 | DUF2905 | 0.42 |
PF03551 | PadR | 0.42 |
PF06480 | FtsH_ext | 0.42 |
PF02538 | Hydantoinase_B | 0.42 |
PF00829 | Ribosomal_L21p | 0.42 |
PF00850 | Hist_deacetyl | 0.42 |
PF00892 | EamA | 0.42 |
PF00156 | Pribosyltran | 0.42 |
PF02410 | RsfS | 0.42 |
PF15780 | ASH | 0.42 |
PF08450 | SGL | 0.42 |
PF00005 | ABC_tran | 0.42 |
PF07973 | tRNA_SAD | 0.42 |
PF09535 | Gmx_para_CXXCG | 0.42 |
PF02875 | Mur_ligase_C | 0.42 |
PF10387 | DUF2442 | 0.42 |
PF02810 | SEC-C | 0.42 |
PF08241 | Methyltransf_11 | 0.42 |
PF00216 | Bac_DNA_binding | 0.42 |
PF11734 | TilS_C | 0.42 |
COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 8.86 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 8.86 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 8.86 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 8.86 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 7.59 |
COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 1.27 |
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 0.84 |
COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.42 |
COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.42 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.42 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.42 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.42 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.36 % |
Unclassified | root | N/A | 4.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001154|JGI12636J13339_1001202 | All Organisms → cellular organisms → Bacteria | 4348 | Open in IMG/M |
3300001593|JGI12635J15846_10313643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
3300001661|JGI12053J15887_10473731 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100307863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1468 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101228218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300002568|C688J35102_118920814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 613 | Open in IMG/M |
3300004092|Ga0062389_101551530 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300004635|Ga0062388_101470282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300004635|Ga0062388_101874312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. 5B5 | 617 | Open in IMG/M |
3300005177|Ga0066690_10876086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300005186|Ga0066676_10344216 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300005343|Ga0070687_100128836 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300005355|Ga0070671_101643359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 570 | Open in IMG/M |
3300005356|Ga0070674_100110561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2017 | Open in IMG/M |
3300005435|Ga0070714_101914822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300005436|Ga0070713_101049966 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300005437|Ga0070710_10170430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1356 | Open in IMG/M |
3300005450|Ga0066682_10112213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1719 | Open in IMG/M |
3300005529|Ga0070741_10919324 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300005529|Ga0070741_10944522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300005529|Ga0070741_10951457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300005532|Ga0070739_10070352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2119 | Open in IMG/M |
3300005533|Ga0070734_10742506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
3300005537|Ga0070730_10729271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 627 | Open in IMG/M |
3300005538|Ga0070731_10495048 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300005538|Ga0070731_11170831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300005541|Ga0070733_10153599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1494 | Open in IMG/M |
3300005542|Ga0070732_10267581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1024 | Open in IMG/M |
3300005591|Ga0070761_10027435 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
3300005610|Ga0070763_10139250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1259 | Open in IMG/M |
3300005610|Ga0070763_10238261 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300005841|Ga0068863_100314540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1520 | Open in IMG/M |
3300005878|Ga0075297_1018073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 738 | Open in IMG/M |
3300005888|Ga0075289_1067307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300005898|Ga0075276_10093970 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300006028|Ga0070717_11087814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300006047|Ga0075024_100897596 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300006052|Ga0075029_100811439 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300006162|Ga0075030_100004738 | All Organisms → cellular organisms → Bacteria | 12304 | Open in IMG/M |
3300006162|Ga0075030_100362821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1155 | Open in IMG/M |
3300006162|Ga0075030_101627249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 505 | Open in IMG/M |
3300006354|Ga0075021_10574555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 718 | Open in IMG/M |
3300006796|Ga0066665_11310677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300006854|Ga0075425_101138643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 888 | Open in IMG/M |
3300007788|Ga0099795_10058742 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300009093|Ga0105240_11158237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
3300009520|Ga0116214_1311861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300009553|Ga0105249_12593725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300009624|Ga0116105_1051324 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300009635|Ga0116117_1205024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300009665|Ga0116135_1001233 | All Organisms → cellular organisms → Bacteria | 13223 | Open in IMG/M |
3300009665|Ga0116135_1108101 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300009700|Ga0116217_10737440 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300009760|Ga0116131_1125737 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300009824|Ga0116219_10133631 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300010043|Ga0126380_10842999 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300010043|Ga0126380_10999093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300010046|Ga0126384_11723319 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300010159|Ga0099796_10560269 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300010359|Ga0126376_10796129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
3300010360|Ga0126372_10171567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1767 | Open in IMG/M |
3300010360|Ga0126372_11702988 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300010371|Ga0134125_11758580 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300010375|Ga0105239_13259048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300010376|Ga0126381_101657101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300010379|Ga0136449_100405285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2417 | Open in IMG/M |
3300010379|Ga0136449_100521188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2055 | Open in IMG/M |
3300010398|Ga0126383_10078609 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
3300010937|Ga0137776_1671193 | Not Available | 2113 | Open in IMG/M |
3300011120|Ga0150983_11172949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300012096|Ga0137389_11552157 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012189|Ga0137388_11439300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300012199|Ga0137383_10863202 | Not Available | 661 | Open in IMG/M |
3300012199|Ga0137383_11249264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300012203|Ga0137399_10117718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2082 | Open in IMG/M |
3300012208|Ga0137376_10644082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
3300012211|Ga0137377_10625644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1013 | Open in IMG/M |
3300012212|Ga0150985_121555978 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300012349|Ga0137387_10756409 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 703 | Open in IMG/M |
3300012362|Ga0137361_11306347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300012924|Ga0137413_11697325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300012944|Ga0137410_11005945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
3300012944|Ga0137410_11838107 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300012955|Ga0164298_10443466 | Not Available | 852 | Open in IMG/M |
3300012955|Ga0164298_11100629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300012986|Ga0164304_11585256 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300013307|Ga0157372_12029992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300014169|Ga0181531_10223483 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300014489|Ga0182018_10657714 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300014654|Ga0181525_10030307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3235 | Open in IMG/M |
3300015051|Ga0137414_1235847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2121 | Open in IMG/M |
3300015242|Ga0137412_10700726 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300015262|Ga0182007_10433750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300015373|Ga0132257_101386181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
3300016294|Ga0182041_11852806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300016357|Ga0182032_11893203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300017823|Ga0187818_10426762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300017930|Ga0187825_10295245 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017933|Ga0187801_10267589 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300017943|Ga0187819_10531331 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300017948|Ga0187847_10353554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300017955|Ga0187817_10125255 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300017959|Ga0187779_10489905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300017961|Ga0187778_10911619 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300017970|Ga0187783_10575543 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300017975|Ga0187782_11525763 | Not Available | 527 | Open in IMG/M |
3300017999|Ga0187767_10113974 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300018007|Ga0187805_10493956 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300018012|Ga0187810_10173289 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300018013|Ga0187873_1158449 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300018062|Ga0187784_11581005 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300018062|Ga0187784_11629384 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300018085|Ga0187772_10224662 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300018085|Ga0187772_10724017 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300018086|Ga0187769_10078799 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
3300018090|Ga0187770_11750801 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300018468|Ga0066662_11275270 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300018468|Ga0066662_12366119 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300019256|Ga0181508_1256184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300020579|Ga0210407_10645763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
3300020579|Ga0210407_10648117 | Not Available | 821 | Open in IMG/M |
3300020579|Ga0210407_10956241 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300020580|Ga0210403_10451746 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300020582|Ga0210395_10281178 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300020582|Ga0210395_10402088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1030 | Open in IMG/M |
3300020583|Ga0210401_11120894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300021168|Ga0210406_10545034 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300021168|Ga0210406_10746913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300021180|Ga0210396_11005052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 706 | Open in IMG/M |
3300021181|Ga0210388_10481889 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300021181|Ga0210388_11517566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300021402|Ga0210385_10605801 | Not Available | 835 | Open in IMG/M |
3300021403|Ga0210397_10650844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
3300021406|Ga0210386_10780850 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300021407|Ga0210383_10856026 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300021407|Ga0210383_11343966 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300021420|Ga0210394_10215105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1678 | Open in IMG/M |
3300021432|Ga0210384_10231718 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
3300021433|Ga0210391_11223602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300021476|Ga0187846_10479398 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300021477|Ga0210398_10063271 | All Organisms → cellular organisms → Bacteria | 3019 | Open in IMG/M |
3300021478|Ga0210402_10246964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1647 | Open in IMG/M |
3300021559|Ga0210409_10996272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300022533|Ga0242662_10042732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1141 | Open in IMG/M |
3300022711|Ga0242674_1036169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300022714|Ga0242671_1077423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300022850|Ga0224552_1056394 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300023090|Ga0224558_1124518 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300024330|Ga0137417_1497019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1727 | Open in IMG/M |
3300025612|Ga0208691_1006780 | All Organisms → cellular organisms → Bacteria | 3139 | Open in IMG/M |
3300025898|Ga0207692_10399084 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 857 | Open in IMG/M |
3300025925|Ga0207650_10013642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5631 | Open in IMG/M |
3300025926|Ga0207659_11448021 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300025938|Ga0207704_11051699 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300026088|Ga0207641_10455888 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300026095|Ga0207676_11107372 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300026215|Ga0209849_1087522 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300026313|Ga0209761_1046362 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
3300026320|Ga0209131_1353308 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300026329|Ga0209375_1189914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
3300026551|Ga0209648_10525288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300026552|Ga0209577_10088809 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
3300026557|Ga0179587_10390860 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300027535|Ga0209734_1060451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
3300027565|Ga0209219_1015619 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300027568|Ga0208042_1010547 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
3300027575|Ga0209525_1133067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300027590|Ga0209116_1008597 | Not Available | 2047 | Open in IMG/M |
3300027625|Ga0208044_1025384 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
3300027652|Ga0209007_1016192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1938 | Open in IMG/M |
3300027652|Ga0209007_1043091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1151 | Open in IMG/M |
3300027667|Ga0209009_1075363 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300027737|Ga0209038_10104635 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300027842|Ga0209580_10181291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300027855|Ga0209693_10200722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
3300027855|Ga0209693_10258887 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300027867|Ga0209167_10358985 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300027869|Ga0209579_10151695 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300027874|Ga0209465_10451703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300027879|Ga0209169_10239165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
3300027898|Ga0209067_10128716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
3300027910|Ga0209583_10331870 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300027911|Ga0209698_10771503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300027915|Ga0209069_10112461 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300028036|Ga0265355_1019380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300028047|Ga0209526_10991814 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300028381|Ga0268264_10033073 | All Organisms → cellular organisms → Bacteria | 4245 | Open in IMG/M |
3300028871|Ga0302230_10185579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300028906|Ga0308309_10640498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
3300029883|Ga0311327_10619620 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300029943|Ga0311340_10008357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13540 | Open in IMG/M |
3300029999|Ga0311339_10271847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1847 | Open in IMG/M |
3300030011|Ga0302270_10550666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
3300030045|Ga0302282_1069500 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300030049|Ga0302191_10368754 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300030053|Ga0302177_10729757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300030057|Ga0302176_10450557 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300030399|Ga0311353_10004578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 17995 | Open in IMG/M |
3300030399|Ga0311353_10415795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
3300030399|Ga0311353_11615491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300030740|Ga0265460_12389167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300030741|Ga0265459_12140945 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300031057|Ga0170834_103574673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
3300031090|Ga0265760_10011052 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
3300031122|Ga0170822_16747418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300031231|Ga0170824_111363709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300031446|Ga0170820_13314431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300031474|Ga0170818_108449982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
3300031521|Ga0311364_11332889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
3300031708|Ga0310686_114002872 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
3300031708|Ga0310686_115044632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300031712|Ga0265342_10050879 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
3300031715|Ga0307476_10129160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1804 | Open in IMG/M |
3300031720|Ga0307469_10591110 | Not Available | 990 | Open in IMG/M |
3300031753|Ga0307477_10567027 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300031753|Ga0307477_10667754 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300031754|Ga0307475_10422660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
3300031754|Ga0307475_11066316 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300031823|Ga0307478_10548591 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300031823|Ga0307478_11524225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300031859|Ga0318527_10502908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300031962|Ga0307479_10280749 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
3300032074|Ga0308173_11007293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
3300032180|Ga0307471_103167793 | Not Available | 583 | Open in IMG/M |
3300032205|Ga0307472_101222547 | Not Available | 719 | Open in IMG/M |
3300032770|Ga0335085_10737528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1091 | Open in IMG/M |
3300032783|Ga0335079_12313132 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032829|Ga0335070_10915072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300032895|Ga0335074_10490157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1281 | Open in IMG/M |
3300032898|Ga0335072_10952472 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300033158|Ga0335077_10119154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3071 | Open in IMG/M |
3300033826|Ga0334847_019213 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300034124|Ga0370483_0304479 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300034163|Ga0370515_0520814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300034282|Ga0370492_0331591 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300034817|Ga0373948_0136551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.24% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.59% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.91% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.49% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.64% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.64% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.22% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.38% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.95% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.95% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.53% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.53% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.11% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.11% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.27% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.27% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.27% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.27% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.27% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.27% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.42% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.42% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.42% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.42% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.42% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022850 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12636J13339_10012025 | 3300001154 | Forest Soil | NTYHIKSRPLEMRIGEPITTAGCSLREMETLSAKVHQAMEDLYYSPPAPRST* |
JGI12635J15846_103136431 | 3300001593 | Forest Soil | RVGEPISTAGLKLRDMEALSAKVKKALEDLYYGP* |
JGI12053J15887_104737312 | 3300001661 | Forest Soil | MRVGQPISTAGLTIRDLEAVSQKVQKAVEELYYAPSVPSA* |
JGIcombinedJ26739_1003078631 | 3300002245 | Forest Soil | IKCRPLEMRVGEPISTAGMTMRDLDAASVKVRQEMEKLYYA* |
JGIcombinedJ26739_1012282181 | 3300002245 | Forest Soil | MDTYHIKCRPLEMRVGKPISTAGLTLRDMETVSAKVHAAVEELYYT* |
C688J35102_1189208141 | 3300002568 | Soil | MNTYHIKSQPLEMRVGEPISTAGLKGHDMEALSAKVKAAMEELYYPQTL* |
Ga0062389_1015515302 | 3300004092 | Bog Forest Soil | MDTYHIKCRPLEMRVGEPISTAGMKMRDLEAVSGKVKKAMEDLYYAPATLST* |
Ga0062388_1014702822 | 3300004635 | Bog Forest Soil | YHIKCRPLEMRVGEPISTAGLTVRDLEAVSGRVKTAMETLYYRPNDPTPMSF* |
Ga0062388_1018743122 | 3300004635 | Bog Forest Soil | PLEMRVGEPISTAGLTMRDMDAVSEKVRKAMEDLYYAQSPVQ* |
Ga0066690_108760862 | 3300005177 | Soil | YHIKCRPLEMRVGEPISTTGLTVKDLPALSDRVQKAVEALYYRP* |
Ga0066676_103442162 | 3300005186 | Soil | NTYHIKSRPLEMRVGEPISTAGYTLHDINTVSAKVQKAVEGLYYNRSET* |
Ga0070687_1001288361 | 3300005343 | Switchgrass Rhizosphere | RLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC* |
Ga0070671_1016433591 | 3300005355 | Switchgrass Rhizosphere | MDTYHIKCRPLEMRVGQPISTAGYALRNMTELSDKVHKAVEDLYYQPVASA* |
Ga0070674_1001105614 | 3300005356 | Miscanthus Rhizosphere | TYHIKCRPLEMRVGQPISTAEYTLRNMEALSDKVHQAVEDLYKRG* |
Ga0070714_1019148221 | 3300005435 | Agricultural Soil | TYHIKCRPLEMRVGEPISTTGLTMKDLQALSDRVQKAVEDLYYREEKS* |
Ga0070713_1010499662 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | CRPLEMRVGKPISTVGLTLRDLEALSAKVQKAVEDLYYRA* |
Ga0070710_101704303 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LLPMNTYHIKCRPLEMRVGEPIATTGLTMKDLESLSARVQKAVEDLYYG* |
Ga0066682_101122131 | 3300005450 | Soil | IKPRPLEMRVGEPISTAGLKLRDMEALSAKVKKALEDLYYDH* |
Ga0070741_109193241 | 3300005529 | Surface Soil | PLEMRVGEPISTTGLKLHDMEALSAKVQKAMEELYYAGRIPT* |
Ga0070741_109445222 | 3300005529 | Surface Soil | IKCRPLEMRVGEPISTTGLTMKDLQALSERVQKAVEDLYYQP* |
Ga0070741_109514571 | 3300005529 | Surface Soil | EMRVGEPISTTGLKLHDMEALSAKVQKAMEELYYAGRIPT* |
Ga0070739_100703524 | 3300005532 | Surface Soil | DTYHIKSRPLEMRVGDPISTAGLGLRDMDQLSANVQHELESLYSKR* |
Ga0070734_107425062 | 3300005533 | Surface Soil | HIKCRPLEMRVGEPISTAGLGMRDLEALSAKVQKAVEDLYYAGHEAPPSNAY* |
Ga0070730_107292712 | 3300005537 | Surface Soil | SRPLEMRVGRPISTAHLKPRDMEMLSAQVKSAMEELYYG* |
Ga0070731_104950482 | 3300005538 | Surface Soil | DTYHIKSRALEMRVGAPISTTGLTMKDLAVLSERVQKALEDLYYRPA* |
Ga0070731_111708311 | 3300005538 | Surface Soil | YHIKCRPLEMRVGEPIATTGLTMKDLESLSARVQKAVEDLYYG* |
Ga0070733_101535993 | 3300005541 | Surface Soil | YHIKCRPLEMRVGQPISTAGMTMRDMEVVSAKVKKQLEDLYYAPAPVSA* |
Ga0070732_102675812 | 3300005542 | Surface Soil | KCRPLEMRVGEPIATAGLAVRDLEAVSGTVQRALEKLYYEN* |
Ga0070761_100274351 | 3300005591 | Soil | ISTVGLTMRDMEAVSAKVKKAMEDLYYAPALPST* |
Ga0070763_101392503 | 3300005610 | Soil | CRPLEMRVGQPISTTGLTMRDLEAVSAKVRKAVEDLYYPQGEASA* |
Ga0070763_102382611 | 3300005610 | Soil | HIKCRPLEMRVGEPISTAGLAGKDLEALSAKVQKAVEDLYYA* |
Ga0068863_1003145401 | 3300005841 | Switchgrass Rhizosphere | CRPLEMRVGEPISTKGLKLHEMETLSAKVQKAVEDLYYSQSQLT* |
Ga0075297_10180732 | 3300005878 | Rice Paddy Soil | NTYHIKCRPLEMRVGQAISTVDYTLRNMEELSDRVHKAVEDLYKSS* |
Ga0075289_10673071 | 3300005888 | Rice Paddy Soil | HIKCRPVEMRVGEPISTTGLHMRDLSALSAKVQKAVEDLYYQP* |
Ga0075276_100939702 | 3300005898 | Rice Paddy Soil | LEMRVGEPISTAGMKGHDIEKLSAQVQGAVEELYYAGRDS* |
Ga0070717_110878141 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YHIKCRPLEMRVGAPISTAGLTLRDLEGVSAKAQKAIEDLYYA* |
Ga0075024_1008975962 | 3300006047 | Watersheds | YHIKCRPLEMRVGGPISTAGLTMRDLETLSNRVQAELEKLYNAQGASRE* |
Ga0075029_1008114392 | 3300006052 | Watersheds | PLEMRVGEPISTVGMTARDLEALSSQVQKALEALYYRP* |
Ga0075030_10000473814 | 3300006162 | Watersheds | YHIKCRPLEMRVGEPISTAGMTVRDLEVISNKVQKALEDLYYQA* |
Ga0075030_1003628211 | 3300006162 | Watersheds | YHIKCRPLEMRVGEPIPTAGLTGRDLEALSAKVQKELEKLYYAGSNHAA* |
Ga0075030_1016272491 | 3300006162 | Watersheds | PLEMRVGEPISTVGLTLRDLEAFSAKVQKAVEELYYR* |
Ga0075021_105745551 | 3300006354 | Watersheds | TFELLPMNTYHIKSRPLEMRVGQPISTSGYTLRTMDALSDRVHRAVEDLYKGGFV* |
Ga0066665_113106772 | 3300006796 | Soil | LLPLNTLHIKCRPLERRVGEPISTAGLTLDDMDQLSENVQKAMEELSCANEST* |
Ga0075425_1011386432 | 3300006854 | Populus Rhizosphere | PLEMRVGKPISTVGLTLRDMESLSAKVQRAVEEMYYEGRVENN* |
Ga0099795_100587421 | 3300007788 | Vadose Zone Soil | PLEMRVGEPISTTGLTLRDVEMVSAKARKAIEDLYYAESPVSA* |
Ga0105240_111582371 | 3300009093 | Corn Rhizosphere | MNTYHIKCQPLEMRVGEPISTTGLSLREMESLSAKVQKALEDLYYR* |
Ga0116214_13118612 | 3300009520 | Peatlands Soil | QMRVGEPISTTGLTMKDLEALSAKVQKAVEDLYYA* |
Ga0105249_125937251 | 3300009553 | Switchgrass Rhizosphere | HIKCRPLEMRVGQPISTAGYSLRNMEALSDRVHKAVEDLYKGG* |
Ga0116105_10513241 | 3300009624 | Peatland | KCRPLEMRVGEPISTTGMTMRDLEAVSAKVKKALEDLYYAESPVPA* |
Ga0116117_12050241 | 3300009635 | Peatland | PLEMRVGKPISTTGLTMRDLEALSARVQKAVEELYYAPAS* |
Ga0116135_100123313 | 3300009665 | Peatland | ISTVGLKMRDLEAVSAKVQKAVEDLYYPQSPAGA* |
Ga0116135_11081011 | 3300009665 | Peatland | TYHIKCRPLEMRVGEPISTTGMTMRDLEAVSAKVKKALEDLYYAESPVPA* |
Ga0116217_107374402 | 3300009700 | Peatlands Soil | PISTARMTMRDLEAVSARVKKAIEDLYYPEAPPTC* |
Ga0116131_11257371 | 3300009760 | Peatland | MRVGEPISTVGLKMRDLEAVSAKVQKAVEDLYYPQSPAGA* |
Ga0116219_101336311 | 3300009824 | Peatlands Soil | KCRPLEMRVGAPISTAGLTMKDLESLSAKVQKEMESLYYAERQ* |
Ga0126380_108429991 | 3300010043 | Tropical Forest Soil | MDTFHIKCRPLEMRVGEPIPSAGLTLRDMEALSARVQRALEDLYYRPAFKS* |
Ga0126380_109990932 | 3300010043 | Tropical Forest Soil | RVGEPIPTAGLALRDMETLSTKVQKALEDLYYQP* |
Ga0126384_117233191 | 3300010046 | Tropical Forest Soil | RPLEMRVGQPISTAGYGPREMEELSANVKKAMEDLYYS* |
Ga0099796_105602691 | 3300010159 | Vadose Zone Soil | PISTAGLTLRDLEAVSAKARKAIEDLYYAESPVSA* |
Ga0126376_107961292 | 3300010359 | Tropical Forest Soil | HIKSRPLEMRLGAAIATAGLTMKDLPALSARVEKALEDLYYQE* |
Ga0126372_101715671 | 3300010360 | Tropical Forest Soil | KCRPLEMRVGDPISTAGLSGHDMEALSARVQKAMEGLFHQRA* |
Ga0126372_117029882 | 3300010360 | Tropical Forest Soil | MNTYHIKCQPLEMRVGEPISTTGLTMRDMETVSTRVQKAIEDLYYRP* |
Ga0134125_117585801 | 3300010371 | Terrestrial Soil | PRPLEMRVGKPISTAGMTTRDMEALSAKVQSAVEEMYYDNRP* |
Ga0105239_132590481 | 3300010375 | Corn Rhizosphere | YHIKPRPLEMRVGKPISTEGLTLRDMEALSARVQRSVEEMYYEGKGENH* |
Ga0126381_1016571011 | 3300010376 | Tropical Forest Soil | MRVGQPIPTAGLTLRDMEALSAQVQRALEDLYYRSDFKS* |
Ga0136449_1004052851 | 3300010379 | Peatlands Soil | PLQMRVGEPISTTGLTMKDLEALSAKVQKAVENLYYRSDS* |
Ga0136449_1005211884 | 3300010379 | Peatlands Soil | PMNTYHIKCRPLEMRVGEPISTTGMTMRGMEAVSAKVKKAMEDLYYAGTTP* |
Ga0126383_100786094 | 3300010398 | Tropical Forest Soil | HIKCQPLEMRVGKPISTTGLKLHDMTALSANVQKALEELYYTE* |
Ga0137776_16711931 | 3300010937 | Sediment | YHIKCRPLEMRLGQPISVAGLKGRDLEALSARVQKAMEELHDRPSALPA* |
Ga0150983_111729492 | 3300011120 | Forest Soil | NTYHIKCRPLGMRVGEPISTAGLTMRDMEVVSAKVKKAMEDLYYAPTTLST* |
Ga0137389_115521571 | 3300012096 | Vadose Zone Soil | PLEMRVGEPIATAGLTMRDLEGVSAKAQKAIEDLYYAESPVSA* |
Ga0137388_114393001 | 3300012189 | Vadose Zone Soil | TYHIKCRPLEMRVGRPISTAGYTLRNMEELSDRVHRAVEDLYLKPVVSG* |
Ga0137383_108632021 | 3300012199 | Vadose Zone Soil | MNTYHIKCRPLEMRVGAPISTAGLTGHDMQALSEKVHQAVFDLYNRK* |
Ga0137383_112492641 | 3300012199 | Vadose Zone Soil | IKPRSLEMRVGEPIATTGLNLQNMEALSAEVQQALEAMYCDR* |
Ga0137399_101177181 | 3300012203 | Vadose Zone Soil | TYHIKCRPLEMRVGQAISTAGYTLRNMEALLDKVHRAMEDLYLKPVVSD* |
Ga0137376_106440823 | 3300012208 | Vadose Zone Soil | DTYHIKCRPLEMRIGKPIPVAGLTMNNLDQLSANVHRALEALYYNQPS* |
Ga0137377_106256441 | 3300012211 | Vadose Zone Soil | PLEMRVGEPISTAGLKMKDLEALSAEVRKAVEELYYP* |
Ga0150985_1215559782 | 3300012212 | Avena Fatua Rhizosphere | LEMRVGKPIPTAGLDTKDMGQLSAKLQRAVEEMYYDGH* |
Ga0137387_107564091 | 3300012349 | Vadose Zone Soil | NTYHIKPRSLEMRVGHPIATAGLTLRDLEQLSAKVQKEMKGLYEAG* |
Ga0137361_113063471 | 3300012362 | Vadose Zone Soil | LNTYHIKCRPLEMRVGEPISTAGLLGHDMDALSARVQKAVEDLNDGRA* |
Ga0137413_116973252 | 3300012924 | Vadose Zone Soil | TYHIKSRPLEMRVGQPISTAGMTLRDTEAVSARVRAAIEGLYKNG* |
Ga0137410_110059452 | 3300012944 | Vadose Zone Soil | VGEPISTAGLTLHDMETLSGKVQKAMEDLYYRVSA* |
Ga0137410_118381072 | 3300012944 | Vadose Zone Soil | YHIKSRPLEFRVGDPIPTAGLKMADLEALSGRVQRALEELYYAPTPEAP* |
Ga0164298_104434661 | 3300012955 | Soil | FDLLPMNTYDIKSQALEMRVGAPISTAGLSLRDMDGVSSKVREAMLELYAAPRER* |
Ga0164298_111006292 | 3300012955 | Soil | KCRPLEMRVGEPISTTGLTMKDLQALSERVQKAVEDLYYRP* |
Ga0164304_115852561 | 3300012986 | Soil | RPLEMRIGAPISTAGLTGHDMQALSEKVHQAVTNLYSRK* |
Ga0157372_120299922 | 3300013307 | Corn Rhizosphere | PMNTYHIKRRPLEMRVGKPISTGGYTLRNMDELSDRVHQAVEDLYKGRPL* |
Ga0181531_102234831 | 3300014169 | Bog | PLEMRVGEPISTAGLTMRDMEAVSAKVKKAMEDLYYAPASLSI* |
Ga0182018_106577142 | 3300014489 | Palsa | EMRVGKPISTAGLAPRDLENLSGKVQKELEALYYASRSPQ* |
Ga0181525_100303074 | 3300014654 | Bog | CRPLEMRVGEPISTVGLTMRDMEAVSAKVRKAMEDLYYSEGSS* |
Ga0137414_12358474 | 3300015051 | Vadose Zone Soil | MNTYHIKCQPLEMRVGEPISTTGLTLHGMEALSGKVQKALEDLYYHDSAE* |
Ga0137412_107007261 | 3300015242 | Vadose Zone Soil | GEPISTTGLTLRDVEMVSAKARKAIEDLYYAESPVSA* |
Ga0182007_104337501 | 3300015262 | Rhizosphere | MNTYHIKCRPLEMRVGQPISTTGLTMKDLQALSDRVQKAVEDLYYREEKS* |
Ga0132257_1013861811 | 3300015373 | Arabidopsis Rhizosphere | IKCRPLEMRVGQPISTGGYTLRNMGELADRVLEAVEDLHAKPVSD* |
Ga0182041_118528061 | 3300016294 | Soil | TYHIKCRPLEMRVGEPISTAALRLRDMESLSTKVQRALEDLYYRP |
Ga0182032_118932031 | 3300016357 | Soil | CRPLEMRVGEPISTIGLTLRDLPALSARVQKSLEDLYYHP |
Ga0187818_104267621 | 3300017823 | Freshwater Sediment | QPISTTGMTMRDLEAVSAKVLKAVEDLYYASSPLPA |
Ga0187825_102952451 | 3300017930 | Freshwater Sediment | IKCWPLEMRVGDPISTQGLTGRDLEGLSSRVQAAVEKLYYSDGSNST |
Ga0187801_102675891 | 3300017933 | Freshwater Sediment | TYHIKCHPLAMRVGEPIPTAGLTTRDLGALSNQVKAEMERLYYGK |
Ga0187819_105313311 | 3300017943 | Freshwater Sediment | MRVGDPISTTGLTMRDLEAVSAKVRKAMSDLYYAPASQSA |
Ga0187847_103535542 | 3300017948 | Peatland | RPLEMRVGEPISTAGMTMRDLEAVSAKVMQELQRLYYA |
Ga0187817_101252552 | 3300017955 | Freshwater Sediment | HIKSRPLEMRVGEPISTAGYDLRHMEELSAKVQKAMEQLYSEGR |
Ga0187779_104899051 | 3300017959 | Tropical Peatland | IKCRPLEMRVGEPISTAGMTGRDLGAVSTKVQKAVEDLYYAA |
Ga0187778_109116191 | 3300017961 | Tropical Peatland | CRPLEMRVGEPISTAGLTGRDLETVSNQVRAAMERLYYSSGAVSE |
Ga0187783_105755431 | 3300017970 | Tropical Peatland | EMRVGEPISTAGLTMRDLEALSARVQKAVEELYYR |
Ga0187782_115257632 | 3300017975 | Tropical Peatland | RPLEMRVGEPIPTAGLTTRDLEVLSNRVKTAMENLYYSEGSTS |
Ga0187767_101139741 | 3300017999 | Tropical Peatland | PISTAGLTLRDMEALSSKVKTELEALYYQPSSATV |
Ga0187805_104939561 | 3300018007 | Freshwater Sediment | MRVGCPISTAGYGMRDLEALSEKVHQAMEELYYQPKPTQTA |
Ga0187810_101732891 | 3300018012 | Freshwater Sediment | IKCRPLEMRVGEPISTAGLAMRDMEALSATVQKALEDLYYRP |
Ga0187873_11584492 | 3300018013 | Peatland | RPLEMRVGEPISTAGMTMRDLETVSVKVKKAMEDLYYAQDPVQ |
Ga0187784_115810052 | 3300018062 | Tropical Peatland | EMRVGEPISTEGMAMRDLEALSAKVQKAVEELYYRS |
Ga0187784_116293842 | 3300018062 | Tropical Peatland | SRPLEMRVGEPISTAGLTLDDMGALSDRVRKAMEDLCYAGQPPRTS |
Ga0187772_102246623 | 3300018085 | Tropical Peatland | RVGEPISTAGLTTRDLEALSARVQKAMEDLYYSPFPVRS |
Ga0187772_107240172 | 3300018085 | Tropical Peatland | YHIKSRPLEMRVGRPISTAGLTLEDMGALSNRVRTAMEDLYDAGRSARTP |
Ga0187769_100787991 | 3300018086 | Tropical Peatland | PLEMRVGQPIPTAGLTTRDLEGLSNRVKAAMENLYYSEGCGAEEVC |
Ga0187770_117508011 | 3300018090 | Tropical Peatland | MNTYHIKSRPLEMRIGRPISTAGLTLEDMGALSNRVRTAMEDLYDAGRSARTP |
Ga0066662_112752702 | 3300018468 | Grasslands Soil | RVGEPISTAGYKPHDVAALSAKVQKAVEGLYYNRSET |
Ga0066662_123661191 | 3300018468 | Grasslands Soil | TYHVKCRPVEMRVGEPISTTGMTTHNIDALAARVQQEVEKLYYGASEPRH |
Ga0181508_12561841 | 3300019256 | Peatland | LEMRVGEPISTTGLTMRDLDALSTQVQAALEELYYRA |
Ga0210407_106457633 | 3300020579 | Soil | LLPMNTYHIKSRPLEMRVGAPISTAGLKGRDLQKLSARVQKAVEDLYYRA |
Ga0210407_106481172 | 3300020579 | Soil | TYHIKSRPLEMRVGEPISTASYGPREMEQLSARVKKAMEELYYS |
Ga0210407_109562412 | 3300020579 | Soil | MNTYHIKSRRLEMRVGEPIPTAGCSLDHMETLSENVHKAMEELYSAPGEVVLREKT |
Ga0210403_104517463 | 3300020580 | Soil | YHIKCRPLEMRVGDPISTAGLTMRDLEGVSEKVRRAMEELYYRA |
Ga0210395_102811781 | 3300020582 | Soil | MNTYHIKSRPLEMRVGEPISTASYGPREMEQLSAKVKKAMEDLYYS |
Ga0210395_104020881 | 3300020582 | Soil | KCRPLEMRVGEPISTTGLTMKDLESLSARVQKAVEDLYYR |
Ga0210401_111208941 | 3300020583 | Soil | HIKCRPLEMRVGEPISTAGLTMRDMEVVSAKVKKAMEDLYYAPTTLPN |
Ga0210406_105450341 | 3300021168 | Soil | LPMNTYHIKCRPLEMRVGKPISTAGRSLRDMDAISAEVKQAMEALARS |
Ga0210406_107469131 | 3300021168 | Soil | MRVGEPISTAGLTIRDMETLSAKVQAALEDLYYRP |
Ga0210396_110050521 | 3300021180 | Soil | KCRPLEMRVGEPISTAGLKMKDMEAVSEKVRKAMEELYYRA |
Ga0210388_104818892 | 3300021181 | Soil | NTYHIKCRPLEMRVGEPISTAGLTMRDMEAVSARVKKAMEDLYYAPTTLSTQICP |
Ga0210388_115175661 | 3300021181 | Soil | HIKCRPLEMRVGEPISTAGLTIRDMEAVSAKVRKAIEDLYYDA |
Ga0210385_106058011 | 3300021402 | Soil | PISTAGLTMRDLEAVSAKVKKALEDLYYATASAPA |
Ga0210397_106508442 | 3300021403 | Soil | LEMRVGEPISTNGLKARDLQMLSAQVQKAVEDLYYKK |
Ga0210386_107808501 | 3300021406 | Soil | EMRVGEPISTTGMTVRDLEGVSAKVRKAIEDLYYAKSPDPV |
Ga0210383_108560262 | 3300021407 | Soil | PISTAGLTIRDMEAVSEKVRKAMEDLYYADRAAPA |
Ga0210383_113439661 | 3300021407 | Soil | EMRVGEPISTAGMTMRDLEAVSARVKKAMEDLYYAA |
Ga0210394_102151053 | 3300021420 | Soil | CRPLEMRVGEPISTVGLKMKDLEVVSAKVRKAMEDLYYQK |
Ga0210384_102317181 | 3300021432 | Soil | LEMRVGDPISAAGLTMRDLEGVSEKVRRAMEELYYAPASPSA |
Ga0210391_112236022 | 3300021433 | Soil | CRPLEMRVGEPISTAGLTLRDLETLSERVKKAVEELYYRP |
Ga0187846_104793981 | 3300021476 | Biofilm | EPIATAGLKLDDMEALSARVQKAMEDLYCRGGLAQST |
Ga0210398_100632713 | 3300021477 | Soil | EMRVGEPISTTGMTVRDLETVSAKVRKAIEDLYYAKSPDPV |
Ga0210402_102469643 | 3300021478 | Soil | KCRPLEMRVGEPISTAGLTGRDLESLSARVQKAMEDLYYRI |
Ga0210409_109962721 | 3300021559 | Soil | NTYHIKCRPLEMRVGQPISTSGYTLRNMDVLSDRVHKAVVDLHERRVQ |
Ga0242662_100427321 | 3300022533 | Soil | IKCRPLEMRVGEPISTTGLTMKDLESLSARVQKAVQDLYYRP |
Ga0242674_10361691 | 3300022711 | Soil | TYHIKCRPLEMRVGEPISTAGMTMRDLEAASVKVRQEMEKLYYA |
Ga0242671_10774231 | 3300022714 | Soil | HIKCRPLEMRVGEPISTAGLTGKDLETLSARVQKAVEDLYYAPQ |
Ga0224552_10563941 | 3300022850 | Soil | EMRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA |
Ga0224558_11245181 | 3300023090 | Soil | PISTVGLKMRDLEAVSAKVQKAVEDLYYPQSPAGA |
Ga0137417_14970191 | 3300024330 | Vadose Zone Soil | MNTYHIKSQPLEMRVGDPISTAGLTGHDMQKLSEKVQKAVSDLYYQASQAKDPRQP |
Ga0208691_10067801 | 3300025612 | Peatland | LEMRVGEPISTTGLTMRDLEALSARVQKAVEELYYAPAS |
Ga0207692_103990841 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | HVKPRPLEMRVGKPISTQGLTLRDMDELSRRVQTAMEEMYYSA |
Ga0207650_100136427 | 3300025925 | Switchgrass Rhizosphere | MRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC |
Ga0207659_114480212 | 3300025926 | Miscanthus Rhizosphere | WLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC |
Ga0207704_110516991 | 3300025938 | Miscanthus Rhizosphere | RRLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC |
Ga0207641_104558882 | 3300026088 | Switchgrass Rhizosphere | CRPLEMRVGEPISTKGLKLHEMETLSAKVQKAVEDLYYSQSQLT |
Ga0207676_111073722 | 3300026095 | Switchgrass Rhizosphere | TYHIKCQPLQMRVGEPISTAGLKLQDMEDLSARVQRAMEDL |
Ga0209849_10875222 | 3300026215 | Soil | VEPISTAGCTRRDMDTLSAEVQAAMEELYYRAKPANPA |
Ga0209761_10463624 | 3300026313 | Grasslands Soil | MNTYHIKSRPLEMRVGEPISTAGYTLHDINTVSAKVQKAVEGLYYNRSET |
Ga0209131_13533081 | 3300026320 | Grasslands Soil | MNTYHIKCRPLEMRVGEPISTTGLKMRDLEAVSAKVRKAMEDLYYAESPVPE |
Ga0209375_11899142 | 3300026329 | Soil | IKPRPLEMRVGEPISTAGLKLRDMEALSAKVKKALEDLYYDH |
Ga0209648_105252882 | 3300026551 | Grasslands Soil | YHIKCRPLEMRVGEPISTAGLKMRDTEAVSEKVRKAMEDLYYQS |
Ga0209577_100888091 | 3300026552 | Soil | VGEPISTAVLTLDEMDTLSAKVQSAMEELYYANETP |
Ga0179587_103908601 | 3300026557 | Vadose Zone Soil | DTYHIKCRPLKMRVGRPISTSGYTLRNMEELSDRVHDAVVKLYTKSVAGE |
Ga0209734_10604511 | 3300027535 | Forest Soil | MNTYHIKCRPLEMRVGQPISTSGYTLRNMDALSERVHKAVVDLHERRVQ |
Ga0209219_10156191 | 3300027565 | Forest Soil | ALEMRVGEPISTTGLKGRDVQTLSAKVQKAVEDLYYRPV |
Ga0208042_10105471 | 3300027568 | Peatlands Soil | PLEMRVGEPISTAGLTMRDLEALSAKVQAALEELYYRR |
Ga0209525_11330672 | 3300027575 | Forest Soil | PLEMRVGEPISTAGMTMRDLDAASVKVRQEMEKLYYA |
Ga0209116_10085971 | 3300027590 | Forest Soil | TYHIKCRPLEMRVGEPISTAGLKMRDMEAVSAKVKKELEDLYSAESRVQE |
Ga0208044_10253843 | 3300027625 | Peatlands Soil | MRVGAPISTAGLTMKDLESLSAKVQKEMESLYYAERQ |
Ga0209007_10161923 | 3300027652 | Forest Soil | LLPMNTYHIKSRPLEMRVGAPISTAGLKGHDLQKLSARVQTAVEDLYYRA |
Ga0209007_10430911 | 3300027652 | Forest Soil | LLPMNTYHIKSRPLEMRVGAPISTAGLKGHDLQKLSARVQKAVEDLYYRA |
Ga0209009_10753631 | 3300027667 | Forest Soil | TYHIKCRPLEMRVGQPISTAGYSLRNMEELSDKVHRAVEDLYLKPVVSD |
Ga0209038_101046352 | 3300027737 | Bog Forest Soil | MRVGEPISTAGMTMRDLEAVSARVKKAMEDLYYAPSPSPA |
Ga0209580_101812911 | 3300027842 | Surface Soil | KCRPLEMRVGEPIATAGLAVRDLEAVSGTVQRALEKLYYEN |
Ga0209693_102007221 | 3300027855 | Soil | HIKCRPLEMRVGEPISTAGLAGKDLEALSAKVQKAVEDLYYA |
Ga0209693_102588873 | 3300027855 | Soil | CRPLEMRVGQPISTTGLTMRDLEAVSAKVRKAVEDLYYPQGEASA |
Ga0209167_103589852 | 3300027867 | Surface Soil | YHIKCRPLEMRVGEPISTAGLTLRDLEAFSAKVQKAVEDLYYS |
Ga0209579_101516952 | 3300027869 | Surface Soil | EMRVGEPISTAGLTMRDLESLSGRVQKAVEDLYHAPVSQPA |
Ga0209465_104517031 | 3300027874 | Tropical Forest Soil | LPMNTYHIKSRPLEMRVGAPIATAGLTMKDLPALSARVEKALEDLYYQE |
Ga0209169_102391652 | 3300027879 | Soil | MRVGEPISTAGMTMRDLEAVSGKVMQELQSLYYQA |
Ga0209067_101287163 | 3300027898 | Watersheds | PMNTYHIKCRPLEMRVGAPISTAGLTMKDLESLSARVQKAVEDLYYN |
Ga0209583_103318701 | 3300027910 | Watersheds | IKCRQLEMRVGEPISTAGLTGHDMQALSNRVQKAVEDLYESGSSVTNSPTSVPV |
Ga0209698_107715031 | 3300027911 | Watersheds | YHIKCRPLEMRVGEPISTAGMTVRDLEVISNKVQKALEDLYYQA |
Ga0209069_101124614 | 3300027915 | Watersheds | TYHIKSRPLEMRVGHPISTSGYTVRNMDALSDRVHAAVEDLYKSGFE |
Ga0265355_10193802 | 3300028036 | Rhizosphere | KCRPLEMRVGEPISTAGMTMRDLDAASVKVRQEMEKLYYA |
Ga0209526_109918141 | 3300028047 | Forest Soil | EPISTAGMTMRDLEAVSARVKKAMEELYYAPASQPA |
Ga0268264_100330735 | 3300028381 | Switchgrass Rhizosphere | IKPRRLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC |
Ga0302230_101855792 | 3300028871 | Palsa | VGEPISTAGLTMRDMDAVSAKVHKAIEDLYYAESPVPL |
Ga0308309_106404981 | 3300028906 | Soil | NTYHIKCRPLEMRVGEPISTAGMTMRDLEAVSGKVMQELQSLYYQA |
Ga0311327_106196202 | 3300029883 | Bog | RPLEMRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA |
Ga0311340_1000835714 | 3300029943 | Palsa | RVGEPISTAGLTMRDMDAVSAKVHKAIEDLYYAESPASA |
Ga0311339_102718473 | 3300029999 | Palsa | IKCRPLEMRVGEPISTAGLTLRDMETLSARVQKAVEELYYQP |
Ga0302270_105506661 | 3300030011 | Bog | YHIKCRPLEMRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA |
Ga0302282_10695001 | 3300030045 | Fen | CRPLEMRVGAPISTVGLTMRDMDAVSEKVRKAMEELYYRA |
Ga0302191_103687541 | 3300030049 | Bog | IKCRPLEMRVGAPISTVGLTMRDMDAVSEKVRKAMEELYYRA |
Ga0302177_107297571 | 3300030053 | Palsa | RPLEMRVGEPISTAGLTIRDMEALSAKVQKALEDLYSR |
Ga0302176_104505572 | 3300030057 | Palsa | EPISTVGLKMKDLEAVSARVRKAMEDLYYAESPVPA |
Ga0311353_1000457817 | 3300030399 | Palsa | EMRVGEPISTAGLTMRDMDAVSAKVHKAIEDLYYAESPASA |
Ga0311353_104157953 | 3300030399 | Palsa | LEMRVGEPIPTKGLTVRDLEALSQRVKTAMEKLYYAP |
Ga0311353_116154912 | 3300030399 | Palsa | RPLEMRVGKPISTAGLTLRDMETVSAKVHAAVEELYYA |
Ga0265460_123891671 | 3300030740 | Soil | PLEMRVGEPISTTGMTMRDLERVSGKVRTELERLYYQE |
Ga0265459_121409453 | 3300030741 | Soil | CRPLEMRVGEPISTVGLTMRDMEAVSAKVKKAMEDLYYAPALPST |
Ga0170834_1035746731 | 3300031057 | Forest Soil | HIKCRPLEMRVGEPISTAGLKLKDLEALSAKVQKAVEDLYYR |
Ga0265760_100110521 | 3300031090 | Soil | CRPLEMRVGEPISTAGLTMRDMEAVSAKVKKAMEDLYYAPTALST |
Ga0170822_167474181 | 3300031122 | Forest Soil | IKCRPLEMRVGEPISTTGLTLRDLEALSGRVKKAIEDLYYAS |
Ga0170824_1113637091 | 3300031231 | Forest Soil | HIKCRPLEMRVGEPISTTGLTLRDLEALSGRVKKAIEDLYYAS |
Ga0302323_1028924331 | 3300031232 | Fen | YHIKSRPLEMRVGEPISTAGLTLRDMEAVSAKVKAAIDDLRAAPSQQLQS |
Ga0170820_133144311 | 3300031446 | Forest Soil | KSRPIEMRVGEPIATAGLTLRDMDALSAKVQREMEGMYYAASDSGGN |
Ga0170818_1084499821 | 3300031474 | Forest Soil | ELLPMDTYHIKSRPLEMRVGAPIATAGLTLREMDALSARVQKEMEGMYYHTSDSAII |
Ga0311364_113328891 | 3300031521 | Fen | HIKCRPLEMRVGEPISTAGRTMRDLEAVSNQVEAAMKKLYYGS |
Ga0310686_1140028723 | 3300031708 | Soil | EMRVGEPISTAGLKMKDMEEVSAKVRKAMEDLYYAGSPVPA |
Ga0310686_1150446322 | 3300031708 | Soil | HIKCRPLEMRVGEPISTAGLTMRDTEAVSEKVKKAMEELYYAPSR |
Ga0265342_100508791 | 3300031712 | Rhizosphere | GEPISTVGLTMRDLEALSARVQAAVEDLYYSRLPASK |
Ga0307476_101291601 | 3300031715 | Hardwood Forest Soil | HIKCRPLEMRVGEPISTVGLKMRDLEAVSEKVRKAMEELYYGAAWPSV |
Ga0307469_105911102 | 3300031720 | Hardwood Forest Soil | TYHIKCRPLEMRVGKPISTAGLSGHDMNALSARVQKAVEDLYDGRAETT |
Ga0307477_105670272 | 3300031753 | Hardwood Forest Soil | KCRPLEMRVGEPISTAGLAMRDLEALSSKVQKAVEDLYYPENASSMI |
Ga0307477_106677541 | 3300031753 | Hardwood Forest Soil | VGDPISTAGLTMRDTEAVSEKVHKAIEDLYYEPSTLSASP |
Ga0307475_104226601 | 3300031754 | Hardwood Forest Soil | PLEMRVGEPISTEGLKVRDLAALSARVQKAVEDLYYKPS |
Ga0307475_110663162 | 3300031754 | Hardwood Forest Soil | PVSTAGLSMRDLEAVSAKVHKAMEDLYYADGRTST |
Ga0307478_105485913 | 3300031823 | Hardwood Forest Soil | HIKPRPLEMRVGEPISTTGLTLRDTEAVSAKVQEALEDLYYADPALAPLKELAP |
Ga0307478_115242251 | 3300031823 | Hardwood Forest Soil | KCRPLEMRVGEPISTSGLTMRDMEAVSEKVKKAMEDLYYQA |
Ga0318527_105029081 | 3300031859 | Soil | NTYHIKCQPLEMRVGAPISTEGLSGHDMQALSDKVQKAVTDLYAAS |
Ga0307479_102807491 | 3300031962 | Hardwood Forest Soil | IKSRPLEMRVGEPISTAGLSGHDMQALSEKVQKAVSDLYYGAPKSRPRQNT |
Ga0308173_110072931 | 3300032074 | Soil | HIKCRPLQMRVGEPISTTGLTMKDLPALSDRVQKAVEALYYRP |
Ga0307471_1031677932 | 3300032180 | Hardwood Forest Soil | TYHIKCHPLEMRVGSPISTAGLTGHDMQALSDKVQKAVSDLYYSHGS |
Ga0307472_1012225471 | 3300032205 | Hardwood Forest Soil | HIKCHPLEMRVGKPLSTAGLSGHDMNALSARVQKAVEDLYDGRAETT |
Ga0335085_107375282 | 3300032770 | Soil | KSRPLEMRVGEPISTTGLTLRDMQTLSAKVQKAMEDLYYRP |
Ga0335079_123131321 | 3300032783 | Soil | PMNTYHIKCRPLEMRVGEPISTVGTDLRHMEELSAKVEKALEDLYYR |
Ga0335070_109150722 | 3300032829 | Soil | RPLEMRLGQPISTTGMTVRDLDSLSTKVQTAMESLYYHSGPA |
Ga0335074_104901571 | 3300032895 | Soil | VGEPISTAGMTMGDLETVSRKVQAALEALYDPPSSVSQ |
Ga0335072_109524722 | 3300032898 | Soil | MDTYHIKCRPLEMRVGEPISTKGTTMADLETVSHRVHAALEALYYAPRPVSQ |
Ga0335077_101191541 | 3300033158 | Soil | YHIQSRPLEMRVGEPISTAGLTLDDMGALSDRVRKAMEDLYYLGQAPRTS |
Ga0334847_019213_604_726 | 3300033826 | Soil | MRVGEPISTIGLTVRDLEALSNKVRTALEKLYYSESSVSQ |
Ga0370483_0304479_6_164 | 3300034124 | Untreated Peat Soil | MNTYHIKCRPLEMRVGEPISTAGLSMRDMETVSAKVRKAMEELYYAPAPQSA |
Ga0370515_0520814_11_118 | 3300034163 | Untreated Peat Soil | MRVGEPISTAGMTMRDMEAVSEKVWKAMEDLYYAK |
Ga0370492_0331591_502_609 | 3300034282 | Untreated Peat Soil | MRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA |
Ga0373948_0136551_453_596 | 3300034817 | Rhizosphere Soil | MNTYHIKCRPLEMRVGQPISTAEYTLRNMEALSDKVHQAVEDLYKRG |
⦗Top⦘ |