Basic Information | |
---|---|
Family ID | F017619 |
Family Type | Metagenome |
Number of Sequences | 239 |
Average Sequence Length | 47 residues |
Representative Sequence | MTRTNTTRSEKSTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Number of Associated Samples | 160 |
Number of Associated Scaffolds | 239 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.18 % |
% of genes near scaffold ends (potentially truncated) | 24.27 % |
% of genes from short scaffolds (< 2000 bps) | 74.48 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.356 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.992 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.473 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.209 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.47% β-sheet: 10.53% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 239 Family Scaffolds |
---|---|---|
PF02955 | GSH-S_ATP | 54.81 |
PF12728 | HTH_17 | 5.44 |
PF16078 | 2-oxogl_dehyd_N | 5.02 |
PF04452 | Methyltrans_RNA | 4.18 |
PF00702 | Hydrolase | 2.51 |
PF06325 | PrmA | 2.09 |
PF04999 | FtsL | 0.84 |
PF00082 | Peptidase_S8 | 0.84 |
PF00072 | Response_reg | 0.42 |
PF01124 | MAPEG | 0.42 |
PF11854 | MtrB_PioB | 0.42 |
PF16870 | OxoGdeHyase_C | 0.42 |
PF07044 | DUF1329 | 0.42 |
PF04002 | RadC | 0.42 |
PF01165 | Ribosomal_S21 | 0.42 |
PF00676 | E1_dh | 0.42 |
PF01807 | zf-CHC2 | 0.42 |
PF12439 | GDE_N | 0.42 |
PF07043 | DUF1328 | 0.42 |
PF00166 | Cpn10 | 0.42 |
PF00210 | Ferritin | 0.42 |
PF08282 | Hydrolase_3 | 0.42 |
PF03537 | Glyco_hydro_114 | 0.42 |
PF13231 | PMT_2 | 0.42 |
PF04545 | Sigma70_r4 | 0.42 |
PF00800 | PDT | 0.42 |
PF09210 | BE_C | 0.42 |
COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
---|---|---|---|
COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 109.62 |
COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 4.18 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 2.09 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 2.09 |
COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 2.09 |
COG3116 | Cell division protein FtsL, interacts with FtsB and FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.84 |
COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 0.42 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.42 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.42 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.42 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.42 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.42 |
COG1543 | Predicted glycosyl hydrolase, contains GH57 and DUF1957 domains | Carbohydrate transport and metabolism [G] | 0.42 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.42 |
COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.42 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.42 |
COG2342 | Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) | Carbohydrate transport and metabolism [G] | 0.42 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.42 |
COG3868 | Alpha-1,4 polygalactosaminidase, glycosyl hydrolase family GH114 | Carbohydrate transport and metabolism [G] | 0.42 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.36 % |
Unclassified | root | N/A | 14.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ01AZ0XU | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 510 | Open in IMG/M |
3300002558|JGI25385J37094_10209615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 521 | Open in IMG/M |
3300002560|JGI25383J37093_10069653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1095 | Open in IMG/M |
3300004281|Ga0066397_10101580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
3300004479|Ga0062595_101652101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
3300005093|Ga0062594_101833317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
3300005166|Ga0066674_10035940 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
3300005166|Ga0066674_10038194 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
3300005166|Ga0066674_10103579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1323 | Open in IMG/M |
3300005166|Ga0066674_10505624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 543 | Open in IMG/M |
3300005167|Ga0066672_10098916 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
3300005171|Ga0066677_10024160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2840 | Open in IMG/M |
3300005172|Ga0066683_10231502 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300005174|Ga0066680_10452326 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300005176|Ga0066679_10113437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1662 | Open in IMG/M |
3300005177|Ga0066690_10889612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300005180|Ga0066685_10269283 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300005180|Ga0066685_10996564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
3300005181|Ga0066678_10351369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 973 | Open in IMG/M |
3300005186|Ga0066676_10097847 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
3300005332|Ga0066388_100004047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9760 | Open in IMG/M |
3300005332|Ga0066388_100154734 | All Organisms → cellular organisms → Bacteria | 2876 | Open in IMG/M |
3300005332|Ga0066388_100180580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2718 | Open in IMG/M |
3300005336|Ga0070680_100556528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 983 | Open in IMG/M |
3300005439|Ga0070711_100118930 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300005440|Ga0070705_101201198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300005445|Ga0070708_100039554 | All Organisms → cellular organisms → Bacteria | 4127 | Open in IMG/M |
3300005445|Ga0070708_100566744 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300005445|Ga0070708_101220807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
3300005446|Ga0066686_10117482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1730 | Open in IMG/M |
3300005446|Ga0066686_10788287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 633 | Open in IMG/M |
3300005447|Ga0066689_10354009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 916 | Open in IMG/M |
3300005447|Ga0066689_10686270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
3300005450|Ga0066682_10688190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
3300005467|Ga0070706_100089107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2861 | Open in IMG/M |
3300005467|Ga0070706_100118242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2469 | Open in IMG/M |
3300005467|Ga0070706_100441687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1211 | Open in IMG/M |
3300005467|Ga0070706_101961422 | Not Available | 531 | Open in IMG/M |
3300005467|Ga0070706_101969068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 529 | Open in IMG/M |
3300005471|Ga0070698_101018232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
3300005518|Ga0070699_100151875 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
3300005524|Ga0070737_10000301 | All Organisms → cellular organisms → Bacteria | 117223 | Open in IMG/M |
3300005529|Ga0070741_10000627 | All Organisms → cellular organisms → Bacteria | 122154 | Open in IMG/M |
3300005529|Ga0070741_10005920 | All Organisms → cellular organisms → Bacteria | 26653 | Open in IMG/M |
3300005529|Ga0070741_10018550 | All Organisms → cellular organisms → Bacteria | 11253 | Open in IMG/M |
3300005529|Ga0070741_10074796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3782 | Open in IMG/M |
3300005533|Ga0070734_10000451 | All Organisms → cellular organisms → Bacteria | 87287 | Open in IMG/M |
3300005536|Ga0070697_100084831 | All Organisms → cellular organisms → Bacteria | 2613 | Open in IMG/M |
3300005536|Ga0070697_101523039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
3300005536|Ga0070697_101804915 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005538|Ga0070731_10008829 | All Organisms → cellular organisms → Bacteria | 7650 | Open in IMG/M |
3300005545|Ga0070695_101084317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
3300005545|Ga0070695_101650819 | Not Available | 536 | Open in IMG/M |
3300005546|Ga0070696_100887875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
3300005549|Ga0070704_100267982 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300005554|Ga0066661_10078242 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
3300005554|Ga0066661_10184514 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300005557|Ga0066704_10028835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3364 | Open in IMG/M |
3300005558|Ga0066698_10346174 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300005568|Ga0066703_10146497 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300005568|Ga0066703_10565209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
3300005574|Ga0066694_10288537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 781 | Open in IMG/M |
3300005598|Ga0066706_10572600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 897 | Open in IMG/M |
3300005614|Ga0068856_100352508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1490 | Open in IMG/M |
3300005713|Ga0066905_100161639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1628 | Open in IMG/M |
3300005713|Ga0066905_100249153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1364 | Open in IMG/M |
3300005719|Ga0068861_102145537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
3300005764|Ga0066903_100045121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5273 | Open in IMG/M |
3300005764|Ga0066903_100589752 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
3300005764|Ga0066903_101767943 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300005764|Ga0066903_108991378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
3300006031|Ga0066651_10068416 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
3300006794|Ga0066658_10112014 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300006804|Ga0079221_10419329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
3300006852|Ga0075433_11673638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
3300006854|Ga0075425_100120504 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
3300006854|Ga0075425_100535717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1348 | Open in IMG/M |
3300006865|Ga0073934_10006928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16136 | Open in IMG/M |
3300006871|Ga0075434_102222980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
3300006903|Ga0075426_10079909 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
3300006903|Ga0075426_10142206 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
3300006903|Ga0075426_10178753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1536 | Open in IMG/M |
3300006903|Ga0075426_10834673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 694 | Open in IMG/M |
3300006904|Ga0075424_100297955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1716 | Open in IMG/M |
3300006904|Ga0075424_100584504 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300006904|Ga0075424_101213950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
3300006914|Ga0075436_100058112 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
3300006914|Ga0075436_100977526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
3300006954|Ga0079219_10953401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
3300009012|Ga0066710_100698983 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
3300009012|Ga0066710_102537249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
3300009012|Ga0066710_104179044 | Not Available | 540 | Open in IMG/M |
3300009038|Ga0099829_11229955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
3300009090|Ga0099827_10707336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 871 | Open in IMG/M |
3300009094|Ga0111539_10361660 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
3300009098|Ga0105245_12949106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
3300009137|Ga0066709_100009045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 8882 | Open in IMG/M |
3300009148|Ga0105243_12631225 | Not Available | 543 | Open in IMG/M |
3300009162|Ga0075423_11378907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
3300009792|Ga0126374_10745871 | Not Available | 742 | Open in IMG/M |
3300009792|Ga0126374_11010271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
3300009792|Ga0126374_11803468 | Not Available | 512 | Open in IMG/M |
3300010320|Ga0134109_10120959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 925 | Open in IMG/M |
3300010321|Ga0134067_10055212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1287 | Open in IMG/M |
3300010336|Ga0134071_10342816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
3300010336|Ga0134071_10681064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300010336|Ga0134071_10696916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
3300010359|Ga0126376_12420296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 572 | Open in IMG/M |
3300010360|Ga0126372_12327836 | Not Available | 586 | Open in IMG/M |
3300010391|Ga0136847_10720336 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300010391|Ga0136847_11389742 | All Organisms → cellular organisms → Bacteria | 8538 | Open in IMG/M |
3300010391|Ga0136847_12775444 | Not Available | 549 | Open in IMG/M |
3300010397|Ga0134124_11848093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
3300010399|Ga0134127_11898932 | Not Available | 672 | Open in IMG/M |
3300010400|Ga0134122_11381604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
3300010403|Ga0134123_12120376 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300010863|Ga0124850_1040373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1485 | Open in IMG/M |
3300012096|Ga0137389_10724286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 855 | Open in IMG/M |
3300012199|Ga0137383_10291070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1196 | Open in IMG/M |
3300012201|Ga0137365_10214193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1438 | Open in IMG/M |
3300012203|Ga0137399_11556544 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012206|Ga0137380_10300865 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300012207|Ga0137381_10442346 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300012361|Ga0137360_10544546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 991 | Open in IMG/M |
3300012362|Ga0137361_10999404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
3300012582|Ga0137358_10812921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
3300012922|Ga0137394_10063872 | All Organisms → cellular organisms → Bacteria | 3058 | Open in IMG/M |
3300012922|Ga0137394_10676401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 870 | Open in IMG/M |
3300012922|Ga0137394_11519531 | Not Available | 528 | Open in IMG/M |
3300012927|Ga0137416_10560643 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300012944|Ga0137410_11044062 | Not Available | 697 | Open in IMG/M |
3300012948|Ga0126375_10035485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2524 | Open in IMG/M |
3300012972|Ga0134077_10250998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
3300012977|Ga0134087_10000042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 20615 | Open in IMG/M |
3300013297|Ga0157378_12574412 | Not Available | 561 | Open in IMG/M |
3300015241|Ga0137418_10714291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 766 | Open in IMG/M |
3300015245|Ga0137409_11391416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300015264|Ga0137403_11253454 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300015358|Ga0134089_10234388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
3300017657|Ga0134074_1252496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
3300017657|Ga0134074_1268118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
3300017659|Ga0134083_10144179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 961 | Open in IMG/M |
3300017974|Ga0187777_10829852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 661 | Open in IMG/M |
3300018058|Ga0187766_10053370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2381 | Open in IMG/M |
3300018431|Ga0066655_10005124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5297 | Open in IMG/M |
3300018431|Ga0066655_10026241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2784 | Open in IMG/M |
3300018431|Ga0066655_10111295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1554 | Open in IMG/M |
3300018431|Ga0066655_10151769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1376 | Open in IMG/M |
3300018433|Ga0066667_10192315 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300018433|Ga0066667_10726198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 836 | Open in IMG/M |
3300018433|Ga0066667_10822720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 792 | Open in IMG/M |
3300018433|Ga0066667_11301524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
3300018433|Ga0066667_11902968 | Not Available | 542 | Open in IMG/M |
3300018468|Ga0066662_10596748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1032 | Open in IMG/M |
3300018468|Ga0066662_11020722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 820 | Open in IMG/M |
3300018468|Ga0066662_11817484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
3300018482|Ga0066669_10121616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1861 | Open in IMG/M |
3300018482|Ga0066669_11881313 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300019360|Ga0187894_10015915 | All Organisms → cellular organisms → Bacteria | 5702 | Open in IMG/M |
3300019458|Ga0187892_10098735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1753 | Open in IMG/M |
3300019789|Ga0137408_1133145 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300020170|Ga0179594_10027510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1786 | Open in IMG/M |
3300020583|Ga0210401_11166657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
3300025289|Ga0209002_10219358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1162 | Open in IMG/M |
3300025310|Ga0209172_10019688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4926 | Open in IMG/M |
3300025326|Ga0209342_10294178 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
3300025326|Ga0209342_10671661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
3300025910|Ga0207684_10020196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5689 | Open in IMG/M |
3300025910|Ga0207684_10522125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1017 | Open in IMG/M |
3300025917|Ga0207660_10692224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
3300025922|Ga0207646_11240180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 653 | Open in IMG/M |
3300025937|Ga0207669_11500859 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300026078|Ga0207702_10284271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1565 | Open in IMG/M |
3300026277|Ga0209350_1077035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 910 | Open in IMG/M |
3300026296|Ga0209235_1062181 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300026296|Ga0209235_1083148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1423 | Open in IMG/M |
3300026297|Ga0209237_1108103 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300026314|Ga0209268_1002320 | All Organisms → cellular organisms → Bacteria | 9109 | Open in IMG/M |
3300026323|Ga0209472_1051450 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300026324|Ga0209470_1286756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
3300026326|Ga0209801_1265031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
3300026327|Ga0209266_1087831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1393 | Open in IMG/M |
3300026329|Ga0209375_1034281 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
3300026333|Ga0209158_1117641 | Not Available | 998 | Open in IMG/M |
3300026334|Ga0209377_1075345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1443 | Open in IMG/M |
3300026334|Ga0209377_1160740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
3300026335|Ga0209804_1301190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 546 | Open in IMG/M |
3300026532|Ga0209160_1317214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300026538|Ga0209056_10421498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 797 | Open in IMG/M |
3300026548|Ga0209161_10251830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 917 | Open in IMG/M |
3300027655|Ga0209388_1022161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1787 | Open in IMG/M |
3300027706|Ga0209581_1003111 | All Organisms → cellular organisms → Bacteria | 14685 | Open in IMG/M |
3300027706|Ga0209581_1030913 | Not Available | 2433 | Open in IMG/M |
3300027826|Ga0209060_10000358 | All Organisms → cellular organisms → Bacteria | 91473 | Open in IMG/M |
3300027869|Ga0209579_10007665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6946 | Open in IMG/M |
3300031280|Ga0307428_1139201 | Not Available | 616 | Open in IMG/M |
3300031368|Ga0307429_1038291 | Not Available | 1523 | Open in IMG/M |
3300031543|Ga0318516_10420593 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300031576|Ga0247727_10181019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1969 | Open in IMG/M |
3300031716|Ga0310813_10821294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 838 | Open in IMG/M |
3300031720|Ga0307469_11208735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
3300031720|Ga0307469_12327587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300031740|Ga0307468_102297390 | Not Available | 524 | Open in IMG/M |
3300031820|Ga0307473_10036194 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
3300031820|Ga0307473_10984454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
3300031949|Ga0214473_11506210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
3300031949|Ga0214473_11773846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
3300031949|Ga0214473_11890903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 586 | Open in IMG/M |
3300031962|Ga0307479_10870171 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300032174|Ga0307470_11442311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 570 | Open in IMG/M |
3300032180|Ga0307471_100550517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1308 | Open in IMG/M |
3300032180|Ga0307471_100711586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1169 | Open in IMG/M |
3300032180|Ga0307471_101182096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 929 | Open in IMG/M |
3300032180|Ga0307471_101805964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 763 | Open in IMG/M |
3300032180|Ga0307471_101974938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
3300032180|Ga0307471_103514975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
3300032893|Ga0335069_10016498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 10294 | Open in IMG/M |
3300033004|Ga0335084_10108544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_69_21 | 2885 | Open in IMG/M |
3300033004|Ga0335084_10271248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1756 | Open in IMG/M |
3300033004|Ga0335084_10401388 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
3300033433|Ga0326726_10497615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1166 | Open in IMG/M |
3300033433|Ga0326726_11009252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.99% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.46% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.69% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.60% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.51% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.26% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.26% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.84% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.84% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.42% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.42% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_06490250 | 2170459024 | Grass Soil | SRAGHGYRSPPSQGGHAMTRTDRTPRTKTPTPRRRVIAIGKRVEGRWQVRTSLWRYLATTALSSQ |
JGI25385J37094_102096151 | 3300002558 | Grasslands Soil | MTRTNTTRSEKGTPPRRRVIAVGKRVDGRWQVRTSFWRYLATTALSQQ* |
JGI25383J37093_100696532 | 3300002560 | Grasslands Soil | MTRTNTTRSEKSTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066397_101015801 | 3300004281 | Tropical Forest Soil | ASRRLKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0062595_1016521012 | 3300004479 | Soil | MTRTNKEQSTKKNTPRRRLMAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0062594_1018333172 | 3300005093 | Soil | MTSRKTRSNDKDTTPRKRLIAVGKKVDGRWQVRTSLWRYVAATALSQS* |
Ga0066674_100359404 | 3300005166 | Soil | MTQTKGHQTKTLKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066674_100381941 | 3300005166 | Soil | MTRTNTTRSEKSAPPRRRVIAVGRRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066674_101035793 | 3300005166 | Soil | MTRTNTTRREKTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066674_105056241 | 3300005166 | Soil | MTRTNTTRSEKSTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066672_100989162 | 3300005167 | Soil | MTQTKGRQAKTVNPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066677_100241603 | 3300005171 | Soil | MTQTKGRQTKSMSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066683_102315022 | 3300005172 | Soil | MTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0066680_104523262 | 3300005174 | Soil | MTQTKGHQTKTVKARRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066679_101134372 | 3300005176 | Soil | MTRTNTTRSEKGTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066690_108896121 | 3300005177 | Soil | MTRTNTTRSEKSTSPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066685_102692831 | 3300005180 | Soil | GEGLGMTQTKGRQTKSMSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066685_109965641 | 3300005180 | Soil | MTQANASRRQKTIPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0066678_103513692 | 3300005181 | Soil | MTQTKGRQTKTVSPRRRVIAIGKRVDGRWQVRTSLWRYLAATALSAQ* |
Ga0066676_100978472 | 3300005186 | Soil | MTQTKGHQTKTLKPRRRVIAIGKRVNGRWLVRTSLWRYLAATALSAQ* |
Ga0066388_1000040472 | 3300005332 | Tropical Forest Soil | MTQADASRRLKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0066388_1001547343 | 3300005332 | Tropical Forest Soil | MTRTNTTRSTKVTPPRRRLIALGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0066388_1001805805 | 3300005332 | Tropical Forest Soil | MTQSKVNRTPSSTATPRRRVVAIGKRVNGRWQVRTSLWRYLATTALSPQ* |
Ga0070680_1005565282 | 3300005336 | Corn Rhizosphere | MTQTKATRTDKRPQRRRIIAVGKRVEGRWQVRTSLWRYLCATAISQ* |
Ga0070711_1001189303 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTNTTRTTKTPTPRRRVIAIGKRVDGRWQVRTSLWRYLATTALSAQ* |
Ga0070705_1012011982 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ISLSRASREGARMTQPKTGRRPKQDAPRRRVIAIGKRIDGRWQVRTSLWRYLAATALSTQ |
Ga0070708_1000395543 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTNTRSEKSTPPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0070708_1005667442 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRPGTSAKKPTPRRRVIAVGKRIDGRWQVRTSLWRYVATTALSAQ* |
Ga0070708_1012208071 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQTKGRQVKTVNPRRRVIAIGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0066686_101174822 | 3300005446 | Soil | MTQTKGRQAKSVSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066686_107882872 | 3300005446 | Soil | MTRTNTTRSEKSMPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066689_103540092 | 3300005447 | Soil | MTRTNANRTSKTPTQGRRVIAIGKRVDGRWQVRTSLWRYLATTALSKQ* |
Ga0066689_106862701 | 3300005447 | Soil | GGHAMTRTNTTRREKTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066682_106881902 | 3300005450 | Soil | MTQTKGRQAKSVSPRRRVIAVGKRANGRWQVRTSPSRYPAATALSAP* |
Ga0070706_1000891072 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTNKERSTKTTTPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0070706_1001182424 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HPMTRTNTRSEKSTPPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0070706_1004416872 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQTKMNRPVKVAAPRRRVIAIGKRVDGRWQVRTSLWRYLATTAFSTQ* |
Ga0070706_1019614221 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAKAARQEVRKTPRRRVIAIGKRVQGRWQVRTSLWRYLAATALSIQ* |
Ga0070706_1019690682 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FFALRGRGTDLAPRRSRGGHPMTRTNTRSEKSTPPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0070698_1010182321 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTNIRSEKSTPPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0070699_1001518753 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTNTTRREKTTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0070737_1000030149 | 3300005524 | Surface Soil | MEGKTSRREQRTTPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSTH* |
Ga0070741_1000062772 | 3300005529 | Surface Soil | MEGKTSRREQRTMPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSTH* |
Ga0070741_1000592017 | 3300005529 | Surface Soil | MTQRKKGEKTSSTPRRRVIAIGKRVDGRWQVRTSLWRYLASTALSAQ* |
Ga0070741_100185503 | 3300005529 | Surface Soil | MTRSNGRTEKQSPPRRRVIAVGKRVDGRWQVRTSLWRYLVTTALSTQ* |
Ga0070741_100747963 | 3300005529 | Surface Soil | MTQTKTRKPLETPPRRRVIAIGRKVNGRWQVRTSLWRYLAATALSAQ* |
Ga0070734_1000045168 | 3300005533 | Surface Soil | MEAKTVRREQKAPRRRVIAVGKRMNGRWQVRTSLWRYLAATALSTQ* |
Ga0070697_1000848314 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQTKGRQKKTVSPRRRVIAIGKRVDGRWQVRTSLWRYLAATALSAQ* |
Ga0070697_1015230392 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PPPRLAARISLPGGQGGHAMPQVNGSRRQKTTPPPRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0070697_1018049151 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRPNKSRSEKTTGTPGRRVIAVGKRVDGRWQVRTSLWRYVAETALSSQ* |
Ga0070731_100088299 | 3300005538 | Surface Soil | MTRTNKERSTKTNTPRRRLIAIGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0070695_1010843172 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRSNGNRTEKSLTPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSAQ* |
Ga0070695_1016508191 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRSNTTTTRTTKTPAPRRRVIAIGKRVDGRWQVRTSLWRYLAT |
Ga0070696_1008878752 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQTKATRTDKRPQRRRIIAVGKRVEGRWQVRTSLWRYLAATAISSQ* |
Ga0070704_1002679823 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQPKTGRRPKQDAPRRRVIAIGKRIDGRWQVRTSLWRYLAATALSTQ* |
Ga0066661_100782423 | 3300005554 | Soil | APLRGGAGMTQTKGHQTKTLKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066661_101845141 | 3300005554 | Soil | QTKGRQTKTVSPRRRVIAIGKRVDGRWQVRTSLWRYLAATALSAQ* |
Ga0066704_100288355 | 3300005557 | Soil | RRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0066698_103461742 | 3300005558 | Soil | GPRGEGLGMTQTKGRQAKSVSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066703_101464971 | 3300005568 | Soil | PLRGGAGMTQTKGHQAKTVKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0066703_105652091 | 3300005568 | Soil | PLRGGVGMTQTKGRQTKTVSPRRRVIAIGRRVDGRWQVRTSLWRYLAATALSAQ* |
Ga0066694_102885373 | 3300005574 | Soil | MTRTNTTRREKTPPRRRVVAVGKRVDGRWQVRTSLWRYLATT |
Ga0066706_105726001 | 3300005598 | Soil | RYRSPVGRGGKGMTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ |
Ga0068856_1003525082 | 3300005614 | Corn Rhizosphere | MTRTNKEQSTKTNTPRRRLMAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0066905_1001616392 | 3300005713 | Tropical Forest Soil | MTRTNTTRSMKPAPPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0066905_1002491532 | 3300005713 | Tropical Forest Soil | MTQANASRRQKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATA |
Ga0068861_1021455372 | 3300005719 | Switchgrass Rhizosphere | CSGGHAMTRSNTTTTRTTKTPAPRRRVIAIGKRVDGRWQVRTSLWRYLATTALSAQ* |
Ga0066903_1000451218 | 3300005764 | Tropical Forest Soil | MTQANARRQKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0066903_1005897523 | 3300005764 | Tropical Forest Soil | MMQADSARQEKRKTPRRRVIAIGKRTNGRWQVRTSLWRYIAATALSNQ* |
Ga0066903_1017679432 | 3300005764 | Tropical Forest Soil | MTRTNTTTRTKPSLPRRRLIAVGKRVEGRWQVRTSLWRYLATAALSLQ* |
Ga0066903_1089913782 | 3300005764 | Tropical Forest Soil | GGHPMTRASTTAKKATPRRRVIAVGKRIDGRWQVRTSLWRYLATTALSAQ* |
Ga0068870_104404692 | 3300005840 | Miscanthus Rhizosphere | TKQPRRRVIAIGRRVEGGRWEVRTSLWRYLAATALSSQ* |
Ga0066651_100684161 | 3300006031 | Soil | MTRTNTTRSEKSTPPRRRVIAVGRRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0066658_101120142 | 3300006794 | Soil | MTRTNTTRSEKGTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0079221_104193292 | 3300006804 | Agricultural Soil | MTRTNTTRSEKGTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSSQ* |
Ga0075433_103738511 | 3300006852 | Populus Rhizosphere | PRRRVIAIGKRVDGRWQVRTSLWRYLATTALSAQ* |
Ga0075433_116736381 | 3300006852 | Populus Rhizosphere | MTQANASRQKTTPPRRRLIAVGKRVEGRWQVRTSLWR |
Ga0075425_1001205044 | 3300006854 | Populus Rhizosphere | MTRTNTTRTTKTPPPRRRVIAIGKRVDGRWQVRTSLWRYLATTALSAQ* |
Ga0075425_1005357172 | 3300006854 | Populus Rhizosphere | MTRTNKERSTKTNMPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0073934_100069288 | 3300006865 | Hot Spring Sediment | MATTKTGRTEKTQAPRRRLIAIGKREKGQWQVRTSLWRYLAATALSSQ* |
Ga0075434_1022229801 | 3300006871 | Populus Rhizosphere | MTRTNTRREKSTPPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0075426_100799091 | 3300006903 | Populus Rhizosphere | PGGHEMTQANASRRQKTIPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0075426_101422062 | 3300006903 | Populus Rhizosphere | MTQANASRQKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0075426_101787531 | 3300006903 | Populus Rhizosphere | MTQTKGRPVKTVNPRRRVIAIGKRVDGRWQVRTSL |
Ga0075426_108346732 | 3300006903 | Populus Rhizosphere | TEKTVTTRRKVIAVGKRVDGRWQVRTSLWRYVAATALSPQ* |
Ga0075424_1002979553 | 3300006904 | Populus Rhizosphere | MTRTNTTRTTKTPPPRRRVIAIGKRVDGRWQVRTSLWRYLATTAL |
Ga0075424_1005845042 | 3300006904 | Populus Rhizosphere | MTQANASRRQKTIPPRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0075424_1012139501 | 3300006904 | Populus Rhizosphere | MTRTNTTRTTKTPTPRRRVIAIGKRVDGRWQVRTSLWRYLATTA |
Ga0075436_1000581124 | 3300006914 | Populus Rhizosphere | MTQTKGRPVKTVNPRRRVIAIGKRVDGRWQVRTSLWRYLATTALSAQ* |
Ga0075436_1009775262 | 3300006914 | Populus Rhizosphere | MTRTDTTRSTKTVAPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0079219_109534011 | 3300006954 | Agricultural Soil | MTRTNKEQGTKTNTPRRRLMAVGKRVDGRWQVRTSLWRYLATTALSLQ* |
Ga0066710_1006989832 | 3300009012 | Grasslands Soil | MTQANTSRRQKTSPPRRSLIAVGKRVEGRWQVRTSLWRYLAATALSAQ |
Ga0066710_1025372491 | 3300009012 | Grasslands Soil | RAAAARHGTRSPAPLRGGAGMTQTKGHQTKTLKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0066710_1041790441 | 3300009012 | Grasslands Soil | MQAKVARQETPKTPRRRLIAVGKRVQGRWQVRTSLWRYLAATALSIQ |
Ga0099829_112299551 | 3300009038 | Vadose Zone Soil | MTRTNTTRSEKSTAPRRRVVAVGKRVDGRWQVRTSLWRY |
Ga0099827_107073362 | 3300009090 | Vadose Zone Soil | MTQANTSRRQKTIPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0111539_103616603 | 3300009094 | Populus Rhizosphere | MTSRKTRSNDKDTTPRKRLIVVGKKVDGRWQVRTSLWRYVAATALSQS* |
Ga0105245_129491062 | 3300009098 | Miscanthus Rhizosphere | MTRMNKERSTKTTTPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0066709_1000090459 | 3300009137 | Grasslands Soil | MTQTKGRQTKTVSPRRRVIAIGRRVDGRWQVRTSLWRYLAATALSAQ* |
Ga0105243_126312252 | 3300009148 | Miscanthus Rhizosphere | MTQTKATRTDKRPQRRRIIAVGKRVEGRWQVRTSLWRYLAATALSSQ* |
Ga0075423_113789072 | 3300009162 | Populus Rhizosphere | MTRTNKERSTKTTTPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0126374_107458712 | 3300009792 | Tropical Forest Soil | MTQSKVNRTPSSTTTPRRRVVAIGKRVNGRWQVRTSLWRYLATTALSPQ* |
Ga0126374_110102712 | 3300009792 | Tropical Forest Soil | MTRTNTTRTTKATPPRRRLIAVGKLVDGRWQVRTSLWRYLATTALSSQ* |
Ga0126374_118034682 | 3300009792 | Tropical Forest Soil | MTRTNTTTRTKPSLPRRRLIAVGKRVEGRWQVRTSLWRYLATTALSLQ* |
Ga0134109_101209592 | 3300010320 | Grasslands Soil | MTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTS |
Ga0134067_100552124 | 3300010321 | Grasslands Soil | MTQTKGHQTKTLKPRRRVIAIGKRVNGRWQVRTSLLRYLAATALSAQ* |
Ga0134071_103428162 | 3300010336 | Grasslands Soil | MTQANTSRRQKTISPRRRLIAIGKRVEGRWQVRTSLWRYVAATALSSQ* |
Ga0134071_106810642 | 3300010336 | Grasslands Soil | MTSGKIRRTEKSATPRRRLIAVGKRVEGRWQVRTSLWRYIAATALSTQ* |
Ga0134071_106969161 | 3300010336 | Grasslands Soil | MTQTKGRQAKSVSPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0126376_124202961 | 3300010359 | Tropical Forest Soil | MTQADATRRLKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0126372_123278361 | 3300010360 | Tropical Forest Soil | MPMHVTRSEKTTRPRKRVIAIGKRVNGRWQVRTSLWRYLAATVLSAQ* |
Ga0136847_107203362 | 3300010391 | Freshwater Sediment | MTRQNANRTEKKTPAASATTPRRKVIAVGKCVDGRWQVRTSLWRYVAATALSPQ* |
Ga0136847_113897428 | 3300010391 | Freshwater Sediment | MTTRATTATKSSRPERTRAAEGRRVIAVGKRIEGRWQVRTSLWRYLAATALSSQ* |
Ga0136847_127754442 | 3300010391 | Freshwater Sediment | MTRARTERTEKTTTPRRKVIAVGKRVDGRWQVRTSLWRYVAATALSSQ* |
Ga0134124_118480931 | 3300010397 | Terrestrial Soil | MTRTNKERSTKTNTPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSPQ* |
Ga0134127_118989322 | 3300010399 | Terrestrial Soil | MTSRKTRSNGKDTSPRKRLIAVGKKVDGRWQVRTSLWRYVAATALSQS* |
Ga0134122_113816041 | 3300010400 | Terrestrial Soil | MQTKPSRTEKRPQRRRVIAVGKRIEGRWQVRTSLWRYLAATAVSSQ* |
Ga0134123_121203762 | 3300010403 | Terrestrial Soil | MTRSNTTTTRTTKTPAPRRRVIAIGKRVDGRWQVRTSLWRYLATTALSAQ* |
Ga0124850_10403732 | 3300010863 | Tropical Forest Soil | MTQANARRQKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSG |
Ga0137389_107242863 | 3300012096 | Vadose Zone Soil | MTRTNTTRSEKGTPPRRRVIAVGKRADGRWQVRTSLWRYL |
Ga0137383_102910703 | 3300012199 | Vadose Zone Soil | MTRTNTTRSDKGTPSRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0137365_102141933 | 3300012201 | Vadose Zone Soil | NTTRSEKSTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0137399_115565441 | 3300012203 | Vadose Zone Soil | YRSPVGTGGKGMTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0137380_103008652 | 3300012206 | Vadose Zone Soil | MTQANTSRRQKTISPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0137381_104423461 | 3300012207 | Vadose Zone Soil | MTQANTSRRQKTISPRRRLIAIGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0137386_108924611 | 3300012351 | Vadose Zone Soil | SPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0137360_103437763 | 3300012361 | Vadose Zone Soil | PPRRRVIAVGKRVDGRWQVRTSFWRYLATTALSQQ* |
Ga0137360_105445461 | 3300012361 | Vadose Zone Soil | MTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLA |
Ga0137361_109994042 | 3300012362 | Vadose Zone Soil | MTRTNTTRSEKSTPPRRRVVAVGKRVDGRWQVRTTLWRYLATTALSQQ* |
Ga0137358_108129212 | 3300012582 | Vadose Zone Soil | MTRTNTTRSEKGTPPRRRVIAVGKRVDGRWQVRTSFWRYLATTSLSQQ* |
Ga0137394_100638723 | 3300012922 | Vadose Zone Soil | MTRSNISRTEKAASPRRRLIAVGKRVEGRWQVRTSLWRYLATTALSAQ* |
Ga0137394_106764011 | 3300012922 | Vadose Zone Soil | MTQANMSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0137394_115195311 | 3300012922 | Vadose Zone Soil | MTSRKTRTTTDKDTTPRRRLIAVGKKIDGRWQVRTSLWRYVAATALSSS* |
Ga0137416_105606431 | 3300012927 | Vadose Zone Soil | TRSEKSTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ* |
Ga0137410_110440622 | 3300012944 | Vadose Zone Soil | MTSRKTRSTDKDTTPRRRLIAVGKKVDGRWQVRTSLWRYVAATALSSS* |
Ga0126375_100354852 | 3300012948 | Tropical Forest Soil | MTQANASRRQKTTPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSGQ* |
Ga0134077_102509981 | 3300012972 | Grasslands Soil | MTQTKGRQTKSMSPRRRVIAVGKRVNGRWQVRTSLWRYLAA |
Ga0134087_100000423 | 3300012977 | Grasslands Soil | MTQTKGRQTKSMSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAK* |
Ga0157378_125744121 | 3300013297 | Miscanthus Rhizosphere | MTSRKTRSTDKDTTPRRRLIAVWKKVDGRWQVRTSLWRYVAATALSSS* |
Ga0137418_104101562 | 3300015241 | Vadose Zone Soil | KAASPRRRLIAVGKRVEGRWQVRTSLWRYLATTALSAQ* |
Ga0137418_107142911 | 3300015241 | Vadose Zone Soil | QKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ* |
Ga0137409_113914161 | 3300015245 | Vadose Zone Soil | MTRTNTTRSEKGTPPRRRVIAIGKRVDGRWQVRTSLWRYLATTA |
Ga0137403_112534541 | 3300015264 | Vadose Zone Soil | MTQTKGHQTKSVKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0134089_102343881 | 3300015358 | Grasslands Soil | MTQPKGRQAKSVSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ* |
Ga0134074_12524961 | 3300017657 | Grasslands Soil | LAPWRLRGGHGMTRTNTTRSEKSTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0134074_12681182 | 3300017657 | Grasslands Soil | PAPLRGGAGMTQTKGHQTKTLKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0134083_101441792 | 3300017659 | Grasslands Soil | MTRTNTTRREKTRPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0187777_108298522 | 3300017974 | Tropical Peatland | MAQTKTSRSEKTKVSSRRVIAIGKRVGGRWQVRTSLWRYLAATALSAQ |
Ga0187766_100533701 | 3300018058 | Tropical Peatland | MTQPNTSRSDKSVTPRRRRVIAVGKRVDGRWQVRTSLWRYLATTALSAQ |
Ga0066655_100051248 | 3300018431 | Grasslands Soil | MTRTNTTRREKTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0066655_100262413 | 3300018431 | Grasslands Soil | MTQTKGHQTKTLKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0066655_101112952 | 3300018431 | Grasslands Soil | MTRTNTTRSEKSTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0066655_101517692 | 3300018431 | Grasslands Soil | MTQTKGRQTKSMSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0066667_101923152 | 3300018433 | Grasslands Soil | MTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ |
Ga0066667_107261982 | 3300018433 | Grasslands Soil | MTRTNTTRSEKGTPPRRRVIATGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0066667_108227202 | 3300018433 | Grasslands Soil | MTQTKGRQAKSVSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0066667_113015241 | 3300018433 | Grasslands Soil | RPGRGTDLAPWRSRGGHPMTRTNTTRSEKSTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0066667_119029682 | 3300018433 | Grasslands Soil | MTRTNTTRSEKSAPPRRRVIAVGRRVDGRWQVRTSLWRYLATTALSQQ |
Ga0066662_105967482 | 3300018468 | Grasslands Soil | MTQTKGRQVKSVSPRRRVIAIGKRVDGRWQVRTSVWRYLAATALSAQ |
Ga0066662_110207222 | 3300018468 | Grasslands Soil | MTRTNANRTSKTPTQGRRVIAIGKRVDGRWQVRTSLWRYLATTALSKQ |
Ga0066662_118174842 | 3300018468 | Grasslands Soil | VRHVRGTDLAPWRLRGGHGMTRTNTTRSEKGTPPRRRVIAVGKRVDGRWQVRTSFWRYLATTALSQQ |
Ga0066669_101216162 | 3300018482 | Grasslands Soil | MTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYL |
Ga0066669_105236822 | 3300018482 | Grasslands Soil | PPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0066669_118813132 | 3300018482 | Grasslands Soil | MTRTNMTRSEKSTPPRRRVIAVGRRVDGRWQVRTSLWRYLATTALSLQ |
Ga0187894_100159153 | 3300019360 | Microbial Mat On Rocks | MQTKTTRREPAKATRRRVIAIGKKVDGRWQVRTSLWRYLAATALSAQ |
Ga0187892_100987353 | 3300019458 | Bio-Ooze | MTRTTSSRTEKTERPRARRVVAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0137408_11331452 | 3300019789 | Vadose Zone Soil | MTRTNTTRSEKSTPPRRRVIATGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0179594_100275102 | 3300020170 | Vadose Zone Soil | MTRTNTTRSEKGTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0210401_111666571 | 3300020583 | Soil | MTRTNTTRREKGTTPTRRVIAVGKRVDGRWQVRTSLWRYLATTALSKQ |
Ga0182009_106439492 | 3300021445 | Soil | GAKSTTPRRRVIAVGKRVAGRWQVRTSLWRYLCATAISQ |
Ga0209002_102193581 | 3300025289 | Soil | MTRPKTIRSEKTPTPRRRVIAIGKRVDGRWQVRTSLWRYLATTALSLQ |
Ga0209172_100196888 | 3300025310 | Hot Spring Sediment | MATTKTGRTEKTQAPRRRLIAIGKREKGQWQVRTSLWRYLAATALSSQ |
Ga0209342_102941783 | 3300025326 | Soil | AIAARISLFALPPGGRAMTRPKTIRSEKTPTPRRRVIAIGKRVDGRWQVRTSLWRYLATTALSLQ |
Ga0209342_106716611 | 3300025326 | Soil | MTSRKTRATDKDPTPRRRLIAVGKKVDGRWQVRTSLWRYVAATALSSQ |
Ga0207684_100201962 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTNTRSEKSTPPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0207684_105221253 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTNKERSTKTTTPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSSQ |
Ga0207660_106922242 | 3300025917 | Corn Rhizosphere | MTQTKATRTDKRPQRRRIIAVGKRVEGRWQVRTSLWRYLAATA |
Ga0207660_116493571 | 3300025917 | Corn Rhizosphere | KTKQPRRRVIAIGRRVEGGRWEVRTSLWRYLAATALSSQ |
Ga0207646_103453751 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RPVKVAAPRRRVIAIGKRVDGRWQVRTSLWRYLATTAFSTQ |
Ga0207646_112401802 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQTKGHQGKTVKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSVQ |
Ga0207669_115008592 | 3300025937 | Miscanthus Rhizosphere | MTSRKTRSNDKDTTPRKRLIAVGKKVDGRWQVRTSLWRYVAATALSQS |
Ga0207702_102842713 | 3300026078 | Corn Rhizosphere | MTRTNKEQSTKTNTPRRRLMAVGKRVDGRWQVRTSLWRYLATTALSPQ |
Ga0209350_10770352 | 3300026277 | Grasslands Soil | MTRTNTTRSEKSTPPRRRVIAVGRRVDGRWQVRTSLWRYLATTALSQQ |
Ga0209235_10621814 | 3300026296 | Grasslands Soil | MTRTNTTRSEKSTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0209235_10831482 | 3300026296 | Grasslands Soil | MTRTNTTRREKSTPPRRRVIAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0209237_11081032 | 3300026297 | Grasslands Soil | MTRTNTTRSEKGTPPRRRVIAVGKRVDGRWQVRTSFWRYLATTALSQQ |
Ga0209469_11564052 | 3300026307 | Soil | KPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0209268_10023208 | 3300026314 | Soil | MTRTNMTRSEKSTPPRRRVIAVGRRVDGRWQVRTSLWRYLATTALSQQ |
Ga0209472_10514503 | 3300026323 | Soil | MMQTKGHQTKTLKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0209470_12867562 | 3300026324 | Soil | MTQANASRRQKTIPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSNQ |
Ga0209801_12650311 | 3300026326 | Soil | MTQTKGRQTKTVSPRRRVIAIGKRVDGRWQVRTSLWRYLAATALSAQ |
Ga0209266_10878311 | 3300026327 | Soil | MTRTNTTRSEKSAPPRRRVIAVGRRVDGRWQVRTSLWRYLATT |
Ga0209375_10342814 | 3300026329 | Soil | GHAMTQTNTTRREKTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0209158_11176411 | 3300026333 | Soil | MTQTKGHQTKTVKARRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0209377_10753453 | 3300026334 | Soil | GGHPMTRTNTTRSEKSTPPRRRVIAVGRRVDGRWQVRTSLWRYLATTALSQQ |
Ga0209377_11607402 | 3300026334 | Soil | GTGGKGMTQANTSRRQKTSPPRRRLIAVGKRVEGRWQVRTSLWRYLAATALSAQ |
Ga0209804_13011901 | 3300026335 | Soil | VRYVRGTDLAPWRLRGGHGMTRTNTTRSEKSTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0209160_13172142 | 3300026532 | Soil | MTQTKGRQAKTVNPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0209157_11626552 | 3300026537 | Soil | TKSMSPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0209056_104214981 | 3300026538 | Soil | MTQTKGRQAKSVSPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSAQ |
Ga0209161_102518302 | 3300026548 | Soil | MTRTNTTRSEKSTPPRRRVVAVGKRVEGRWQVRTSLWRYLATTALSQQ |
Ga0209388_10221613 | 3300027655 | Vadose Zone Soil | MTRTNTTRSEKGTPPRRRVIAVGRRVDGRWQVRTSFWRYLATTALSQQ |
Ga0209581_10031112 | 3300027706 | Surface Soil | MEGKTSRREQRTTPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSTH |
Ga0209581_10309132 | 3300027706 | Surface Soil | MEGKTSRREQRTMPRRRVIAVGKRVNGRWQVRTSLWRYLAATALSTH |
Ga0209060_1000035875 | 3300027826 | Surface Soil | MEAKTVRREQKAPRRRVIAVGKRMNGRWQVRTSLWRYLAATALSTQ |
Ga0209579_100076659 | 3300027869 | Surface Soil | MTRTNKERSTKTNTPRRRLIAIGKRVDGRWQVRTSLWRYLATTALSPQ |
Ga0307428_11392012 | 3300031280 | Salt Marsh | MTQPKTGRETPRRQSTTPPRRRVLAVGKRVDGRWQVRTSLWR |
Ga0307429_10382913 | 3300031368 | Salt Marsh | MTQPKTGRETPRRQSTTPPRRRVLAVGKRVDGRWQVRTSLWRYLAAT |
Ga0318516_104205931 | 3300031543 | Soil | MQTDKIVRATKSEPTRRRVLAVGKRVNGRWQVRTSLWRYLAATALSNQ |
Ga0247727_101810192 | 3300031576 | Biofilm | MTQTKSSRTEKRPQRRRIIAVGKRVEGRWQVRTSLWRYLAATAISSQ |
Ga0310813_108212941 | 3300031716 | Soil | RAKSERNETKGTPRRKVIAVGKRVDGRWQVRTSLWRYVATTALSSQ |
Ga0307469_112087352 | 3300031720 | Hardwood Forest Soil | MTRMNKERSTKTNTPRRRLIAVGKRVDGRWQVRTSLWRYLATTALSPQ |
Ga0307469_123275872 | 3300031720 | Hardwood Forest Soil | MTRSNSTRTEKSAPLRRRVIAVGKRVDGRWQVRTSLWRYLAATALSNQ |
Ga0307468_1022973901 | 3300031740 | Hardwood Forest Soil | MTSRKTRSNGKDTSPRKRLIAVGKKVDGRWQVRTSLWRYVAATALSQS |
Ga0318521_109473232 | 3300031770 | Soil | TKSEPTRRRVLAVGKRVNGRWQVRTSLWRYLAATALSNQ |
Ga0318546_104154471 | 3300031771 | Soil | PARPRRRMIAVGKRRNGRWQVRTSLWRWLAETAISQ |
Ga0307473_100361943 | 3300031820 | Hardwood Forest Soil | MTRTNGTRTEKAAAPRRRVIADGKRVDGRWQVRTSLWRYLATTALSAQ |
Ga0307473_109844542 | 3300031820 | Hardwood Forest Soil | MTQTKGHQAKTVKPRRRVIAIGKRVNGRWQVRTSLWRYLAATALSVQ |
Ga0214473_103322833 | 3300031949 | Soil | ERTRAAEGRRVIAVGKRIDGRWQVRTSLWRYLAATALSSQ |
Ga0214473_115062101 | 3300031949 | Soil | MTSRKTRSTDKDTTPRRRLIAVGKKVDGRWQVRTSLWRYVAATALSSQ |
Ga0214473_117738462 | 3300031949 | Soil | RREKPITPRRKVIAVGKRVDGRWQVRTSLWRYVAATALSAQ |
Ga0214473_118909031 | 3300031949 | Soil | GTSMTQTKSSRTEKRPQRRRIIAVGKRVEGRWQVRTSLWRYLAATAISSQ |
Ga0307479_108701712 | 3300031962 | Hardwood Forest Soil | NTTRSEKSTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0307479_118558771 | 3300031962 | Hardwood Forest Soil | GEKRIITTPRRRMIAIGKRVDGRWQVRTSLWRYLASTALSAQ |
Ga0310890_107289142 | 3300032075 | Soil | KTTKQPRRRVIAIGRRVEGGRWEVRTSLWRYLAATALSSQ |
Ga0307470_114423111 | 3300032174 | Hardwood Forest Soil | MTEIKRSHEKTTTPRRKRVIAVGKRVDGRWQVRTSLWRYLAATTLSLQ |
Ga0307471_1005505172 | 3300032180 | Hardwood Forest Soil | MTQTKGHQAKTVKPRRRVIAIGKRVNGRWQVRTSLWRYLATTALSAQ |
Ga0307471_1007115862 | 3300032180 | Hardwood Forest Soil | MENRTGRREQTTSPRRRVIAIGKRVNGRWQLRTSLWRYLAVTALSNQ |
Ga0307471_1011820961 | 3300032180 | Hardwood Forest Soil | MTRTNTTRREKTTPPRRRVVAVGKRVDGRWQVRTSLWRYLATTALSQQ |
Ga0307471_1018059642 | 3300032180 | Hardwood Forest Soil | MTQTKGRQTKTVSPRRRVIAVGKRVEGRWQVRTSLWRYLATTALSAQ |
Ga0307471_1019749382 | 3300032180 | Hardwood Forest Soil | MTRPGTTAKKPTPRRRVIAVGKRIDGRWQVRTSLWRYVATTALSSQ |
Ga0307471_1035149752 | 3300032180 | Hardwood Forest Soil | MTQTKIRQVKDVPPRRRVIAVGKRVDGRWQVRTSLWRYLAATALSAQ |
Ga0307472_1008338521 | 3300032205 | Hardwood Forest Soil | GTPPRRRVIAVGKRVDGRWQVRTSFWRYLATTALSQQ |
Ga0335069_100164985 | 3300032893 | Soil | MQTAKNVRTTKIERAPRRVLAVGKRVNGRWQVRTSLWRYLAATALSNQ |
Ga0335084_101085441 | 3300033004 | Soil | MQTAKNVRTTKNERAPRRVLAVGKRVNGRWQVRTSLWRYLAATALSNQ |
Ga0335084_102712481 | 3300033004 | Soil | TRRNEKIAAPRRRVIAIGKREKGQWQVRTSLWRYLAATALSSQ |
Ga0335084_104013881 | 3300033004 | Soil | MQTAKIVRTTKNERAPRRVLAVGKRVNGRWQVRTSLWRYLAATVLSNQ |
Ga0326726_104976152 | 3300033433 | Peat Soil | MEAKTLRIEKTTAPKKRVIAVGKKVNGRWKVRTSLWRYLAATTLSNQ |
Ga0326726_110092521 | 3300033433 | Peat Soil | MTTTKTVRNEETRRPTKRVIAIGKRTNGRWQVRTSLWRYLAATALSNQ |
⦗Top⦘ |