Metagenome / Metatranscriptome Family F017514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F017514
Family Type	Metagenome / Metatranscriptome
Number of Sequences	240
Average Sequence Length	41 residues
Representative Sequence	MPIGQERTKEQLYRQAKRLGIKGRSKMNKGQLKAALTRRGH
Number of Associated Samples	160
Number of Associated Scaffolds	240

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	80.83 %
% of genes near scaffold ends (potentially truncated)	22.92 %
% of genes from short scaffolds (< 2000 bps)	85.83 %
Associated GOLD sequencing projects	147
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (57.083 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.500 % of family members)
Environment Ontology (ENVO)	Unclassified (25.833 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (56.250 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 240 Family Scaffolds
PF07498	Rho_N	31.25
PF03309	Pan_kinase	2.08
PF00902	TatC	1.67
PF00072	Response_reg	1.25
PF00903	Glyoxalase	0.83
PF14019	DUF4235	0.83
PF02771	Acyl-CoA_dh_N	0.83
PF00211	Guanylate_cyc	0.83
PF01061	ABC2_membrane	0.83
PF00809	Pterin_bind	0.83
PF07883	Cupin_2	0.83
PF01988	VIT1	0.83
PF01391	Collagen	0.83
PF06240	COXG	0.83
PF05239	PRC	0.42
PF08445	FR47	0.42
PF08281	Sigma70_r4_2	0.42
PF00583	Acetyltransf_1	0.42
PF04007	DUF354	0.42
PF00155	Aminotran_1_2	0.42
PF00578	AhpC-TSA	0.42
PF04542	Sigma70_r2	0.42
PF01243	Putative_PNPOx	0.42
PF04261	Dyp_perox	0.42
PF00027	cNMP_binding	0.42
PF08521	2CSK_N	0.42
PF13155	Toprim_2	0.42
PF13189	Cytidylate_kin2	0.42
PF03992	ABM	0.42
PF00563	EAL	0.42
PF01288	HPPK	0.42
PF00877	NLPC_P60	0.42
PF00248	Aldo_ket_red	0.42
PF07676	PD40	0.42
PF07687	M20_dimer	0.42
PF13469	Sulfotransfer_3	0.42
PF12681	Glyoxalase_2	0.42
PF13424	TPR_12	0.42
PF00999	Na_H_Exchanger	0.42
PF00484	Pro_CA	0.42
PF00246	Peptidase_M14	0.42
PF00069	Pkinase	0.42
PF13374	TPR_10	0.42
PF00202	Aminotran_3	0.42
PF03006	HlyIII	0.42
PF04545	Sigma70_r4	0.42
PF00733	Asn_synthase	0.42
PF04185	Phosphoesterase	0.42
PF00800	PDT	0.42
PF07366	SnoaL	0.42
PF13365	Trypsin_2	0.42

COG ID	Name	Functional Category	% Frequency in 240 Family Scaffolds
COG1521	Pantothenate kinase type III	Coenzyme transport and metabolism [H]	2.08
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	1.67
COG0805	Twin-arginine protein secretion pathway component TatC	Intracellular trafficking, secretion, and vesicular transport [U]	1.67
COG1633	Rubrerythrin, includes spore coat protein YhjR	Inorganic ion transport and metabolism [P]	0.83
COG1814	Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family	Inorganic ion transport and metabolism [P]	0.83
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.83
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.83
COG3427	Carbon monoxide dehydrogenase subunit CoxG	Energy production and conversion [C]	0.83
COG0025	NhaP-type Na+/H+ or K+/H+ antiporter	Inorganic ion transport and metabolism [P]	0.42
COG0077	Prephenate dehydratase	Amino acid transport and metabolism [E]	0.42
COG0288	Carbonic anhydrase	Inorganic ion transport and metabolism [P]	0.42
COG0381	UDP-N-acetylglucosamine 2-epimerase	Cell wall/membrane/envelope biogenesis [M]	0.42
COG0475	Kef-type K+ transport system, membrane component KefB	Inorganic ion transport and metabolism [P]	0.42
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.42
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.42
COG0791	Cell wall-associated hydrolase, NlpC_P60 family	Cell wall/membrane/envelope biogenesis [M]	0.42
COG0801	7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis)	Coenzyme transport and metabolism [H]	0.42
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.42
COG1272	Predicted membrane channel-forming protein YqfA, hemolysin III family	Intracellular trafficking, secretion, and vesicular transport [U]	0.42
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.42
COG1817	Predicted glycosyltransferase	General function prediction only [R]	0.42
COG2200	EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)	Signal transduction mechanisms [T]	0.42
COG2837	Periplasmic deferrochelatase/peroxidase EfeB	Inorganic ion transport and metabolism [P]	0.42
COG3004	Na+/H+ antiporter NhaA	Energy production and conversion [C]	0.42
COG3263	NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains	Energy production and conversion [C]	0.42
COG3434	c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains	Signal transduction mechanisms [T]	0.42
COG3511	Phospholipase C	Cell wall/membrane/envelope biogenesis [M]	0.42
COG4651	Predicted Kef-type K+ transport protein, K+/H+ antiporter domain	Inorganic ion transport and metabolism [P]	0.42
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.42
COG4943	Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains	Signal transduction mechanisms [T]	0.42
COG5001	Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain	Signal transduction mechanisms [T]	0.42

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.33 %
Unclassified	root	N/A	41.67 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.33 %
Unclassified	root	N/A	41.67 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	57.08 %
Unclassified	root	N/A	41.67 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.25 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	40.83 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.83 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	37.50 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.83 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.83 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.42 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.42 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	21.25 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1.25 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.83 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.42 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.42 %
unclassified Firmicutes sensu stricto	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto	0.42 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	12.50 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.25 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.25 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.83 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.42 %
Sporichthyales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales	0.42 %
Firmicutes bacterium R50	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50	0.42 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.42 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.42 %
Glycomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales	0.42 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.42 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.42 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	12.50 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.25 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Patulibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae	0.42 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.42 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.42 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.42 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.42 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.42 %
Streptosporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	0.42 %
Glycomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae	0.42 %
Sporichthyaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae	0.42 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.42 %
Firmicutes bacterium R50	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	12.50 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.25 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Patulibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter	0.42 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.42 %
Nonomuraea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea	0.42 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.42 %
Sporichthya	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya	0.42 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.42 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.42 %
Glycomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces	0.42 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.42 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.42 %
Firmicutes bacterium R50	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	12.50 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.25 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Patulibacter minatonensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis	0.42 %
Zunongwangia	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia	0.42 %
Glycomyces artemisiae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → Glycomyces artemisiae	0.42 %
unclassified Streptomyces	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces	0.42 %
Sporichthya polymorpha	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha	0.42 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.42 %
Nonomuraea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea	0.42 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.42 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.42 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.42 %
Firmicutes bacterium R50	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	12.50 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.25 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.83 %
Zunongwangia profunda	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda	0.42 %
Streptomyces sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp.	0.42 %
Patulibacter minatonensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis	0.42 %
Glycomyces artemisiae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → Glycomyces artemisiae	0.42 %
Sporichthya polymorpha	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha	0.42 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.42 %
Nonomuraea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea	0.42 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.42 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.42 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.42 %
Firmicutes bacterium R50	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50	0.42 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352024\|deeps__Contig_130338	Not Available	657	Open in IMG/M
2228664021\|ICCgaii200_c0411727	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → Glycomyces artemisiae	632	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c2165401	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda	606	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_10824561	Not Available	553	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100355246	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	592	Open in IMG/M
3300000550\|F24TB_10495496	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	547	Open in IMG/M
3300000550\|F24TB_10958300	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10098382	All Organisms → cellular organisms → Bacteria	722	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10171963	Not Available	515	Open in IMG/M
3300000890\|JGI11643J12802_10053726	Not Available	657	Open in IMG/M
3300000890\|JGI11643J12802_10822319	All Organisms → cellular organisms → Bacteria	957	Open in IMG/M
3300000956\|JGI10216J12902_105390281	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1536	Open in IMG/M
3300000956\|JGI10216J12902_106058976	All Organisms → cellular organisms → Bacteria	1164	Open in IMG/M
3300001867\|JGI12627J18819_10221467	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	762	Open in IMG/M
3300003911\|JGI25405J52794_10042605	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	962	Open in IMG/M
3300004114\|Ga0062593_100074965	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2259	Open in IMG/M
3300004114\|Ga0062593_100502208	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1124	Open in IMG/M
3300004114\|Ga0062593_100858270	Not Available	912	Open in IMG/M
3300004114\|Ga0062593_102088385	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis	632	Open in IMG/M
3300004114\|Ga0062593_102258987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha	611	Open in IMG/M
3300004463\|Ga0063356_101095235	Not Available	1147	Open in IMG/M
3300004479\|Ga0062595_100419872	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	968	Open in IMG/M
3300004479\|Ga0062595_100794853	Not Available	778	Open in IMG/M
3300004479\|Ga0062595_101170396	Not Available	679	Open in IMG/M
3300004633\|Ga0066395_10093444	All Organisms → cellular organisms → Bacteria	1435	Open in IMG/M
3300004633\|Ga0066395_10413416	Not Available	762	Open in IMG/M
3300005093\|Ga0062594_100126327	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1608	Open in IMG/M
3300005167\|Ga0066672_10053489	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2325	Open in IMG/M
3300005172\|Ga0066683_10499862	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	743	Open in IMG/M
3300005330\|Ga0070690_100300072	Not Available	1152	Open in IMG/M
3300005332\|Ga0066388_100005687	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	8742	Open in IMG/M
3300005332\|Ga0066388_100107050	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3279	Open in IMG/M
3300005332\|Ga0066388_106344212	Not Available	596	Open in IMG/M
3300005335\|Ga0070666_10199644	All Organisms → cellular organisms → Bacteria	1407	Open in IMG/M
3300005339\|Ga0070660_100235710	All Organisms → cellular organisms → Bacteria	1489	Open in IMG/M
3300005363\|Ga0008090_14548380	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	535	Open in IMG/M
3300005406\|Ga0070703_10452941	Not Available	569	Open in IMG/M
3300005434\|Ga0070709_10123902	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1756	Open in IMG/M
3300005435\|Ga0070714_100090939	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2673	Open in IMG/M
3300005435\|Ga0070714_100435416	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1244	Open in IMG/M
3300005437\|Ga0070710_10009810	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4692	Open in IMG/M
3300005446\|Ga0066686_10439870	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	891	Open in IMG/M
3300005526\|Ga0073909_10044499	Not Available	1586	Open in IMG/M
3300005537\|Ga0070730_10265127	All Organisms → cellular organisms → Bacteria	1131	Open in IMG/M
3300005544\|Ga0070686_101770692	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp.	525	Open in IMG/M
3300005548\|Ga0070665_102114481	Not Available	567	Open in IMG/M
3300005553\|Ga0066695_10815612	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	537	Open in IMG/M
3300005563\|Ga0068855_100195867	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	2276	Open in IMG/M
3300005615\|Ga0070702_100538066	Not Available	865	Open in IMG/M
3300005713\|Ga0066905_101687375	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300005764\|Ga0066903_100026765	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	6385	Open in IMG/M
3300005764\|Ga0066903_100037137	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5662	Open in IMG/M
3300005764\|Ga0066903_100312096	All Organisms → cellular organisms → Bacteria	2501	Open in IMG/M
3300005764\|Ga0066903_100337097	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2424	Open in IMG/M
3300005764\|Ga0066903_100461498	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2129	Open in IMG/M
3300005764\|Ga0066903_100463899	All Organisms → cellular organisms → Bacteria	2125	Open in IMG/M
3300005764\|Ga0066903_100509469	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2043	Open in IMG/M
3300005764\|Ga0066903_100837576	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1652	Open in IMG/M
3300005764\|Ga0066903_100854905	All Organisms → cellular organisms → Bacteria	1638	Open in IMG/M
3300005764\|Ga0066903_100877979	All Organisms → cellular organisms → Bacteria	1619	Open in IMG/M
3300005764\|Ga0066903_100944664	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1567	Open in IMG/M
3300005764\|Ga0066903_100955204	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1560	Open in IMG/M
3300005764\|Ga0066903_100999114	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1529	Open in IMG/M
3300005764\|Ga0066903_101200342	Not Available	1408	Open in IMG/M
3300005764\|Ga0066903_101634328	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300005764\|Ga0066903_101946769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1127	Open in IMG/M
3300005764\|Ga0066903_102684788	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	966	Open in IMG/M
3300005764\|Ga0066903_102772790	All Organisms → cellular organisms → Bacteria	951	Open in IMG/M
3300005764\|Ga0066903_102854517	All Organisms → cellular organisms → Bacteria	937	Open in IMG/M
3300005764\|Ga0066903_104307949	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300005764\|Ga0066903_106301923	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	619	Open in IMG/M
3300005764\|Ga0066903_106771480	Not Available	596	Open in IMG/M
3300005894\|Ga0075270_1013834	All Organisms → cellular organisms → Bacteria	990	Open in IMG/M
3300005902\|Ga0075273_10039614	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	834	Open in IMG/M
3300005937\|Ga0081455_10022848	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	5833	Open in IMG/M
3300005937\|Ga0081455_10070339	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	2906	Open in IMG/M
3300005937\|Ga0081455_10081128	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2657	Open in IMG/M
3300005937\|Ga0081455_10663891	All Organisms → cellular organisms → Bacteria	669	Open in IMG/M
3300006038\|Ga0075365_11320646	Not Available	507	Open in IMG/M
3300006175\|Ga0070712_100043724	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3085	Open in IMG/M
3300006237\|Ga0097621_100214022	All Organisms → cellular organisms → Bacteria	1677	Open in IMG/M
3300006755\|Ga0079222_10515190	All Organisms → cellular organisms → Bacteria	882	Open in IMG/M
3300006844\|Ga0075428_100132182	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2714	Open in IMG/M
3300006844\|Ga0075428_100248007	All Organisms → cellular organisms → Bacteria	1919	Open in IMG/M
3300006846\|Ga0075430_100205761	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1633	Open in IMG/M
3300006852\|Ga0075433_11145616	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	676	Open in IMG/M
3300006871\|Ga0075434_100715888	Not Available	1018	Open in IMG/M
3300006871\|Ga0075434_101014926	Not Available	843	Open in IMG/M
3300009012\|Ga0066710_100102951	All Organisms → cellular organisms → Bacteria	3826	Open in IMG/M
3300009012\|Ga0066710_102116359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	826	Open in IMG/M
3300009088\|Ga0099830_11420703	Not Available	577	Open in IMG/M
3300009094\|Ga0111539_10098269	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3438	Open in IMG/M
3300009098\|Ga0105245_10476359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1261	Open in IMG/M
3300009148\|Ga0105243_11780773	Not Available	646	Open in IMG/M
3300009156\|Ga0111538_10355113	All Organisms → cellular organisms → Bacteria	1855	Open in IMG/M
3300009156\|Ga0111538_12405408	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	661	Open in IMG/M
3300009162\|Ga0075423_12648140	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	548	Open in IMG/M
3300009174\|Ga0105241_11906551	Not Available	583	Open in IMG/M
3300009176\|Ga0105242_11154878	Not Available	791	Open in IMG/M
3300010043\|Ga0126380_12246146	Not Available	505	Open in IMG/M
3300010047\|Ga0126382_10415516	Not Available	1055	Open in IMG/M
3300010047\|Ga0126382_11841447	Not Available	570	Open in IMG/M
3300010048\|Ga0126373_12064730	Not Available	632	Open in IMG/M
3300010145\|Ga0126321_1505556	Not Available	556	Open in IMG/M
3300010358\|Ga0126370_10159331	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1656	Open in IMG/M
3300010358\|Ga0126370_10669685	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	907	Open in IMG/M
3300010360\|Ga0126372_10114874	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2063	Open in IMG/M
3300010361\|Ga0126378_12208718	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	628	Open in IMG/M
3300010362\|Ga0126377_11165887	All Organisms → cellular organisms → Bacteria → Terrabacteria group	840	Open in IMG/M
3300010362\|Ga0126377_11447395	All Organisms → cellular organisms → Bacteria → Terrabacteria group	760	Open in IMG/M
3300010366\|Ga0126379_10210214	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1880	Open in IMG/M
3300010366\|Ga0126379_10232671	All Organisms → cellular organisms → Bacteria	1800	Open in IMG/M
3300010366\|Ga0126379_10434094	Not Available	1370	Open in IMG/M
3300010366\|Ga0126379_10565877	Not Available	1218	Open in IMG/M
3300010371\|Ga0134125_12129151	Not Available	610	Open in IMG/M
3300010373\|Ga0134128_11508734	Not Available	740	Open in IMG/M
3300010375\|Ga0105239_10158189	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2531	Open in IMG/M
3300010375\|Ga0105239_11072732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	927	Open in IMG/M
3300010376\|Ga0126381_101186068	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50	1103	Open in IMG/M
3300010376\|Ga0126381_102025972	Not Available	829	Open in IMG/M
3300010376\|Ga0126381_102256515	Not Available	782	Open in IMG/M
3300010376\|Ga0126381_102509111	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	739	Open in IMG/M
3300010376\|Ga0126381_103416643	Not Available	625	Open in IMG/M
3300010397\|Ga0134124_12607086	Not Available	548	Open in IMG/M
3300010398\|Ga0126383_10259803	All Organisms → cellular organisms → Bacteria	1710	Open in IMG/M
3300010398\|Ga0126383_13297240	Not Available	527	Open in IMG/M
3300010399\|Ga0134127_11990988	Not Available	659	Open in IMG/M
3300010937\|Ga0137776_1018423	Not Available	1354	Open in IMG/M
3300012199\|Ga0137383_10428527	Not Available	969	Open in IMG/M
3300012204\|Ga0137374_10625343	All Organisms → cellular organisms → Bacteria	818	Open in IMG/M
3300012206\|Ga0137380_11326997	Not Available	604	Open in IMG/M
3300012209\|Ga0137379_10900566	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	789	Open in IMG/M
3300012210\|Ga0137378_10987068	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	756	Open in IMG/M
3300012211\|Ga0137377_10784334	Not Available	886	Open in IMG/M
3300012356\|Ga0137371_11171833	Not Available	575	Open in IMG/M
3300012358\|Ga0137368_10481203	Not Available	803	Open in IMG/M
3300012359\|Ga0137385_11191047	All Organisms → cellular organisms → Bacteria → Terrabacteria group	623	Open in IMG/M
3300012469\|Ga0150984_111876997	Not Available	562	Open in IMG/M
3300012469\|Ga0150984_123327476	Not Available	1155	Open in IMG/M
3300012882\|Ga0157304_1021292	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	826	Open in IMG/M
3300012897\|Ga0157285_10016788	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1510	Open in IMG/M
3300012898\|Ga0157293_10114315	Not Available	715	Open in IMG/M
3300012899\|Ga0157299_10129336	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	689	Open in IMG/M
3300012905\|Ga0157296_10021672	Not Available	1267	Open in IMG/M
3300012916\|Ga0157310_10282060	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	643	Open in IMG/M
3300012943\|Ga0164241_10179915	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1513	Open in IMG/M
3300012957\|Ga0164303_10542376	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	753	Open in IMG/M
3300012961\|Ga0164302_11603676	Not Available	541	Open in IMG/M
3300012971\|Ga0126369_10507274	Not Available	1265	Open in IMG/M
3300012971\|Ga0126369_10981404	Not Available	932	Open in IMG/M
3300012971\|Ga0126369_11017661	Not Available	916	Open in IMG/M
3300012971\|Ga0126369_13360910	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	524	Open in IMG/M
3300012986\|Ga0164304_11724006	Not Available	524	Open in IMG/M
3300013096\|Ga0157307_1003233	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2306	Open in IMG/M
3300013105\|Ga0157369_10141090	All Organisms → cellular organisms → Bacteria	2550	Open in IMG/M
3300013306\|Ga0163162_10301568	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1734	Open in IMG/M
3300013307\|Ga0157372_12398760	Not Available	606	Open in IMG/M
3300013772\|Ga0120158_10390593	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	642	Open in IMG/M
3300015201\|Ga0173478_10109724	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1032	Open in IMG/M
3300015371\|Ga0132258_10121579	All Organisms → cellular organisms → Bacteria	6205	Open in IMG/M
3300015371\|Ga0132258_10152288	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5549	Open in IMG/M
3300015371\|Ga0132258_10300253	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3949	Open in IMG/M
3300015371\|Ga0132258_12400117	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1321	Open in IMG/M
3300015372\|Ga0132256_101418075	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	806	Open in IMG/M
3300015374\|Ga0132255_100829072	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300018027\|Ga0184605_10491798	Not Available	535	Open in IMG/M
3300018073\|Ga0184624_10430561	Not Available	582	Open in IMG/M
3300019356\|Ga0173481_10000896	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	6847	Open in IMG/M
3300019356\|Ga0173481_10008838	All Organisms → cellular organisms → Bacteria	2793	Open in IMG/M
3300019356\|Ga0173481_10009263	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2741	Open in IMG/M
3300019356\|Ga0173481_10880405	Not Available	503	Open in IMG/M
3300019361\|Ga0173482_10026515	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1707	Open in IMG/M
3300019361\|Ga0173482_10364268	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	660	Open in IMG/M
3300019361\|Ga0173482_10635370	Not Available	542	Open in IMG/M
3300019362\|Ga0173479_10606401	Not Available	574	Open in IMG/M
3300020070\|Ga0206356_11575345	Not Available	661	Open in IMG/M
3300020076\|Ga0206355_1193867	Not Available	774	Open in IMG/M
3300020078\|Ga0206352_10092442	Not Available	554	Open in IMG/M
3300021445\|Ga0182009_10046172	All Organisms → cellular organisms → Eukaryota	1822	Open in IMG/M
3300021445\|Ga0182009_10765283	Not Available	526	Open in IMG/M
3300021560\|Ga0126371_10177893	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2209	Open in IMG/M
3300021560\|Ga0126371_10766790	Not Available	1111	Open in IMG/M
3300021560\|Ga0126371_11279342	Not Available	868	Open in IMG/M
3300021560\|Ga0126371_11438906	Not Available	819	Open in IMG/M
3300021560\|Ga0126371_13628760	Not Available	521	Open in IMG/M
3300022195\|Ga0222625_1226572	Not Available	524	Open in IMG/M
3300022467\|Ga0224712_10302888	Not Available	748	Open in IMG/M
3300022467\|Ga0224712_10645780	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300022737\|Ga0247747_1003376	Not Available	1524	Open in IMG/M
3300022893\|Ga0247787_1049109	Not Available	620	Open in IMG/M
3300023062\|Ga0247791_1042289	Not Available	710	Open in IMG/M
3300024284\|Ga0247671_1020675	All Organisms → cellular organisms → Bacteria → Terrabacteria group	985	Open in IMG/M
3300025898\|Ga0207692_10098083	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea	1603	Open in IMG/M
3300025899\|Ga0207642_10042698	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1995	Open in IMG/M
3300025901\|Ga0207688_10086804	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1793	Open in IMG/M
3300025903\|Ga0207680_11020038	Not Available	592	Open in IMG/M
3300025912\|Ga0207707_10074866	All Organisms → cellular organisms → Bacteria	2953	Open in IMG/M
3300025914\|Ga0207671_10785450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	755	Open in IMG/M
3300025916\|Ga0207663_11428229	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	557	Open in IMG/M
3300025918\|Ga0207662_10635026	Not Available	745	Open in IMG/M
3300025927\|Ga0207687_10586361	Not Available	938	Open in IMG/M
3300025928\|Ga0207700_10600679	Not Available	979	Open in IMG/M
3300025929\|Ga0207664_10881870	Not Available	804	Open in IMG/M
3300025930\|Ga0207701_11443498	Not Available	559	Open in IMG/M
3300025942\|Ga0207689_10576737	All Organisms → cellular organisms → Bacteria	946	Open in IMG/M
3300025961\|Ga0207712_10992188	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	745	Open in IMG/M
3300026118\|Ga0207675_101458141	Not Available	705	Open in IMG/M
3300026552\|Ga0209577_10422329	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	947	Open in IMG/M
3300026752\|Ga0207473_104363	Not Available	541	Open in IMG/M
3300026828\|Ga0207502_107136	Not Available	577	Open in IMG/M
3300026861\|Ga0207503_1014227	Not Available	516	Open in IMG/M
3300027821\|Ga0209811_10052064	Not Available	1402	Open in IMG/M
3300027857\|Ga0209166_10353239	All Organisms → cellular organisms → Bacteria → Terrabacteria group	767	Open in IMG/M
3300027873\|Ga0209814_10181663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	906	Open in IMG/M
3300027886\|Ga0209486_11042714	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300027907\|Ga0207428_10178276	Not Available	1606	Open in IMG/M
3300027907\|Ga0207428_10179621	Not Available	1599	Open in IMG/M
3300027992\|Ga0247750_1038912	Not Available	530	Open in IMG/M
3300028720\|Ga0307317_10098072	Not Available	970	Open in IMG/M
3300028814\|Ga0307302_10639651	Not Available	529	Open in IMG/M
3300028881\|Ga0307277_10542307	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	522	Open in IMG/M
3300028885\|Ga0307304_10116758	Not Available	1083	Open in IMG/M
3300031058\|Ga0308189_10243706	Not Available	675	Open in IMG/M
3300031058\|Ga0308189_10513293	Not Available	518	Open in IMG/M
3300031091\|Ga0308201_10024963	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1297	Open in IMG/M
3300031092\|Ga0308204_10051669	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1001	Open in IMG/M
3300031544\|Ga0318534_10106882	All Organisms → cellular organisms → Bacteria	1604	Open in IMG/M
3300031547\|Ga0310887_11144641	Not Available	501	Open in IMG/M
3300031938\|Ga0308175_100302452	All Organisms → cellular organisms → Eukaryota → Sar	1631	Open in IMG/M
3300031938\|Ga0308175_100377638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1473	Open in IMG/M
3300031938\|Ga0308175_100903574	Not Available	971	Open in IMG/M
3300031938\|Ga0308175_101375257	Not Available	787	Open in IMG/M
3300031938\|Ga0308175_101587378	Not Available	732	Open in IMG/M
3300031938\|Ga0308175_102380268	Not Available	593	Open in IMG/M
3300031954\|Ga0306926_12213959	Not Available	612	Open in IMG/M
3300031996\|Ga0308176_10262358	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	1663	Open in IMG/M
3300031996\|Ga0308176_11488731	Not Available	721	Open in IMG/M
3300032009\|Ga0318563_10637563	Not Available	574	Open in IMG/M
3300032261\|Ga0306920_100036714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7053	Open in IMG/M
3300033551\|Ga0247830_10253974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1333	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.17%
Host-Associated	Host-Associated	20.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	77.08%
Plants	Host-Associated → Plants	20.83%
Aquatic	Environmental → Aquatic	2.08%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.92%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.08%
Freshwater	Environmental → Aquatic → Freshwater	0.83%
Sediment	Environmental → Aquatic → Sediment	0.83%
Roots	Host-Associated → Plants → Roots	0.83%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.42%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	57.08%
Loam	Environmental → Terrestrial → Soil → Loam	19.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.00%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.00%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.83%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.83%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.42%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.42%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.42%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.42%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.42%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	35.00%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	12.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.00%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.50%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.00%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.17%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.83%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.83%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.42%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.42%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	0.42%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.42%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.42%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.42%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.42%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	12.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.67%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	11.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.42%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	5.00%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.17%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	2.08%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.08%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	2.08%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.67%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.25%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.25%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.25%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.83%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.83%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.83%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.83%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.83%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.42%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.42%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	0.42%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.42%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.42%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.42%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.42%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.42%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.42%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.42%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.42%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352024	Bare-fallow DEEP SOIL	Environmental	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005894	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203	Environmental	Open in IMG/M
3300005902	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010145	Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010937	Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012882	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2	Environmental	Open in IMG/M
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012905	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2	Environmental	Open in IMG/M
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013096	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)	Environmental	Open in IMG/M
3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022195	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022737	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5	Environmental	Open in IMG/M
3300022893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4	Environmental	Open in IMG/M
3300023062	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4	Environmental	Open in IMG/M
3300024284	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026752	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4w-11 (SPAdes)	Environmental	Open in IMG/M
3300026828	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-12 (SPAdes)	Environmental	Open in IMG/M
3300026861	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027992	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5	Environmental	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_02367130	2199352024	Soil	ERRQHMPMTGRETKEQLYRKAKRLNIKGRSKMNKGALKAAIGRHR
ICCgaii200_04117271	2228664021	Soil	VATVGKQSKGGHFMTMGKERTKEQLYXEAKRLGVKGRSXMNKGQLKAALARRGH
ICChiseqgaiiDRAFT_21654011	3300000033	Soil	TETSFERGSLMAQGRERTKEQLYREAKRLGVKGRSKMNKGQLKAAV
ICChiseqgaiiFebDRAFT_108245611	3300000363	Soil	MPLGNERTKEQLYRQAKSLGIKGRSKMNKGQLKAALARKGH*
INPhiseqgaiiFebDRAFT_1003552462	3300000364	Soil	MPLETKEQLYREARRLGIKGRSKMNKGQLKAAISRRS*
F24TB_104954962	3300000550	Soil	MPTGHERTKEQLYREAKRLGIRGRSKMSKGQLKAAISRHRM*
F24TB_109583002	3300000550	Soil	MPQVKERTKEALYREAKRLGIKGRSKMNKGALKAAVERRR*
AF_2010_repII_A1DRAFT_100983821	3300000597	Forest Soil	MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALSRRGH*
AF_2010_repII_A1DRAFT_101719632	3300000597	Forest Soil	MPISRELTKEQLYREARRLRVKGRSKMTKSQLKSAVARHRHM*
JGI11643J12802_100537262	3300000890	Soil	MPQGKERTKEQLLKEAKKLGIKGRSRMNKGALKAAVDRRR*
JGI11643J12802_108223191	3300000890	Soil	MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAV
JGI10216J12902_1053902812	3300000956	Soil	MPIETKEQLYREAKRLRIKGRSKMTKGQLKAAISRQRM*
JGI10216J12902_1060589763	3300000956	Soil	GKGVPMPLDTKEQLYREAKRLRIKGRSKMNKGQLKAAISRHRM*
JGI12627J18819_102214671	3300001867	Forest Soil	MPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALMRRGH*
JGI25405J52794_100426052	3300003911	Tabebuia Heterophylla Rhizosphere	MPQGTERTKEQLLREAKRLNIKGRSKMNKGALQAAINRRK*
Ga0062593_1000749651	3300004114	Soil	MAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY*
Ga0062593_1005022082	3300004114	Soil	MPLDTKEQLYREARRLGIKGRSKMNKGQLKAAISRRRGA*
Ga0062593_1008582702	3300004114	Soil	MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0062593_1020883851	3300004114	Soil	MTQGKERTKEQLMREAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0062593_1022589871	3300004114	Soil	MPTTGRETKEQLYRQAKRLGIKGRSKMNKGALKAAVGRHTHR*
Ga0063356_1010952353	3300004463	Arabidopsis Thaliana Rhizosphere	MPMGQERTKEQLYREAKRLGIKGRSKMNKGQLKAALLRRGQ*
Ga0062595_1004198722	3300004479	Soil	MPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR*
Ga0062595_1007948531	3300004479	Soil	MTQGKERTKEQLMRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0062595_1011703961	3300004479	Soil	MPMGQERTKEELYRAAKRLNIKGRSKMNKGQLKAALARRGH*
Ga0066395_100934442	3300004633	Tropical Forest Soil	MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066395_104134162	3300004633	Tropical Forest Soil	MPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH*
Ga0062594_1001263274	3300005093	Soil	MPLSHERTKEQLYRQAKSLGIKGRSKMSKGQLKAALARKGH*
Ga0066672_100534891	3300005167	Soil	MIGREPTKEQLYHKAKRLGIKGRSKMSKNQLKAAVGRHR*
Ga0066683_104998621	3300005172	Soil	MPITREFTKEQLYREAKRLRIKGRSKMSKSQLKAAVSRHRHM*
Ga0070690_1003000723	3300005330	Switchgrass Rhizosphere	MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRS*
Ga0066388_1000056872	3300005332	Tropical Forest Soil	MPISHEPTKEQLYRQAKRLKVKGRSKMNKSQLKSAVARRSH*
Ga0066388_1001070503	3300005332	Tropical Forest Soil	MPITGRELTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHHR*
Ga0066388_1063442122	3300005332	Tropical Forest Soil	MPTIGREPTKEQLYRQAKRLGIRGRSKMSKNQLKAAVGRHH*
Ga0070666_101996443	3300005335	Switchgrass Rhizosphere	MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRS*
Ga0070660_1002357103	3300005339	Corn Rhizosphere	MAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS*
Ga0008090_145483801	3300005363	Tropical Rainforest Soil	MAFSRDVTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHHH*
Ga0070703_104529411	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0070709_101239022	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MATGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAAVTRRGH*
Ga0070714_1000909393	3300005435	Agricultural Soil	MTQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0070714_1004354161	3300005435	Agricultural Soil	MPIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH*
Ga0070710_100098106	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0066686_104398702	3300005446	Soil	MATSERTKEQLYSQAKRFGVKGRSKMNKSQLKAALARRGH*
Ga0073909_100444993	3300005526	Surface Soil	MTQGKERTKEELYREAKRLNITGRSKMNKGALKAALARRGH*
Ga0070730_102651271	3300005537	Surface Soil	MTMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALQRRGH*
Ga0070686_1017706922	3300005544	Switchgrass Rhizosphere	MASGQERTKEQLYRQAASLGIKGRSKMNKGQLKAAIDRRR*
Ga0070665_1021144811	3300005548	Switchgrass Rhizosphere	MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT
Ga0066695_108156122	3300005553	Soil	MATRERTKEQLYSQAKRFGVKGRSKMNKGQLKAALARRGH*
Ga0068855_1001958673	3300005563	Corn Rhizosphere	MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT*
Ga0070702_1005380662	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRT*
Ga0066905_1016873751	3300005713	Tropical Forest Soil	MPTRDKTKEQWYRDAKRLGIKGRSKMNKGQLKAAVNRRGH*
Ga0066903_1000267658	3300005764	Tropical Forest Soil	MGRERTKEELYRTAKRLGIKGRSKMNKGQLKAAVARRGG*
Ga0066903_1000371375	3300005764	Tropical Forest Soil	MTIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH*
Ga0066903_1003120964	3300005764	Tropical Forest Soil	MPITRELTKEQLYREAKRLHIKGRSKMSKTQLKAAVSRHRF*
Ga0066903_1003370972	3300005764	Tropical Forest Soil	MPMIGRDLTKEQLYRQARRLGIKGRSKMSKSQLKAAVGRHHR*
Ga0066903_1004614982	3300005764	Tropical Forest Soil	MPIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066903_1004638992	3300005764	Tropical Forest Soil	MPVGEMTKEKLYKEATRLRIKGRSKMTKSQLKSAIDRHSHR*
Ga0066903_1005094691	3300005764	Tropical Forest Soil	MPLETKEQLYREAKRLRIKGRSKMNKGQLKAAVSRHRI*
Ga0066903_1008375762	3300005764	Tropical Forest Soil	MPISREMTKEQLYREAKRLHVKGRSKMTKSQLKSALARQRHI*
Ga0066903_1008549053	3300005764	Tropical Forest Soil	MPISREPTKEQLYREAKRLRVNGRSTMTKSQLKSAVARHRHM*
Ga0066903_1008779792	3300005764	Tropical Forest Soil	MMPTREPTKETLYREAKRLRIKGRSKMSKTQLKSAIARHRF*
Ga0066903_1009446642	3300005764	Tropical Forest Soil	MPMGHDRTKEQLYRQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0066903_1009552042	3300005764	Tropical Forest Soil	MTMGHERTKEELYRQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066903_1009991142	3300005764	Tropical Forest Soil	MPTTEPTKEKLYREARRLRIKGRSKMNKTQLKSAIARHRY*
Ga0066903_1012003422	3300005764	Tropical Forest Soil	MPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH*
Ga0066903_1016343282	3300005764	Tropical Forest Soil	MPIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0066903_1019467691	3300005764	Tropical Forest Soil	NPRRWDMPMGQEQTKAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH*
Ga0066903_1026847882	3300005764	Tropical Forest Soil	MPTTEPSKEKLYREAQRLRIKGRSKMTKTQLQSAIARHRF*
Ga0066903_1027727902	3300005764	Tropical Forest Soil	MPIGQERTKEQLYRQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066903_1028545171	3300005764	Tropical Forest Soil	TSPKGGHLMPMGHERTKQELYRTAKRLNIKGRSKMSKGQLKAALARRGH*
Ga0066903_1043079492	3300005764	Tropical Forest Soil	MPEWGGTCNSMKGVYMPQGTERTKEQLLRDAKRLNIKGRSKMNKGALKAAVDRRK*
Ga0066903_1063019231	3300005764	Tropical Forest Soil	MPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKA
Ga0066903_1067714801	3300005764	Tropical Forest Soil	MPTGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALARRGH*
Ga0075270_10138341	3300005894	Rice Paddy Soil	MPTTRRETKEQLYRQAKSLGIKGRSKMNKGTLKAAIGRHR*
Ga0075273_100396142	3300005902	Rice Paddy Soil	MPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKTAVGRRHR*
Ga0081455_100228482	3300005937	Tabebuia Heterophylla Rhizosphere	MPMETKEQLYREAKRLRIKGRSKMSKGQLKAAVSRHRI*
Ga0081455_100703393	3300005937	Tabebuia Heterophylla Rhizosphere	MPTTRDKTKEQWYREAKRLGIKGRSKMNKGQLKAAVNRRGG*
Ga0081455_100811285	3300005937	Tabebuia Heterophylla Rhizosphere	MPMGHERTKEQLYLQAKRLNIKGHSKMNKGQLKAALQRRGH*
Ga0081455_106638912	3300005937	Tabebuia Heterophylla Rhizosphere	MPTTTGATKEQLYKEAKRLGIKGRSKMKKGALKAAIERRRGH*
Ga0075365_113206461	3300006038	Populus Endosphere	MAMGQERTKEQLYRQAKSLNIKGRSKMTKTQLKAALSRKGH*
Ga0070712_1000437241	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALTRR
Ga0097621_1002140223	3300006237	Miscanthus Rhizosphere	EERGCRMTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0079222_105151902	3300006755	Agricultural Soil	RTKEQLYREAKRLDIKGRSKMNKGALKAALARRGH*
Ga0075428_1001321824	3300006844	Populus Rhizosphere	MPTTRDKTKEQWYRQAKRLGIKGRSKMNKGQLKAAVNRRSS*
Ga0075428_1002480072	3300006844	Populus Rhizosphere	MPQGKERTKEQLLKEAKRLGIQGRSKMNKGALKAAVERRR*
Ga0075430_1002057614	3300006846	Populus Rhizosphere	MTRDELYKEAKRLGIKGRSKMTKGLLKAAVDRRRSS*
Ga0075433_111456162	3300006852	Populus Rhizosphere	MPLDTKEQLYREAKRLRIKGRSKMNKGQLKAAISRQRV*
Ga0075434_1007158881	3300006871	Populus Rhizosphere	MPMGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALARRGH*
Ga0075434_1010149262	3300006871	Populus Rhizosphere	MPTGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALARRGQ*
Ga0066710_1001029513	3300009012	Grasslands Soil	MPITREFTKEQLYREAKRLRIKGRSKMSKSQLKAAVSRHRHM
Ga0066710_1021163591	3300009012	Grasslands Soil	MPMGHERTKEQLYREAKRLGIKGRSRMNKGQLKAALARRGH
Ga0099830_114207032	3300009088	Vadose Zone Soil	MPIGREITKEQLYREARRLGIRGRSKMRKSQLKMAVERRRHR*
Ga0111539_100982695	3300009094	Populus Rhizosphere	MATVKETKEKLYREAKRLNIKGRSKMNKGQLKAALARRGR*
Ga0105245_104763591	3300009098	Miscanthus Rhizosphere	KERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT*
Ga0105243_117807731	3300009148	Miscanthus Rhizosphere	MPMGQERTKQQLYSQAKRLDIKGRSKMNKGQLKAAVARRGH*
Ga0111538_103551132	3300009156	Populus Rhizosphere	MPTTREKSKEQLYREAKRLGIKGRSKMNKGQLKSAVNRRSG*
Ga0111538_124054082	3300009156	Populus Rhizosphere	KERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0075423_126481402	3300009162	Populus Rhizosphere	RTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0105241_119065511	3300009174	Corn Rhizosphere	MPLGNERTKEQLYWQAKSLGIRGRSKMNKGQLKAALARKGH*
Ga0105242_111548781	3300009176	Miscanthus Rhizosphere	MPMGKERTKEELYREAKRLNIRGRSKMNKGALKAALARRGQ*
Ga0126380_122461461	3300010043	Tropical Forest Soil	MAMGKERTKEQLYRAAKRLNIKGRSKMNKGQLKAAVA
Ga0126382_104155161	3300010047	Tropical Forest Soil	MPTELTKEKLYREAKRLGIKGRSKMSKSQLKSAIARRRQF*
Ga0126382_118414471	3300010047	Tropical Forest Soil	VCVVSMDHERTKEQRYREAKRLKIKGRSKMNKGQLKAAVQRRGH*
Ga0126373_120647301	3300010048	Tropical Forest Soil	MPISREMTKEQLYREAKRLHVKGRSKMTKSQLKSAVARHRHF*
Ga0126321_15055562	3300010145	Soil	LEGGERMPTTSGTTKEQLYKEAKRLGIKGRSKMRKGALKAAIERRRGH*
Ga0126370_101593313	3300010358	Tropical Forest Soil	MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAAITRRGH*
Ga0126370_106696851	3300010358	Tropical Forest Soil	RRDQTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH*
Ga0126372_101148742	3300010360	Tropical Forest Soil	MKGVYMPQGTERTKEQLLREAKRLNIKGRSKMNKGALKAAVDRRK*
Ga0126378_122087182	3300010361	Tropical Forest Soil	MPITRELTKEQLYREAKRLRIKGRSKMSKTQLKAAVSRHRF*
Ga0126377_111658872	3300010362	Tropical Forest Soil	MPMETKEQLYREAKRLRIKGRSKMNKGQLKAAISRLR*
Ga0126377_114473952	3300010362	Tropical Forest Soil	MPMETKEQLYREAKRLRIKGRSKMNKGQLKAAISRGR*
Ga0126379_102102141	3300010366	Tropical Forest Soil	MPISHEPTKEQLYRQAKRLKVKGRSKMNKSQLKSVVARRSH*
Ga0126379_102326713	3300010366	Tropical Forest Soil	MPMIGRDLTKEQLYHQAKRLGIKGRSKMSKSQLKAAVGRHHR*
Ga0126379_104340941	3300010366	Tropical Forest Soil	MPIGRRDLTKEQLYHQAKRLGIRGRSKMSKSQLKAAVGRHH*
Ga0126379_105658772	3300010366	Tropical Forest Soil	MGQEQTKAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH*
Ga0134125_121291511	3300010371	Terrestrial Soil	MPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAAL
Ga0134128_115087341	3300010373	Terrestrial Soil	MAQGKERTKEQLLREAKRLGIKGRSKMNKGALRAAVDRRS*
Ga0105239_101581893	3300010375	Corn Rhizosphere	RQSKGGRFMAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY*
Ga0105239_110727321	3300010375	Corn Rhizosphere	MAQGEERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS*
Ga0126381_1011860682	3300010376	Tropical Forest Soil	MPTIGREPTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH*
Ga0126381_1020259722	3300010376	Tropical Forest Soil	MPIDRRDLTKEQLYRQAKRLGIRGRSKMSKNQLKAAVGRHH*
Ga0126381_1022565151	3300010376	Tropical Forest Soil	MAISREMTKEQLYREAKRLHVKGRSKMTKSQLKSAVARHRHF*
Ga0126381_1025091112	3300010376	Tropical Forest Soil	MAIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0126381_1034166432	3300010376	Tropical Forest Soil	MAFSRDVTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH
Ga0134124_126070862	3300010397	Terrestrial Soil	HERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0126383_102598033	3300010398	Tropical Forest Soil	MRMSVTSDLTKEQLYRQAKRLGIKGRSKMSKAQLKSALSRHGWRS*
Ga0126383_132972402	3300010398	Tropical Forest Soil	MPTTEPTKEKLYREARRLHIKGRSKMNKTQLKSAIARHRY*
Ga0134127_119909881	3300010399	Terrestrial Soil	SAIEEGGVVMPLSHERTKEQLYRQAKSLGIRGRSKMNTGQLKAALARKGH*
Ga0137776_10184232	3300010937	Sediment	MTMGHERTKEQLYNQAKRFGIKGRSKMNKGQLKAALARRGH*
Ga0137383_104285272	3300012199	Vadose Zone Soil	MAISRDLTKEQLYHQAKRLGIRGRSKMSKSQLKMAVGRHHR*
Ga0137374_106253431	3300012204	Vadose Zone Soil	MATRERTKEQLYNHAKRLGVKGRSKMNKGQLKAALARRGH*
Ga0137380_113269971	3300012206	Vadose Zone Soil	MPMIDRELTKEQLYRQAKRLGIKGRSKMSKSQLKSAVGRHHR*
Ga0137379_109005662	3300012209	Vadose Zone Soil	MPTERTKEQLYREAKRLGIKGRSRMNKGQLKAALTRRGH*
Ga0137378_109870682	3300012210	Vadose Zone Soil	MPISRDVTKEQLYRQAKRLGIKGRSKMSKSQLKSAVGRHHH*
Ga0137377_107843341	3300012211	Vadose Zone Soil	TMPIGHERTKEQLYREAKRLRIKGRSRMNKGQLKAALTRHGH*
Ga0137371_111718331	3300012356	Vadose Zone Soil	MPTERTKEQLYREAKRLGIKGRSRMNKGQLKAALTRRTQ*
Ga0137368_104812033	3300012358	Vadose Zone Soil	MASRERTKEQLYSQAKRFGVKGRSKMNKGQLKAALARRGH*
Ga0137385_111910471	3300012359	Vadose Zone Soil	GNSPKGGETMPIGHERTKEQLYREAKRLRIKGRSRMNKGQLKSALTRHGH*
Ga0150984_1118769971	3300012469	Avena Fatua Rhizosphere	EGGFAMPIETKEQLYREARRLGIKGRSKMNKGQLKAALSRRRSM*
Ga0150984_1233274762	3300012469	Avena Fatua Rhizosphere	ERTKEQLYREAKRLGIPGRSKMNKGALKAAVERRR*
Ga0157304_10212922	3300012882	Soil	MPQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157285_100167882	3300012897	Soil	MPQGKDRTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157293_101143151	3300012898	Soil	MAQGKERTKEQHLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157299_101293361	3300012899	Soil	MTQGKERTKEELLREAKKLGIKGRSKMNKGALKAAVDRRR*
Ga0157296_100216721	3300012905	Soil	GKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0157310_102820602	3300012916	Soil	MQQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0164241_101799152	3300012943	Soil	MPTGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALA
Ga0164303_105423762	3300012957	Soil	SANRRGSFKPLGNERTKEQLYRQAKSLGIRGRSKMNKGQLKAALARKGH*
Ga0164302_116036762	3300012961	Soil	MTMGKERTKEELYSQAKRLGVKGRSKMNKGQLKAALARQGH*
Ga0126369_105072742	3300012971	Tropical Forest Soil	MGQEQTNAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH*
Ga0126369_109814041	3300012971	Tropical Forest Soil	MGHERTKEQLYNQAKRLDIKGRSKMNKGQLKAALARRGH*
Ga0126369_110176611	3300012971	Tropical Forest Soil	MPTGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0126369_133609102	3300012971	Tropical Forest Soil	MGHERTKEELYRQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0164304_117240062	3300012986	Soil	MTTGHERTKEQLYRQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0157307_10032335	3300013096	Soil	MPQGKERTKEQLLKEAKRLGIKGHSRMNKGALKAAVDRRR*
Ga0157369_101410902	3300013105	Corn Rhizosphere	MPMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALSRRGH*
Ga0163162_103015684	3300013306	Switchgrass Rhizosphere	MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157372_123987601	3300013307	Corn Rhizosphere	RGSFMPLGNERTKEQLYRQAKSLGIRGRSKMNKGQLKAALARKGH*
Ga0120158_103905932	3300013772	Permafrost	NNRREALMAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK*
Ga0173478_101097241	3300015201	Soil	QGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0132258_1012157913	3300015371	Arabidopsis Rhizosphere	MIVREPTKEQLYRQAKRLDIKGRSKMNKGQLKAAIGRHHR*
Ga0132258_101522886	3300015371	Arabidopsis Rhizosphere	MPMGKERTKEELYREAKRLDIKGRSKMTKGALKAALARRGR*
Ga0132258_103002535	3300015371	Arabidopsis Rhizosphere	MPMETKEQLYREAKRLGIKGRSRMNKGQLKAAVSRRRGG*
Ga0132258_124001171	3300015371	Arabidopsis Rhizosphere	MAEGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0132256_1014180753	3300015372	Arabidopsis Rhizosphere	MAQGKETTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0132255_1008290722	3300015374	Arabidopsis Rhizosphere	MAQGKERTKEQLMRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0184605_104917981	3300018027	Groundwater Sediment	VAQVRERSKEQLYREAKRLGVKGRSKMNKGQLKAAVNRRSS
Ga0184624_104305611	3300018073	Groundwater Sediment	MPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGL
Ga0173481_100008968	3300019356	Soil	MPQGKDRTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0173481_100088383	3300019356	Soil	MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR
Ga0173481_100092636	3300019356	Soil	MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0173481_108804052	3300019356	Soil	MPTTGRETKEQLYRQAKRLGIKGRSKMNKGALKAAVGRHTHR
Ga0173482_100265153	3300019361	Soil	MPQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0173482_103642681	3300019361	Soil	MTMGKERTREELYREAKRLNIKGRSKMNKRQLLAAVNRKK
Ga0173482_106353702	3300019361	Soil	MPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGH
Ga0173479_106064012	3300019362	Soil	MATGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALMRRGH
Ga0206356_115753452	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MPMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALSRRGH
Ga0206355_11938672	3300020076	Corn, Switchgrass And Miscanthus Rhizosphere	GGAMPMGKERTKEQLYSEAKRLDIKGRSKMNKGALKAALARRGH
Ga0206352_100924421	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	MPMGKERTKEQLYSEAKRLDIKGRSKMNKGALKAALARRGH
Ga0182009_100461722	3300021445	Soil	MPTTNRETKEQLYRQAKRLGVKGRSKMNKGALKAAIARRTGS
Ga0182009_107652831	3300021445	Soil	MPVSHGPTKEQLLREAKRLNIKGRSKMNKGALQAAVNRRK
Ga0126371_101778933	3300021560	Tropical Forest Soil	MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALTRRGH
Ga0126371_107667903	3300021560	Tropical Forest Soil	MPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH
Ga0126371_112793423	3300021560	Tropical Forest Soil	MPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH
Ga0126371_114389062	3300021560	Tropical Forest Soil	MAMGKERTKEQLYNEAKRLKIKGRSKMNKGALKAALARRGH
Ga0126371_136287602	3300021560	Tropical Forest Soil	MAISREMTKEQLYREAKRLHVKGRSKMSKSQLKSAVARHRNL
Ga0222625_12265721	3300022195	Groundwater Sediment	MTMGHERTKEQLYRQAKSLDIKGRSKMNKGQLKAALARKGH
Ga0224712_103028881	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	ERRQQMPTTGRETKEQLYRQAKRLNIKGRSKMNKGALKAAIGRHR
Ga0224712_106457802	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	RKEANMPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR
Ga0247747_10033761	3300022737	Soil	MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERR
Ga0247787_10491091	3300022893	Soil	MAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVERRR
Ga0247791_10422891	3300023062	Soil	KERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0247671_10206752	3300024284	Soil	CRMTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS
Ga0207692_100980831	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	TQREAEQLYREAKRLGVKGRSKMNKGQLKAALTRRGH
Ga0207642_100426981	3300025899	Miscanthus Rhizosphere	MAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS
Ga0207688_100868044	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAA
Ga0207680_110200381	3300025903	Switchgrass Rhizosphere	MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRS
Ga0207707_100748663	3300025912	Corn Rhizosphere	MPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR
Ga0207671_107854502	3300025914	Corn Rhizosphere	MPMGQERTKQQLYSQAKRLDIKGRSKMNKGQLKAAVARRGH
Ga0207663_114282291	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MPIETKEQLYREARRLGIKGRSKMNKGQLKAALSRRRSS
Ga0207662_106350261	3300025918	Switchgrass Rhizosphere	MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRS
Ga0207687_105863611	3300025927	Miscanthus Rhizosphere	MPLSHERTKEQLYRQAKSLGIKGRSKMSKGQLKAALARKGH
Ga0207700_106006792	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MPIGHERTKAQLYREAKRLGVKGRSKMNKGQLKAALTRRGH
Ga0207664_108818702	3300025929	Agricultural Soil	MPIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH
Ga0207701_114434982	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRT
Ga0207689_105767371	3300025942	Miscanthus Rhizosphere	IDRRGKGWRMAQGEERTKGQLLREAKRLGIKGRSKMNKGALKAAVDRRS
Ga0207712_109921882	3300025961	Switchgrass Rhizosphere	QERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY
Ga0207675_1014581411	3300026118	Switchgrass Rhizosphere	MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0209577_104223291	3300026552	Soil	MIGREPTKEQLYHKAKRLGIKGRSKMSKNQLKAAVGRHR
Ga0207473_1043632	3300026752	Soil	MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVDRRR
Ga0207502_1071361	3300026828	Soil	MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDR
Ga0207503_10142271	3300026861	Soil	MPTTGRETKEQLYRQAKRLGIKGRSKMNKGQLKAAVNRRGR
Ga0209811_100520643	3300027821	Surface Soil	MTQGKERTKEELYREAKRLNITGRSKMNKGALKAALARRGH
Ga0209166_103532391	3300027857	Surface Soil	MTMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALQRRGH
Ga0209814_101816631	3300027873	Populus Rhizosphere	MPQGKERTKEQLLKEAKRLGIQGRSKMNKGALKAAVDRRR
Ga0209486_110427142	3300027886	Agricultural Soil	MPTTTRFTKEQLYREAKRLGIKGRSKMNKGALKAAVERRRGH
Ga0207428_101782763	3300027907	Populus Rhizosphere	MPTTRDKTKEQWYRQAKRLGIKGRSKMNKGQLKAAVNRRSS
Ga0207428_101796213	3300027907	Populus Rhizosphere	MATVKETKEKLYREAKRLNIKGRSKMNKGQLKAALARRGR
Ga0247750_10389121	3300027992	Soil	QSKGGRFMAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY
Ga0307317_100980722	3300028720	Soil	MANNRREALMAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK
Ga0307302_106396511	3300028814	Soil	MPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAA
Ga0307277_105423072	3300028881	Soil	MAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK
Ga0307304_101167581	3300028885	Soil	MAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK
Ga0308189_102437062	3300031058	Soil	ARVGRRTANNRREALMAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK
Ga0308189_105132932	3300031058	Soil	ANNRREALMAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK
Ga0308201_100249633	3300031091	Soil	TMGHERTKEQLYRQAKSLDIKGRSKMNKGQLKAALARKGH
Ga0308204_100516692	3300031092	Soil	ISMPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGH
Ga0318534_101068822	3300031544	Soil	MPTTEPTKEKLYREARRLHIKGRSKMNKTQLKSAIARHRY
Ga0310887_111446411	3300031547	Soil	MTQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRR
Ga0308175_1003024523	3300031938	Soil	EGRHQMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIAPHR
Ga0308175_1003776381	3300031938	Soil	WRMAQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRS
Ga0308175_1009035742	3300031938	Soil	RHQMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIARRTGR
Ga0308175_1013752572	3300031938	Soil	MPMTGRETKEQLYRKAKRLNIKGRSKMNKGALKAAIGRHR
Ga0308175_1015873781	3300031938	Soil	MPIGHERTKEQLYREAKRFGIKGRSKMNKGQLKAALSKRGH
Ga0308175_1023802681	3300031938	Soil	MPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAA
Ga0306926_122139592	3300031954	Soil	MATGHERTNEQLYRQAQRLGNKGRSKMNKGQLKVALTRRGH
Ga0308176_102623582	3300031996	Soil	MPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIAPHR
Ga0308176_114887311	3300031996	Soil	MPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIA
Ga0318563_106375631	3300032009	Soil	MPTIGRELTKEQLYRQARRLGIKGRSKMSKSQLKSAVGRHHR
Ga0306920_1000367144	3300032261	Soil	MPTEITKEQLYREARRLRIRGRSKMTKSQLRAAISRQRGM
Ga0247830_102539742	3300033551	Soil	MPMETKEQLYREAKRLGIKGRSRMNKGQLKAAVSRRRGG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F017514

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences