Metagenome / Metatranscriptome Family F017631

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F017631
Family Type	Metagenome / Metatranscriptome
Number of Sequences	239
Average Sequence Length	39 residues
Representative Sequence	LYNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT
Number of Associated Samples	169
Number of Associated Scaffolds	239

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.27 %
% of genes near scaffold ends (potentially truncated)	95.82 %
% of genes from short scaffolds (< 2000 bps)	91.63 %
Associated GOLD sequencing projects	154
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (66.109 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.268 % of family members)
Environment Ontology (ENVO)	Unclassified (69.874 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (67.364 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 29.69% β-sheet: 0.00% Coil/Unstructured: 70.31%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 239 Family Scaffolds
PF02945	Endonuclease_7	0.84
PF01844	HNH	0.42
PF13649	Methyltransf_25	0.42
PF13385	Laminin_G_3	0.42

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
All Organisms	root	All Organisms	33.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
Viruses	superkingdom	All Organisms → Viruses	23.85 %
cellular organisms	root	All Organisms → cellular organisms	10.04 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	15.48 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	9.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	15.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	6.28 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	0.42 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	15.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.67 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.42 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.42 %
unclassified Euryarchaeota	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	15.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.26 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.42 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.42 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	14.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	1.26 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	0.42 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.42 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Escherichia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia	1.26 %
Pirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae	0.42 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.42 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	1.26 %
Rhodopirellula	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula	0.42 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.42 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	1.26 %
unclassified Rhodopirellula	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula	0.42 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.42 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.11 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.37 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	1.26 %
Rhodopirellula sp.	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp.	0.42 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.42 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.42 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000176\|TB03JUN2009E_c029101	Not Available	776	Open in IMG/M
3300001839\|RCM40_1019613	Not Available	661	Open in IMG/M
3300002092\|JGI24218J26658_1021327	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300002305\|B570J29619_1011370	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	683	Open in IMG/M
3300003823\|Ga0007875_1010628	Not Available	1121	Open in IMG/M
3300004460\|Ga0066222_1076992	Not Available	508	Open in IMG/M
3300004684\|Ga0065168_1064254	Not Available	578	Open in IMG/M
3300004685\|Ga0065177_1084861	Not Available	588	Open in IMG/M
3300004807\|Ga0007809_10116149	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
3300005525\|Ga0068877_10245589	All Organisms → cellular organisms → Bacteria	1054	Open in IMG/M
3300005581\|Ga0049081_10151829	All Organisms → cellular organisms → Bacteria	847	Open in IMG/M
3300005582\|Ga0049080_10223162	Not Available	619	Open in IMG/M
3300005582\|Ga0049080_10246664	Not Available	583	Open in IMG/M
3300006101\|Ga0007810_1042737	All Organisms → cellular organisms → Bacteria → Proteobacteria	958	Open in IMG/M
3300006104\|Ga0007882_10212002	Not Available	653	Open in IMG/M
3300006108\|Ga0007862_1011788	Not Available	2018	Open in IMG/M
3300006108\|Ga0007862_1087169	Not Available	595	Open in IMG/M
3300006110\|Ga0007871_1086331	Not Available	591	Open in IMG/M
3300006110\|Ga0007871_1093234	Not Available	568	Open in IMG/M
3300006123\|Ga0007852_1045000	Not Available	1049	Open in IMG/M
3300006123\|Ga0007852_1087994	Not Available	699	Open in IMG/M
3300006129\|Ga0007834_1125903	Not Available	527	Open in IMG/M
3300006637\|Ga0075461_10243736	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	528	Open in IMG/M
3300006802\|Ga0070749_10134645	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1445	Open in IMG/M
3300006802\|Ga0070749_10196067	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1158	Open in IMG/M
3300006802\|Ga0070749_10594479	Not Available	597	Open in IMG/M
3300006802\|Ga0070749_10646051	Not Available	568	Open in IMG/M
3300006810\|Ga0070754_10026654	All Organisms → Viruses → Predicted Viral	3285	Open in IMG/M
3300006810\|Ga0070754_10206691	All Organisms → cellular organisms → Bacteria → Proteobacteria	912	Open in IMG/M
3300006810\|Ga0070754_10247163	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	815	Open in IMG/M
3300006916\|Ga0070750_10038123	All Organisms → cellular organisms → Bacteria → Proteobacteria	2369	Open in IMG/M
3300007171\|Ga0102977_1001150	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp.	2288	Open in IMG/M
3300007516\|Ga0105050_10194100	Not Available	1275	Open in IMG/M
3300007520\|Ga0105054_10855827	Not Available	653	Open in IMG/M
3300007538\|Ga0099851_1055747	Not Available	1548	Open in IMG/M
3300007539\|Ga0099849_1205221	Not Available	740	Open in IMG/M
3300007540\|Ga0099847_1063086	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1154	Open in IMG/M
3300007541\|Ga0099848_1185615	Not Available	753	Open in IMG/M
3300007541\|Ga0099848_1201780	Not Available	713	Open in IMG/M
3300007960\|Ga0099850_1062625	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1570	Open in IMG/M
3300008012\|Ga0075480_10531246	Not Available	563	Open in IMG/M
3300008110\|Ga0114343_1033844	Not Available	2106	Open in IMG/M
3300008110\|Ga0114343_1205517	Not Available	564	Open in IMG/M
3300008266\|Ga0114363_1080335	All Organisms → Viruses → Predicted Viral	1217	Open in IMG/M
3300008266\|Ga0114363_1148817	All Organisms → Viruses → Predicted Viral	1143	Open in IMG/M
3300009037\|Ga0105093_10526128	Not Available	661	Open in IMG/M
3300009037\|Ga0105093_10797107	Not Available	549	Open in IMG/M
3300009068\|Ga0114973_10563754	Not Available	586	Open in IMG/M
3300009082\|Ga0105099_10935328	Not Available	549	Open in IMG/M
3300009149\|Ga0114918_10424615	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	721	Open in IMG/M
3300009151\|Ga0114962_10617463	Not Available	561	Open in IMG/M
3300009152\|Ga0114980_10653910	Not Available	591	Open in IMG/M
3300009155\|Ga0114968_10380517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	774	Open in IMG/M
3300009159\|Ga0114978_10749505	Not Available	553	Open in IMG/M
3300009161\|Ga0114966_10757848	Not Available	527	Open in IMG/M
3300009168\|Ga0105104_10868456	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	527	Open in IMG/M
3300009180\|Ga0114979_10216036	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1157	Open in IMG/M
3300009180\|Ga0114979_10337710	Not Available	890	Open in IMG/M
3300009181\|Ga0114969_10671052	Not Available	561	Open in IMG/M
3300009182\|Ga0114959_10445928	Not Available	629	Open in IMG/M
3300009182\|Ga0114959_10565647	Not Available	545	Open in IMG/M
3300009183\|Ga0114974_10087489	Not Available	2021	Open in IMG/M
3300009183\|Ga0114974_10387053	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	804	Open in IMG/M
3300009183\|Ga0114974_10614590	Not Available	598	Open in IMG/M
3300009184\|Ga0114976_10578460	Not Available	572	Open in IMG/M
3300010157\|Ga0114964_10029638	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3024	Open in IMG/M
3300010157\|Ga0114964_10181912	All Organisms → Viruses → Predicted Viral	1014	Open in IMG/M
3300010157\|Ga0114964_10293698	Not Available	771	Open in IMG/M
3300010158\|Ga0114960_10305107	Not Available	798	Open in IMG/M
3300010299\|Ga0129342_1160202	All Organisms → cellular organisms → Bacteria → Proteobacteria	816	Open in IMG/M
3300010300\|Ga0129351_1327778	Not Available	576	Open in IMG/M
3300010316\|Ga0136655_1136763	Not Available	733	Open in IMG/M
3300010334\|Ga0136644_10519727	Not Available	662	Open in IMG/M
3300010354\|Ga0129333_10135531	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2263	Open in IMG/M
3300010368\|Ga0129324_10259381	Not Available	691	Open in IMG/M
3300010389\|Ga0136549_10082011	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1563	Open in IMG/M
3300010389\|Ga0136549_10138378	All Organisms → Viruses → Predicted Viral	1106	Open in IMG/M
3300010885\|Ga0133913_10569140	Not Available	2978	Open in IMG/M
3300011010\|Ga0139557_1008829	Not Available	2017	Open in IMG/M
3300012012\|Ga0153799_1102638	Not Available	507	Open in IMG/M
3300012017\|Ga0153801_1047999	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	752	Open in IMG/M
3300012732\|Ga0157549_1186783	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1916	Open in IMG/M
3300013093\|Ga0164296_1066288	All Organisms → Viruses → Predicted Viral	1635	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10524075	Not Available	784	Open in IMG/M
3300017700\|Ga0181339_1034285	Not Available	555	Open in IMG/M
3300017701\|Ga0181364_1046970	Not Available	680	Open in IMG/M
3300017707\|Ga0181363_1068183	Not Available	618	Open in IMG/M
3300017716\|Ga0181350_1075074	Not Available	862	Open in IMG/M
3300017716\|Ga0181350_1080985	Not Available	821	Open in IMG/M
3300017716\|Ga0181350_1123420	Not Available	620	Open in IMG/M
3300017716\|Ga0181350_1142711	Not Available	563	Open in IMG/M
3300017716\|Ga0181350_1165473	Not Available	511	Open in IMG/M
3300017722\|Ga0181347_1125776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	714	Open in IMG/M
3300017722\|Ga0181347_1166127	Not Available	596	Open in IMG/M
3300017723\|Ga0181362_1029431	All Organisms → Viruses → Predicted Viral	1171	Open in IMG/M
3300017723\|Ga0181362_1110826	Not Available	541	Open in IMG/M
3300017723\|Ga0181362_1125221	Not Available	502	Open in IMG/M
3300017736\|Ga0181365_1053953	All Organisms → Viruses → Predicted Viral	1002	Open in IMG/M
3300017754\|Ga0181344_1087199	Not Available	913	Open in IMG/M
3300017754\|Ga0181344_1127382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	732	Open in IMG/M
3300017754\|Ga0181344_1133749	Not Available	711	Open in IMG/M
3300017754\|Ga0181344_1135054	Not Available	707	Open in IMG/M
3300017754\|Ga0181344_1182679	Not Available	592	Open in IMG/M
3300017761\|Ga0181356_1128947	Not Available	800	Open in IMG/M
3300017761\|Ga0181356_1223728	Not Available	547	Open in IMG/M
3300017766\|Ga0181343_1127926	Not Available	712	Open in IMG/M
3300017774\|Ga0181358_1248869	Not Available	560	Open in IMG/M
3300017774\|Ga0181358_1265351	Not Available	535	Open in IMG/M
3300017777\|Ga0181357_1117747	All Organisms → cellular organisms → Bacteria → Proteobacteria	998	Open in IMG/M
3300017777\|Ga0181357_1251747	Not Available	613	Open in IMG/M
3300017777\|Ga0181357_1292870	Not Available	555	Open in IMG/M
3300017778\|Ga0181349_1088290	All Organisms → Viruses → Predicted Viral	1173	Open in IMG/M
3300017778\|Ga0181349_1274255	Not Available	555	Open in IMG/M
3300017778\|Ga0181349_1297696	Not Available	524	Open in IMG/M
3300017778\|Ga0181349_1316644	Not Available	502	Open in IMG/M
3300017780\|Ga0181346_1125221	All Organisms → cellular organisms → Bacteria	981	Open in IMG/M
3300017780\|Ga0181346_1298058	Not Available	548	Open in IMG/M
3300017784\|Ga0181348_1038991	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1975	Open in IMG/M
3300017784\|Ga0181348_1232457	Not Available	646	Open in IMG/M
3300017785\|Ga0181355_1083678	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1331	Open in IMG/M
3300017785\|Ga0181355_1319719	Not Available	578	Open in IMG/M
3300017785\|Ga0181355_1362262	Not Available	531	Open in IMG/M
3300017963\|Ga0180437_11067029	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	577	Open in IMG/M
3300018420\|Ga0181563_10684809	Not Available	566	Open in IMG/M
3300019783\|Ga0181361_109210	Not Available	767	Open in IMG/M
3300019783\|Ga0181361_113568	Not Available	640	Open in IMG/M
3300019784\|Ga0181359_1010861	All Organisms → Viruses → Predicted Viral	3250	Open in IMG/M
3300019784\|Ga0181359_1064194	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1401	Open in IMG/M
3300020179\|Ga0194134_10290181	Not Available	650	Open in IMG/M
3300020200\|Ga0194121_10142750	Not Available	1404	Open in IMG/M
3300020204\|Ga0194116_10501278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	571	Open in IMG/M
3300021129\|Ga0214179_1042081	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300021139\|Ga0214166_1073239	Not Available	705	Open in IMG/M
3300021424\|Ga0194117_10503961	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	540	Open in IMG/M
3300021961\|Ga0222714_10126252	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1571	Open in IMG/M
3300021962\|Ga0222713_10161063	All Organisms → Viruses → Predicted Viral	1538	Open in IMG/M
3300021962\|Ga0222713_10557542	Not Available	675	Open in IMG/M
3300022057\|Ga0212025_1029480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	920	Open in IMG/M
3300022167\|Ga0212020_1078806	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	553	Open in IMG/M
3300022190\|Ga0181354_1049381	All Organisms → Viruses → Predicted Viral	1401	Open in IMG/M
3300022190\|Ga0181354_1073609	All Organisms → cellular organisms → Bacteria	1131	Open in IMG/M
3300022190\|Ga0181354_1081580	Not Available	1066	Open in IMG/M
3300022190\|Ga0181354_1099662	Not Available	947	Open in IMG/M
3300022190\|Ga0181354_1214336	Not Available	566	Open in IMG/M
3300022190\|Ga0181354_1214932	Not Available	565	Open in IMG/M
3300022190\|Ga0181354_1251603	Not Available	503	Open in IMG/M
3300022198\|Ga0196905_1165738	Not Available	564	Open in IMG/M
3300022407\|Ga0181351_1060170	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1563	Open in IMG/M
3300022407\|Ga0181351_1189033	Not Available	700	Open in IMG/M
3300022407\|Ga0181351_1234076	Not Available	585	Open in IMG/M
3300022839\|Ga0222649_1014896	Not Available	1088	Open in IMG/M
3300025162\|Ga0209083_1130625	Not Available	975	Open in IMG/M
3300025353\|Ga0208255_110015	Not Available	885	Open in IMG/M
3300025353\|Ga0208255_117854	Not Available	634	Open in IMG/M
3300025357\|Ga0208383_1013086	Not Available	1030	Open in IMG/M
3300025375\|Ga0208259_1012782	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1297	Open in IMG/M
3300025379\|Ga0208738_1052665	Not Available	581	Open in IMG/M
3300025407\|Ga0208378_1023505	Not Available	1115	Open in IMG/M
3300025410\|Ga0208875_1036775	Not Available	792	Open in IMG/M
3300025411\|Ga0208865_1041210	Not Available	748	Open in IMG/M
3300025417\|Ga0208616_1029168	Not Available	838	Open in IMG/M
3300025421\|Ga0207958_1029029	Not Available	869	Open in IMG/M
3300025424\|Ga0208617_1081835	Not Available	533	Open in IMG/M
3300025429\|Ga0208500_1018625	Not Available	925	Open in IMG/M
3300025598\|Ga0208379_1106076	Not Available	666	Open in IMG/M
3300025616\|Ga0208613_1096213	Not Available	670	Open in IMG/M
3300025647\|Ga0208160_1049930	Not Available	1193	Open in IMG/M
3300025652\|Ga0208134_1041682	All Organisms → Viruses → Predicted Viral	1522	Open in IMG/M
3300025652\|Ga0208134_1167013	Not Available	540	Open in IMG/M
3300025698\|Ga0208771_1172505	Not Available	586	Open in IMG/M
3300025781\|Ga0208386_1035773	Not Available	701	Open in IMG/M
3300025889\|Ga0208644_1287682	Not Available	659	Open in IMG/M
3300025889\|Ga0208644_1335866	Not Available	583	Open in IMG/M
3300026187\|Ga0209929_1118797	Not Available	670	Open in IMG/M
3300027396\|Ga0255146_1114958	Not Available	550	Open in IMG/M
3300027499\|Ga0208788_1079631	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	810	Open in IMG/M
3300027608\|Ga0208974_1001307	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	9804	Open in IMG/M
3300027608\|Ga0208974_1144569	Not Available	607	Open in IMG/M
3300027659\|Ga0208975_1022269	All Organisms → Viruses → Predicted Viral	2070	Open in IMG/M
3300027659\|Ga0208975_1083276	All Organisms → cellular organisms → Bacteria → Proteobacteria	944	Open in IMG/M
3300027708\|Ga0209188_1314236	Not Available	517	Open in IMG/M
3300027732\|Ga0209442_1253299	Not Available	628	Open in IMG/M
3300027733\|Ga0209297_1163637	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	906	Open in IMG/M
3300027736\|Ga0209190_1009432	All Organisms → cellular organisms → Bacteria → Proteobacteria	5901	Open in IMG/M
3300027741\|Ga0209085_1065827	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1649	Open in IMG/M
3300027747\|Ga0209189_1049436	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2042	Open in IMG/M
3300027749\|Ga0209084_1117992	All Organisms → cellular organisms → Bacteria → Proteobacteria	1146	Open in IMG/M
3300027749\|Ga0209084_1203552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	795	Open in IMG/M
3300027749\|Ga0209084_1362904	Not Available	528	Open in IMG/M
3300027759\|Ga0209296_1130464	All Organisms → Viruses → Predicted Viral	1156	Open in IMG/M
3300027759\|Ga0209296_1367990	Not Available	548	Open in IMG/M
3300027760\|Ga0209598_10242814	Not Available	734	Open in IMG/M
3300027772\|Ga0209768_10271120	Not Available	726	Open in IMG/M
3300027798\|Ga0209353_10155825	All Organisms → Viruses → Predicted Viral	1016	Open in IMG/M
3300027798\|Ga0209353_10367853	Not Available	597	Open in IMG/M
3300027892\|Ga0209550_10368782	Not Available	898	Open in IMG/M
3300027893\|Ga0209636_10804380	Not Available	719	Open in IMG/M
3300027896\|Ga0209777_10443307	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	969	Open in IMG/M
3300027896\|Ga0209777_10596231	Not Available	800	Open in IMG/M
3300027917\|Ga0209536_101235875	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	915	Open in IMG/M
3300027969\|Ga0209191_1033056	All Organisms → Viruses → Predicted Viral	2466	Open in IMG/M
3300027969\|Ga0209191_1256873	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	663	Open in IMG/M
3300027973\|Ga0209298_10090920	All Organisms → Viruses → Predicted Viral	1344	Open in IMG/M
3300027976\|Ga0209702_10097645	Not Available	1395	Open in IMG/M
3300028086\|Ga0255201_1007418	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1906	Open in IMG/M
3300028393\|Ga0304728_1102448	Not Available	1093	Open in IMG/M
3300028393\|Ga0304728_1181402	Not Available	742	Open in IMG/M
3300028393\|Ga0304728_1296554	Not Available	525	Open in IMG/M
3300029932\|Ga0119933_1043646	Not Available	552	Open in IMG/M
3300031539\|Ga0307380_10234748	Not Available	1744	Open in IMG/M
3300031578\|Ga0307376_10555126	Not Available	736	Open in IMG/M
3300031669\|Ga0307375_10149697	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	1617	Open in IMG/M
3300031759\|Ga0316219_1273172	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	586	Open in IMG/M
3300031787\|Ga0315900_10464253	Not Available	974	Open in IMG/M
3300031787\|Ga0315900_11015436	Not Available	543	Open in IMG/M
3300031999\|Ga0315274_11421879	Not Available	666	Open in IMG/M
3300032053\|Ga0315284_11185842	Not Available	840	Open in IMG/M
3300032118\|Ga0315277_10822485	All Organisms → cellular organisms → Bacteria → Proteobacteria	874	Open in IMG/M
3300032173\|Ga0315268_12279567	Not Available	555	Open in IMG/M
3300032435\|Ga0335398_10240304	Not Available	1603	Open in IMG/M
3300032560\|Ga0316223_1034881	All Organisms → Viruses → Predicted Viral	2132	Open in IMG/M
3300032560\|Ga0316223_1216229	Not Available	606	Open in IMG/M
3300032561\|Ga0316222_1135508	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	935	Open in IMG/M
3300032562\|Ga0316226_1385966	Not Available	514	Open in IMG/M
3300032605\|Ga0316232_1077481	Not Available	1555	Open in IMG/M
3300032605\|Ga0316232_1337307	Not Available	553	Open in IMG/M
3300032675\|Ga0316225_1198021	Not Available	625	Open in IMG/M
3300032677\|Ga0316227_1187666	Not Available	732	Open in IMG/M
3300033233\|Ga0334722_10229676	All Organisms → Viruses → Predicted Viral	1367	Open in IMG/M
3300033993\|Ga0334994_0145231	Not Available	1340	Open in IMG/M
3300033993\|Ga0334994_0410272	Not Available	652	Open in IMG/M
3300034062\|Ga0334995_0158958	Not Available	1620	Open in IMG/M
3300034092\|Ga0335010_0695856	Not Available	501	Open in IMG/M
3300034105\|Ga0335035_0709449	Not Available	515	Open in IMG/M
3300034112\|Ga0335066_0505977	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	640	Open in IMG/M
3300034121\|Ga0335058_0765278	Not Available	528	Open in IMG/M
3300034272\|Ga0335049_0079341	Not Available	2408	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.33%
Terrestrial	Environmental → Terrestrial	1.67%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	80.33%
Marine	Environmental → Aquatic → Marine	15.48%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	1.67%
Soil	Environmental → Terrestrial → Soil	1.26%
Sediment	Environmental → Aquatic → Sediment	0.84%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.42%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	46.44%
Lake	Environmental → Aquatic → Freshwater → Lake	27.62%
Coastal	Environmental → Aquatic → Marine → Coastal	12.55%
Ice	Environmental → Aquatic → Freshwater → Ice	2.09%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.67%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.26%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.26%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	1.26%
Clay	Environmental → Terrestrial → Soil → Clay	1.26%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.84%
River	Environmental → Aquatic → Freshwater → River	0.84%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.84%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.42%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.42%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.42%
Hypersaline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline	0.42%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.42%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	39.75%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	25.52%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	12.55%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	3.77%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.09%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.09%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.67%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	1.67%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	1.26%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.26%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	1.26%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	1.26%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.84%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.84%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.84%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.84%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.42%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.42%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.42%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.42%
Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment	0.42%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.42%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	24.27%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	16.32%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	11.72%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	10.04%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	4.60%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	3.77%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.93%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.09%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.09%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	2.09%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.67%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.67%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.67%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	1.67%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.26%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.26%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	1.26%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.84%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.84%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.84%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	0.84%
Marine Methane Seep Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment	0.84%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.42%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.42%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.42%
Drinking Water Treatment Plant	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant	0.42%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.42%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	0.42%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	0.42%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.42%
Saline Lake	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake	0.42%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	0.42%
Pond Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water	0.42%
Hypersaline Lake Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment	0.42%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.42%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000176	Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion	Environmental	Open in IMG/M
3300001839	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b	Environmental	Open in IMG/M
3300002092	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome	Environmental	Open in IMG/M
3300002305	Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion	Environmental	Open in IMG/M
3300003823	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09	Environmental	Open in IMG/M
3300004460	Marine viral communities from Newfoundland, Canada BC-1	Environmental	Open in IMG/M
3300004684	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)	Environmental	Open in IMG/M
3300004685	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)	Environmental	Open in IMG/M
3300004807	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300006101	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09	Environmental	Open in IMG/M
3300006104	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1	Environmental	Open in IMG/M
3300006108	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07	Environmental	Open in IMG/M
3300006110	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09	Environmental	Open in IMG/M
3300006123	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08	Environmental	Open in IMG/M
3300006129	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07	Environmental	Open in IMG/M
3300006637	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006810	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01	Environmental	Open in IMG/M
3300006916	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24	Environmental	Open in IMG/M
3300007171	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007516	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01	Environmental	Open in IMG/M
3300007520	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007539	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG	Environmental	Open in IMG/M
3300007540	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300007960	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG	Environmental	Open in IMG/M
3300008012	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300009037	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009149	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010299	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA	Environmental	Open in IMG/M
3300010300	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA	Environmental	Open in IMG/M
3300010316	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300010389	Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012732	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013093	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG	Environmental	Open in IMG/M
3300013137 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m	Environmental	Open in IMG/M
3300017700	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017963	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG	Environmental	Open in IMG/M
3300018420	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019783	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020179	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m	Environmental	Open in IMG/M
3300020200	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m	Environmental	Open in IMG/M
3300020204	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface	Environmental	Open in IMG/M
3300021129	Freshwater microbial communities from Trout Bog Lake, WI - 01OCT2007 epilimnion	Environmental	Open in IMG/M
3300021138	Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion	Environmental	Open in IMG/M
3300021139	Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion	Environmental	Open in IMG/M
3300021424	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300022057	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)	Environmental	Open in IMG/M
3300022167	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022198	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022839	Saline water microbial communities from Ace Lake, Antarctica - #337	Environmental	Open in IMG/M
3300025162	Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)	Environmental	Open in IMG/M
3300025353	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes)	Environmental	Open in IMG/M
3300025357	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)	Environmental	Open in IMG/M
3300025375	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)	Environmental	Open in IMG/M
3300025379	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)	Environmental	Open in IMG/M
3300025407	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes)	Environmental	Open in IMG/M
3300025410	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes)	Environmental	Open in IMG/M
3300025411	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes)	Environmental	Open in IMG/M
3300025417	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes)	Environmental	Open in IMG/M
3300025421	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes)	Environmental	Open in IMG/M
3300025424	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes)	Environmental	Open in IMG/M
3300025429	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes)	Environmental	Open in IMG/M
3300025598	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes)	Environmental	Open in IMG/M
3300025616	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes)	Environmental	Open in IMG/M
3300025647	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300025652	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)	Environmental	Open in IMG/M
3300025698	Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes)	Environmental	Open in IMG/M
3300025781	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes)	Environmental	Open in IMG/M
3300025889	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)	Environmental	Open in IMG/M
3300026187	Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)	Environmental	Open in IMG/M
3300027396	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h	Environmental	Open in IMG/M
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027760	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027893	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027973	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027976	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)	Environmental	Open in IMG/M
3300028086	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h	Environmental	Open in IMG/M
3300028393	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)	Environmental	Open in IMG/M
3300029932	Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031578	Soil microbial communities from Risofladan, Vaasa, Finland - TR-2	Environmental	Open in IMG/M
3300031669	Soil microbial communities from Risofladan, Vaasa, Finland - TR-1	Environmental	Open in IMG/M
3300031759	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032435	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly)	Environmental	Open in IMG/M
3300032560	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009	Environmental	Open in IMG/M
3300032561	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011	Environmental	Open in IMG/M
3300032562	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017	Environmental	Open in IMG/M
3300032605	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13	Environmental	Open in IMG/M
3300032675	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015	Environmental	Open in IMG/M
3300032677	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
TB03JUN2009E_0291011	3300000176	Freshwater	ADMVALYEKRYTEALALAKRLGDGMERQDAYRSGQFRQAVT*
RCM40_10196131	3300001839	Marine Plankton	LYNQKYMEALALAKRLGDGLERSDAYRSGQYRAAP
JGI24218J26658_10213271	3300002092	Lentic	FMKGEQDMMTLYNQKYVEALALAKRLGDGMERQDAYRTPQFREAVT*
B570J29619_10113701	3300002305	Freshwater	MKGETDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT*
Ga0007875_10106284	3300003823	Freshwater	EQDMFTIYNQKYTEALALAKRLGDGMERQDAYRNGQYRQKVT*
Ga0066222_10769923	3300004460	Marine	KGEQDMMALYNQKFAQAIALAKRLGDGLERRDAYRDGQLRVDVS*
Ga0065168_10642542	3300004684	Freshwater	MVKLYTDRYMEALALAKRLGDGMERTDAYRTGQYSQAVK*
Ga0065177_10848612	3300004685	Freshwater	MFTIYNQKYTEALALAKRLGDGMERRDAYRSGQTRIDVS*
Ga0007809_101161493	3300004807	Freshwater	DMMALYNQKYIEALALAKRLGDGMERQDAYRTPQFRQAVT*
Ga0068877_102455893	3300005525	Freshwater Lake	LYNTKYAEALAMAKRLGDGMERQDAYRSGQYRQAVT*
Ga0049081_101518291	3300005581	Freshwater Lentic	YNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT*
Ga0049080_102231621	3300005582	Freshwater Lentic	ETDMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQVVT*
Ga0049080_102466641	3300005582	Freshwater Lentic	ETDMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQAVT*
Ga0007810_10427371	3300006101	Freshwater	EQDLVQLYNGKYVEALAQAKRLGDGLERQDAFRSGQYRQKVE*
Ga0007882_102120023	3300006104	Freshwater	MMALYNQKYIEALALAKRLGDGLERQDSYRDGQFRQVVT*
Ga0007862_10117881	3300006108	Freshwater	LYDGKYKEALGQAKRLGDGLERQDAYRSGQYRQQVT*
Ga0007862_10871692	3300006108	Freshwater	YNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT*
Ga0007871_10863311	3300006110	Freshwater	EADLVTLYNTKYTEALAEAKRLGDALERQDAYRSGQYRQAVT*
Ga0007871_10932342	3300006110	Freshwater	NQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT*
Ga0007852_10450003	3300006123	Freshwater	YNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT*
Ga0007852_10879941	3300006123	Freshwater	LYDKKYNEALAIAKRLGDGMERQDAYRSGQYRQAVT*
Ga0007834_11259032	3300006129	Freshwater	TDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT*
Ga0075461_102437362	3300006637	Aqueous	DVLANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN*
Ga0070749_101346453	3300006802	Aqueous	MTAYDAKYKEALALAKRLGDGLERQDSYRSGQYRQAVT*
Ga0070749_101960673	3300006802	Aqueous	VIAQYTKRYEEAIMLAKRLGDGMDRRDSYRSGQLRVPVN*
Ga0070749_105944791	3300006802	Aqueous	YNTKYTEALALAKRLGDGMERQDAYRSGQYRQAVT*
Ga0070749_106460513	3300006802	Aqueous	YDGKFKEAVALAQRLGDGLERQDAYRSGQARVQVT*
Ga0070754_100266541	3300006810	Aqueous	NTKFNEGIQLAKRLGDGLERQDAYRSGQVRVPVT*
Ga0070754_102066913	3300006810	Aqueous	YNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN*
Ga0070754_102471631	3300006810	Aqueous	PDVLANYQNRYNEALMLAKRMGDGMERQDAYRSGQVRVPVT*
Ga0070750_100381231	3300006916	Aqueous	NKRYEEAMILAKRLGDGMERRDAYRSGQTRMSVN*
Ga0102977_10011501	3300007171	Freshwater Lake	QTQYENKYKEAILLAKRLGDGMERQDAYRSGQARIPVT*
Ga0105050_101941001	3300007516	Freshwater	DMMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN*
Ga0105054_108558272	3300007520	Freshwater	EADLLTLYNTKYNEALQLAKRLGDGLERQDSYRSGQVRIPVI*
Ga0099851_10557475	3300007538	Aqueous	KGDADLMTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT*
Ga0099849_12052211	3300007539	Aqueous	GDADLMTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT*
Ga0099847_10630861	3300007540	Aqueous	AYNKRYEEAMILLKRLGDGMERRDAYRSGQVRMTVN*
Ga0099848_11856151	3300007541	Aqueous	MTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT*
Ga0099848_12017801	3300007541	Aqueous	NKRYEEAMILLKRLGDGMERRDAYRSGQVRMSVN*
Ga0099850_10626251	3300007960	Aqueous	AYNAKYNEALQLAKRLGDGLERQDSYRSGQVRVPVT*
Ga0075480_105312461	3300008012	Aqueous	QLYNAKYNEALQLAKRLGDGLERQDSYRSGQVRVPVT*
Ga0114343_10338445	3300008110	Freshwater, Plankton	MKGEQDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT*
Ga0114343_12055171	3300008110	Freshwater, Plankton	DTKFKEALALAKRLGDGMERQDAYRSGQFRQAVT*
Ga0114363_10803351	3300008266	Freshwater, Plankton	YNQKYMEAMALAKRLGDGMERQDAYRSGQFRQKVT*
Ga0114363_11488171	3300008266	Freshwater, Plankton	DGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT*
Ga0105093_105261283	3300009037	Freshwater Sediment	ALYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT*
Ga0105093_107971071	3300009037	Freshwater Sediment	TALYNGKYTEALALAKRLGDGMERQDAYRSGQYRQAVT*
Ga0114973_105637541	3300009068	Freshwater Lake	MKGEVDMMGLYNQKFIEALALAKRLGDGMERQDAYRSGQFRQVVT*
Ga0105099_109353281	3300009082	Freshwater Sediment	GEQDMLTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT*
Ga0114918_104246151	3300009149	Deep Subsurface	INNYEKRYNEALLLAKRLGDGMERQDAYRSGQFRMDVQ*
Ga0114962_106174631	3300009151	Freshwater Lake	EQDLIALYDGKYKEALGLAKRLGDGLERQDAYRSGQFRQAVT*
Ga0114980_106539101	3300009152	Freshwater Lake	MKGETDMMQLYDGKYKEAVALAKRLGDGLERQDAYRSGQLRVKVT*
Ga0114968_103805173	3300009155	Freshwater Lake	EQDMITLYNTKFGETLIQLKRLGDGLERQDAYRSGQVRTQVN*
Ga0114977_103337914	3300009158	Freshwater Lake	KGEADMVALYSGRYQESLALAKRLGDGLEKQDSYRSGTYRVDVR*
Ga0114978_107495051	3300009159	Freshwater Lake	MMALYDGKYKEALALAKRLGDGMERQDAYRSGQVRINVT*
Ga0114966_107578482	3300009161	Freshwater Lake	DMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQAVT*
Ga0105104_108684561	3300009168	Freshwater Sediment	KQRYEEALLMAKRLGDGMERTDAYRAGQARYQVV*
Ga0114979_102160361	3300009180	Freshwater Lake	KGEPDLVALYRQKYVEALALAKRLGDGMERQDAYRSGQLRVEVS*
Ga0114979_103377101	3300009180	Freshwater Lake	DMMALYNGKYTEALALAKRLGDGMERQDAYRSGQFRQAVT*
Ga0114969_106710522	3300009181	Freshwater Lake	DMMGLYNQKFIEALALAKRLGDGMERQDAYRSGQFRQVVT*
Ga0114959_104459283	3300009182	Freshwater Lake	ITLYDTKYKEALALAKRLGDGMERQDAYRTGQYRQAVT*
Ga0114959_105656471	3300009182	Freshwater Lake	YDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT*
Ga0114974_100874895	3300009183	Freshwater Lake	VAMYQQRYMEALMLAKRLGDGMERRDAYRSGQVRAEVP*
Ga0114974_103870533	3300009183	Freshwater Lake	ITAYNTKYMEALAMAKRLGDGMERQDAYRSGQYRQKVT*
Ga0114974_106145901	3300009183	Freshwater Lake	MMQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQRVT*
Ga0114976_105784601	3300009184	Freshwater Lake	LYDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT*
Ga0114964_100296386	3300010157	Freshwater Lake	DMMALYDGKYKEALMLAKRLGDGLERQDAYRSGQVRIPVQ*
Ga0114964_101819124	3300010157	Freshwater Lake	YDGKYKEALGLAKRLGDGLERQDAYRSGQYRQKVT*
Ga0114964_102936981	3300010157	Freshwater Lake	QLYDAKYKEAVALAKRLGDGLERQDAYRSGQYRQKVN*
Ga0114960_103051071	3300010158	Freshwater Lake	ALYDGKYKEALAMAKRLGDGMERQDAYRSGQYRQAVT*
Ga0129342_11602023	3300010299	Freshwater To Marine Saline Gradient	LLNLYNGKFSEALQMAKRLGDGLEKQDAYRSGQPKVPVN*
Ga0129351_13277782	3300010300	Freshwater To Marine Saline Gradient	EPDLLQLYNTKFNEGIQLAKRLGDGLERQDAYRSGQVRVPVT*
Ga0136655_11367633	3300010316	Freshwater To Marine Saline Gradient	YTGKYQEALALAKRLGDGMERQDAYRSGQVRVQVT*
Ga0136644_105197271	3300010334	Freshwater Lake	ADLITVYDTKYKEALALAKRLGDGLERQDAYRSGQFRQAVT*
Ga0129333_101355316	3300010354	Freshwater To Marine Saline Gradient	YNGKYNEALALAKRLGDGMERGDAYRSGQFRQAVT*
Ga0129324_102593811	3300010368	Freshwater To Marine Saline Gradient	TQYDNKYKEAVLLAKRLGDGMERQDAYRSGQARIPVT*
Ga0136549_100820115	3300010389	Marine Methane Seep Sediment	VLANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN*
Ga0136549_101383781	3300010389	Marine Methane Seep Sediment	VLANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMAVN*
Ga0133913_105691405	3300010885	Freshwater Lake	YNQKYMEALALAKRLGDGMERQDAYRSGQFRQAVT*
Ga0139557_10088291	3300011010	Freshwater	MMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT*
Ga0153799_11026381	3300012012	Freshwater	GLYNTKYMEAMALAKRLGDGMERQDAYRSGQFRQAVT*
Ga0153801_10479991	3300012017	Freshwater	YDGKYKEALGQLKRLGDGLERQDSYRSGQYRQAVT*
Ga0157549_11867831	3300012732	Freshwater	LAQYQKRYDDALMMAKRLGDGMERGDAYRDGQYKQKVV*
Ga0164296_10662881	3300013093	Freshwater	IIALYDQKYMEAVAQAKRLGDGLERQDAYRSGQYRQPVT*
(restricted) Ga0172375_105240751	3300013137	Freshwater	AKRYEEAMILAKRMGDGMMRRDAYRSGQVRMTVN*
Ga0181339_10342852	3300017700	Freshwater Lake	DMMALYNQKFMEALALAKRLGDGLERQDAYRSGQFRQKVT
Ga0181364_10469703	3300017701	Freshwater Lake	MQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181363_10681831	3300017707	Freshwater Lake	MQLYDGKFKEALQLAVKLGDGLERRDSYRNGQFRVEL
Ga0181350_10750744	3300017716	Freshwater Lake	LAVYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQRVT
Ga0181350_10809851	3300017716	Freshwater Lake	ALYNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0181350_11234203	3300017716	Freshwater Lake	LGLYEGKYKEALALAKRLGDGLERQDAYRSGQFRQAVT
Ga0181350_11427111	3300017716	Freshwater Lake	GLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181350_11654731	3300017716	Freshwater Lake	MMTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQRVT
Ga0181347_11257763	3300017722	Freshwater Lake	YNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0181347_11661272	3300017722	Freshwater Lake	DMVALYNQKYMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181362_10294311	3300017723	Freshwater Lake	DDGKYKEALILAKRLGDGMERQDAYRSGQYRQAVT
Ga0181362_11108261	3300017723	Freshwater Lake	LYNQKFIEALALAKRLGDGLERQDAYRSGQFRQVVT
Ga0181362_11252212	3300017723	Freshwater Lake	QLYNTKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181365_10539534	3300017736	Freshwater Lake	RYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181344_10871991	3300017754	Freshwater Lake	MMALYNQKYMEAVVLAKRLADGLERQDAYRSGQFRQAVK
Ga0181344_11273821	3300017754	Freshwater Lake	GENNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181344_11337491	3300017754	Freshwater Lake	TLYDGKYKEALAMAKRLGDGMERQDAYRSGQYRQAVT
Ga0181344_11350543	3300017754	Freshwater Lake	LYDTKFKEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181344_11826792	3300017754	Freshwater Lake	YNGKFMEALALAKRLGDGMERQDAYRSGQFRQRVT
Ga0181356_11289471	3300017761	Freshwater Lake	ALYNQKFMEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0181356_12237281	3300017761	Freshwater Lake	ITYQKKYEEAVAQAKRLGDGMERQDAYRSGQYRQAVT
Ga0181343_11279263	3300017766	Freshwater Lake	KGEQDMMTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181358_12488691	3300017774	Freshwater Lake	IILGYDAKYKEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181358_12653512	3300017774	Freshwater Lake	IGLYEGKYKEALALAKRLGDGLERQDAYRSGQYRQAVT
Ga0181357_11177473	3300017777	Freshwater Lake	DMIGLYEKKYQDALMLAKRLGDGMERRDAYRSGQARVDVQ
Ga0181357_12517472	3300017777	Freshwater Lake	GETDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181357_12928701	3300017777	Freshwater Lake	MKGEVDMMGLYNQKFIEALALAKRLGDGMERQDAYRSGQFRQVVT
Ga0181349_10882903	3300017778	Freshwater Lake	LYNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0181349_12742551	3300017778	Freshwater Lake	DMMALYDGKYKEALVLAKRLGDGLERQGAYRSGQYRQPVT
Ga0181349_12976961	3300017778	Freshwater Lake	GLYDGKYKEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0181349_13166442	3300017778	Freshwater Lake	KAEADMVTLYNQKYMEALALAKRLGDGMERQDAYRSGQDRHAVT
Ga0181346_11252213	3300017780	Freshwater Lake	ALYNQKFMEALALAKRLADGMERQDAYRSGQFRQQVT
Ga0181346_12980582	3300017780	Freshwater Lake	GEQDIISLYDTKFKEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181348_10389915	3300017784	Freshwater Lake	ETDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181348_12324571	3300017784	Freshwater Lake	DMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT
Ga0181355_10836785	3300017785	Freshwater Lake	VYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT
Ga0181355_13197191	3300017785	Freshwater Lake	MMQLYNGKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181355_13622621	3300017785	Freshwater Lake	MTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0180437_110670292	3300017963	Hypersaline Lake Sediment	DVLAGYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMAVN
Ga0181563_106848091	3300018420	Salt Marsh	IMTGYDMKYKEALMLAKRLGDGMERQDAYRSGQFRQVVT
Ga0181361_1092103	3300019783	Freshwater Lake	IMKGETDMLALYDGKYKEALALAKRLGDGLERGDAYRNGQARIQVT
Ga0181361_1135683	3300019783	Freshwater Lake	EADMMQLYNGKYMEAMALAKRLGDGMERQDAYRSGQFRQRVT
Ga0181359_10108611	3300019784	Freshwater Lake	TLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181359_10641941	3300019784	Freshwater Lake	ADMTALYNGKYTEALAQAKRLGDGLERGDAYRDGQYKQKVI
Ga0194134_102901811	3300020179	Freshwater Lake	INSRYKEALILAKRLGDGLERMDAYRSGQVRDKVV
Ga0194121_101427504	3300020200	Freshwater Lake	TQYENKYKEAILLAKRLGDGLERQDAYRSGQVRIPVG
Ga0194116_105012782	3300020204	Freshwater Lake	YMGRYNEALMLAKRLGDGMERQDAYRSGQFRMEVK
Ga0214179_10420811	3300021129	Freshwater	YEKRYMEALAIAKRLGDGLEREDAYRSGQFRIQPVQ
Ga0214164_10594223	3300021138	Freshwater	DNKYKEALAIAKRLGDGMDRQDAYRSGQTRIQPVP
Ga0214166_10732393	3300021139	Freshwater	MVKLYTDRYMEALALAKRLGDGMERTDAYRTGQYTQAVT
Ga0194117_105039611	3300021424	Freshwater Lake	QYMGRYNEALMLAKRLGDGMERQDAYRSGQFRMEVK
Ga0222714_101262525	3300021961	Estuarine Water	EADMMGIYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0222713_101610631	3300021962	Estuarine Water	LYDGKYKEAMGQLKRLGDGLERQDSYRSGQYRQAVT
Ga0222713_105575423	3300021962	Estuarine Water	TDMMQLYNQKFMEALALAKRLGDGMDRQDAYRSGQFRQKVT
Ga0212025_10294803	3300022057	Aqueous	ANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN
Ga0212020_10788061	3300022167	Aqueous	YNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN
Ga0181354_10493811	3300022190	Freshwater Lake	TDLLAVYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT
Ga0181354_10736093	3300022190	Freshwater Lake	ELDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQQVT
Ga0181354_10815803	3300022190	Freshwater Lake	LYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0181354_10996622	3300022190	Freshwater Lake	MKGETDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181354_12143362	3300022190	Freshwater Lake	MKGETDMMQLYNGKFMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181354_12149322	3300022190	Freshwater Lake	MGLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0181354_12516031	3300022190	Freshwater Lake	TDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0196905_11657381	3300022198	Aqueous	DMIANYEKKYQESLMLAKRLGDGMEKQDQYRSGTPRVPVN
Ga0181351_10601701	3300022407	Freshwater Lake	TIYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT
Ga0181351_11890331	3300022407	Freshwater Lake	RSNTKYNEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0181351_12340761	3300022407	Freshwater Lake	ALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0222649_10148963	3300022839	Saline Water	MMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN
Ga0209083_11306254	3300025162	Freshwater	TYMKGEEDMMKLYDGKYKEALMLAKRLGDGMERGDAYRDGQYKQKVT
Ga0208255_1100151	3300025353	Freshwater	YNSKYTEALAEAKRLGDALERQDAYRSGQYRQAVT
Ga0208255_1178541	3300025353	Freshwater	YNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT
Ga0208383_10130864	3300025357	Freshwater	LVALYDGKYKEALGQAKRLGDGLERQDAYRSGQYRQKVT
Ga0208259_10127821	3300025375	Freshwater	FMKGETDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT
Ga0208738_10526652	3300025379	Freshwater	MKGETDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQQVT
Ga0208378_10235051	3300025407	Freshwater	YNQKYVEALALAKRLGDGMERQDAYRDGQFRQQVT
Ga0208875_10367751	3300025410	Freshwater	IITLYNSKYTEALAEAKRLGDALERQDAYRSGQYRQAVT
Ga0208865_10412101	3300025411	Freshwater	TLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT
Ga0208616_10291683	3300025417	Freshwater	LYDGKYKEAIAQAKRLGDGLERQDAYRSGQYRQKVT
Ga0207958_10290294	3300025421	Freshwater	LYNQKYVEALALAKRLGDGMERQDAYRDGQFRQQVT
Ga0208617_10818351	3300025424	Freshwater	TDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT
Ga0208500_10186251	3300025429	Freshwater	TIYNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT
Ga0208379_11060763	3300025598	Freshwater	AFYDNKYKEALAIAKRLGDGMDRQDAYRSGQIRIQPVP
Ga0208613_10962133	3300025616	Freshwater	MQLYDTKYREALAIAKRLGDGLEKQDSYRNGTYRVPVR
Ga0208160_10499303	3300025647	Aqueous	DLLQLYNAKYNEALQLAKRLGDGLERQDSYRSGQVRVPVT
Ga0208134_10416823	3300025652	Aqueous	LALYNTKYNEALQLAKRLGDGLERRDSYRSGQVRVPVN
Ga0208134_11670131	3300025652	Aqueous	YNTKYTEALALAKRLGDGMERQDAYRSGQVRIKVT
Ga0208771_11725052	3300025698	Saline Lake	KGEADMMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN
Ga0208386_10357733	3300025781	Freshwater	LVTLYGKKYNEALAIAKRLGDGMERQDAYRAGQYRQAVK
Ga0208644_12876823	3300025889	Aqueous	LMANINGKYKEALILAKRLGDGLERQDAYRTGQVRDKVV
Ga0208644_13358661	3300025889	Aqueous	IIGLYDNKFKEALVMAKRLGDGLERQDAYRSGQARMPVK
Ga0209929_11187973	3300026187	Pond Water	LQLYNTKFNEGIQLAKRLGDGLERQDSYRSGQVRVPVT
Ga0255146_11149582	3300027396	Freshwater	LYNQKYMEALALAKRLGDGMERQDAYRSGQFRQKVN
Ga0208788_10796312	3300027499	Deep Subsurface	MKGETDMVTLYNTKYNEALALAKRLGDGMERTDSYRTGQVRVAVT
Ga0208974_10013071	3300027608	Freshwater Lentic	FETDMMNLYNQKYMEAMALAKRLGDGMERQDAYRSGQFRQKVT
Ga0208974_11445691	3300027608	Freshwater Lentic	GETDMMQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0208975_10222691	3300027659	Freshwater Lentic	YQKRYDEALAMAKRLGDGMERQDAYRSGQVRIAVT
Ga0208975_10832763	3300027659	Freshwater Lentic	ALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0209188_13142361	3300027708	Freshwater Lake	LYDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0209442_12532993	3300027732	Freshwater Lake	GYDMKYKEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0209297_11636374	3300027733	Freshwater Lake	GYNNKYMEALAMAKRLGDGMERQDAYRSGQYRQKVT
Ga0209190_10094328	3300027736	Freshwater Lake	MMALYDGKYKEALMLAKRLGDGLERQDAYRSGQYRQAVT
Ga0209085_10658271	3300027741	Freshwater Lake	GYTARYNEALALAKRLGDGLERQDAYRSGQVRIEVR
Ga0209189_10494365	3300027747	Freshwater Lake	DMMQLYDGKYKEAVALAKRLGDGLERQDAYRSGQYRQTVT
Ga0209084_11179921	3300027749	Freshwater Lake	AGTYQQRYMEALTLAKRLGDGMERRDAYRSGQVRAEVP
Ga0209084_12035521	3300027749	Freshwater Lake	LIALYDGKYKEALTLAKRLADGMERQDAYRSGQYRQAVT
Ga0209084_13629042	3300027749	Freshwater Lake	LYDTKYKEALALAKRLGDGMERQDAYRTGQYRQAVT
Ga0209296_11304641	3300027759	Freshwater Lake	QLYEGKYKEALTLAKRLGDGLERQDAYRSGQYRQPVT
Ga0209296_13679902	3300027759	Freshwater Lake	MKGETDMMNLYNQKYMEAMALAKRLGDGMERQDAYRSGQFRQRVT
Ga0209598_102428141	3300027760	Freshwater Lake	MLALYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT
Ga0209768_102711201	3300027772	Freshwater Lake	IIAGYDMKYKEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0209353_101558254	3300027798	Freshwater Lake	YNQKFMEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0209353_103678532	3300027798	Freshwater Lake	LITLYNTKYNEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0209550_103687824	3300027892	Freshwater Lake	YNTKYNEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0209636_108043801	3300027893	Marine Sediment	LKGDAHLMTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT
Ga0209777_104433071	3300027896	Freshwater Lake Sediment	VALYNQKYTEALEQAKRLGDALERMDAYRSGQYRQAVT
Ga0209777_105962313	3300027896	Freshwater Lake Sediment	LYDAKYKEAVAQAKRLGDALERQDAYRSGQYRQPVT
Ga0209536_1012358751	3300027917	Marine Sediment	YDKKYQEALMMAKRMGDGMERQDAYRSGQYRQAVT
Ga0209191_10330566	3300027969	Freshwater Lake	KGETDLVALYKQKYVEAIALAKRLGDGMERQDAYRSGQLRVEVS
Ga0209191_12568733	3300027969	Freshwater Lake	AFYDKKYQDALMLAKRLGDGLERQDAYRSGQARVPVT
Ga0209298_100909205	3300027973	Freshwater Lake	IITGYDMKYKEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0209702_100976454	3300027976	Freshwater	ADMMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN
Ga0255201_10074184	3300028086	Freshwater	NYEKKYQEALMLAKRLGDGMEKQDQYRSGTPRVPVS
Ga0304728_11024483	3300028393	Freshwater Lake	GEQDIIGLYDAKFKDAIILAKRLGDGMEKQDQYRSGQFRQQVT
Ga0304728_11814021	3300028393	Freshwater Lake	YDIKYKEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0304728_12965541	3300028393	Freshwater Lake	MALYNQKYMEALALAKRLGDGLERQDAYRSGQFRQAVT
Ga0119933_10436461	3300029932	Drinking Water Treatment Plant	YEAKYKEALGLAKRLGDGLERQDAYRSGQVRYPVA
Ga0307380_102347484	3300031539	Soil	DLLQLYELKYNQALALAKRLGDGLEKQDSYRSGQARVSVT
Ga0307376_105551263	3300031578	Soil	EADIVAAYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN
Ga0307375_101496974	3300031669	Soil	FMKGDTDMMQLYNGKYMEALQLAKRLGDGLEKNDSYRVGQPQVPVN
Ga0316219_12731722	3300031759	Freshwater	DLMVFYDTKYKEALSQAKRLGDGLERMDSYRSGQYRQPVT
Ga0315900_104642531	3300031787	Freshwater	ITGRYKEALALAKRLGDGLDRQDAYRSGQVRDKVV
Ga0315900_110154362	3300031787	Freshwater	NYNKRYEEAMILAKRLGDGMDRRDAYRSGQIRMSVN
Ga0315274_114218793	3300031999	Sediment	QLYNQKFMEALALAKRLGDGLERQDAYRSGQFRQAVT
Ga0315284_111858423	3300032053	Sediment	TVYKAKYDEAVALAKRLGDGLERRDAYRSGQARVDVT
Ga0315277_108224851	3300032118	Sediment	YDGKYKEAMGQLKRLGDGLERQDAYRSGQARVPVT
Ga0315268_122795672	3300032173	Sediment	MKGENDMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQAVT
Ga0335398_102403041	3300032435	Freshwater	LLTLYNTKYNEALQLAKRLGDGLERQDSYRSGQVRIPVI
Ga0316223_10348811	3300032560	Freshwater	YDKKYNEALAIAKRLGDGMERQDAYRSGQYRQAVT
Ga0316223_12162292	3300032560	Freshwater	KLYTDRYMEALALAKRLGDGMERTDAYRTGQYSQAVK
Ga0316222_11355083	3300032561	Freshwater	FYDNKYKEALAIAKRLGDGLERQDAYRSGQTRIQPVP
Ga0316226_13859661	3300032562	Freshwater	IYNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT
Ga0316232_10774811	3300032605	Freshwater	LVALYDKKYVEAVQIAKRLGDGMERQDSYRSGQYRETVK
Ga0316232_13373071	3300032605	Freshwater	DLVGLYNGKYTEALAQAKRLGDGLERQDAFRSGQYRQKVE
Ga0316225_11980212	3300032675	Freshwater	MKGEADMVKLYTDRYMEALALAKRLGDGMERTDAYRTGQYSQAVK
Ga0316227_11876663	3300032677	Freshwater	LYDKKYNEALAIAKRLGDGMERQDAYRSGQYRQAVT
Ga0334722_102296764	3300033233	Sediment	PEVLSTYQKRYDEALAMAKRLGDGMERQDAYRSGQVRIAVT
Ga0334994_0145231_5_142	3300033993	Freshwater	MKGETDMMQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT
Ga0334994_0410272_17_127	3300033993	Freshwater	LYNTKYNEALALAKRLGDGMERQDAYRSGQYRQQVT
Ga0334995_0158958_22_159	3300034062	Freshwater	MKGETDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT
Ga0335010_0695856_380_496	3300034092	Freshwater	MAFYETKYKEALALAKRLGDGMERQDAYRSGQYRQPVT
Ga0335035_0709449_3_110	3300034105	Freshwater	YNTKYTEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0335066_0505977_521_640	3300034112	Freshwater	IVTLYDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT
Ga0335058_0765278_375_512	3300034121	Freshwater	MKGEADIIALYDGKYKEALTLAKRLIDGLDRQDVYRSGQTRVPVT
Ga0335049_0079341_2272_2391	3300034272	Freshwater	MLQLYNTKYQEALMLAKRLGDGMERQDAYRSGQYRQKVV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters