


| Basic Information | |
|---|---|
| Family ID | F017444 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 240 |
| Average Sequence Length | 39 residues |
| Representative Sequence | FLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 240 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 88.33 % |
| % of genes from short scaffolds (< 2000 bps) | 99.58 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 240 Family Scaffolds |
|---|---|---|
| PF13609 | Porin_4 | 28.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.42 % |
| Unclassified | root | N/A | 29.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004763|Ga0007746_1010860 | Not Available | 1113 | Open in IMG/M |
| 3300004763|Ga0007746_1036504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1255 | Open in IMG/M |
| 3300004763|Ga0007746_1037549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1338 | Open in IMG/M |
| 3300004763|Ga0007746_1038704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1371 | Open in IMG/M |
| 3300004763|Ga0007746_1053235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1125 | Open in IMG/M |
| 3300004763|Ga0007746_1057326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 684 | Open in IMG/M |
| 3300004763|Ga0007746_1068872 | Not Available | 1269 | Open in IMG/M |
| 3300004764|Ga0007754_1011348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 1282 | Open in IMG/M |
| 3300004767|Ga0007750_1000458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1363 | Open in IMG/M |
| 3300004767|Ga0007750_1019497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 902 | Open in IMG/M |
| 3300004767|Ga0007750_1022423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 1343 | Open in IMG/M |
| 3300004767|Ga0007750_1048099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 639 | Open in IMG/M |
| 3300004768|Ga0007762_1002544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 1324 | Open in IMG/M |
| 3300004768|Ga0007762_1022944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1220 | Open in IMG/M |
| 3300004768|Ga0007762_1024489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1156 | Open in IMG/M |
| 3300004768|Ga0007762_1025922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 652 | Open in IMG/M |
| 3300004769|Ga0007748_10019323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1347 | Open in IMG/M |
| 3300004769|Ga0007748_10027960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 1266 | Open in IMG/M |
| 3300004769|Ga0007748_10186083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 938 | Open in IMG/M |
| 3300004769|Ga0007748_10213713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 903 | Open in IMG/M |
| 3300004786|Ga0007753_1004566 | Not Available | 1333 | Open in IMG/M |
| 3300004786|Ga0007753_1006894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 704 | Open in IMG/M |
| 3300004787|Ga0007755_1013562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1155 | Open in IMG/M |
| 3300004787|Ga0007755_1028827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1351 | Open in IMG/M |
| 3300004787|Ga0007755_1029188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1357 | Open in IMG/M |
| 3300004787|Ga0007755_1050165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 710 | Open in IMG/M |
| 3300004788|Ga0007742_10002716 | Not Available | 1297 | Open in IMG/M |
| 3300004788|Ga0007742_10018448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300004789|Ga0007752_10023317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1344 | Open in IMG/M |
| 3300004789|Ga0007752_10098408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1321 | Open in IMG/M |
| 3300004789|Ga0007752_10113453 | Not Available | 753 | Open in IMG/M |
| 3300004790|Ga0007758_10022437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1345 | Open in IMG/M |
| 3300004790|Ga0007758_10028340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1349 | Open in IMG/M |
| 3300004792|Ga0007761_10114044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1355 | Open in IMG/M |
| 3300004793|Ga0007760_10057778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1352 | Open in IMG/M |
| 3300004795|Ga0007756_10001855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1344 | Open in IMG/M |
| 3300004795|Ga0007756_10010102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1337 | Open in IMG/M |
| 3300004795|Ga0007756_10075112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1028 | Open in IMG/M |
| 3300004795|Ga0007756_10076670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1355 | Open in IMG/M |
| 3300004795|Ga0007756_10098335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1153 | Open in IMG/M |
| 3300004795|Ga0007756_10118726 | Not Available | 1386 | Open in IMG/M |
| 3300004795|Ga0007756_10132497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 708 | Open in IMG/M |
| 3300004795|Ga0007756_10161278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1309 | Open in IMG/M |
| 3300004796|Ga0007763_10158310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 668 | Open in IMG/M |
| 3300004796|Ga0007763_10190299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 644 | Open in IMG/M |
| 3300004797|Ga0007764_10124550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 647 | Open in IMG/M |
| 3300004836|Ga0007759_10084336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 804 | Open in IMG/M |
| 3300004836|Ga0007759_10093250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1395 | Open in IMG/M |
| 3300005415|Ga0007743_1017298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
| 3300005418|Ga0068881_1118250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1318 | Open in IMG/M |
| 3300005420|Ga0068879_1047852 | Not Available | 861 | Open in IMG/M |
| 3300005565|Ga0068885_1001425 | Not Available | 615 | Open in IMG/M |
| 3300005565|Ga0068885_1054421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1334 | Open in IMG/M |
| 3300005565|Ga0068885_1107288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1353 | Open in IMG/M |
| 3300005565|Ga0068885_1911135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1288 | Open in IMG/M |
| 3300007304|Ga0102689_1021370 | Not Available | 1317 | Open in IMG/M |
| 3300007304|Ga0102689_1093600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1313 | Open in IMG/M |
| 3300007304|Ga0102689_1132104 | Not Available | 1371 | Open in IMG/M |
| 3300007304|Ga0102689_1185121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 635 | Open in IMG/M |
| 3300007304|Ga0102689_1197773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1356 | Open in IMG/M |
| 3300007319|Ga0102691_1052901 | Not Available | 1321 | Open in IMG/M |
| 3300007319|Ga0102691_1108976 | Not Available | 1206 | Open in IMG/M |
| 3300007321|Ga0102692_1065437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1363 | Open in IMG/M |
| 3300007321|Ga0102692_1067099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1341 | Open in IMG/M |
| 3300007321|Ga0102692_1069124 | Not Available | 1376 | Open in IMG/M |
| 3300007321|Ga0102692_1165526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1383 | Open in IMG/M |
| 3300007534|Ga0102690_1078782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1297 | Open in IMG/M |
| 3300007534|Ga0102690_1175609 | Not Available | 1405 | Open in IMG/M |
| 3300007534|Ga0102690_1204604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1295 | Open in IMG/M |
| 3300011381|Ga0102688_1013371 | Not Available | 1373 | Open in IMG/M |
| 3300011381|Ga0102688_1125280 | Not Available | 1278 | Open in IMG/M |
| 3300011381|Ga0102688_1125810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1311 | Open in IMG/M |
| 3300012471|Ga0129334_1036710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 732 | Open in IMG/M |
| 3300012471|Ga0129334_1129883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 960 | Open in IMG/M |
| 3300012686|Ga0157560_1169704 | Not Available | 1495 | Open in IMG/M |
| 3300012689|Ga0157565_1018942 | Not Available | 1349 | Open in IMG/M |
| 3300012689|Ga0157565_1103859 | Not Available | 1425 | Open in IMG/M |
| 3300012691|Ga0157569_1061475 | Not Available | 1467 | Open in IMG/M |
| 3300012692|Ga0157571_1106352 | Not Available | 1383 | Open in IMG/M |
| 3300012693|Ga0157573_1068349 | Not Available | 1355 | Open in IMG/M |
| 3300012701|Ga0157562_1118367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus | 532 | Open in IMG/M |
| 3300012702|Ga0157596_1095203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1337 | Open in IMG/M |
| 3300012706|Ga0157627_1079814 | Not Available | 1330 | Open in IMG/M |
| 3300012706|Ga0157627_1207849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1354 | Open in IMG/M |
| 3300012707|Ga0157623_1012698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1282 | Open in IMG/M |
| 3300012707|Ga0157623_1101393 | Not Available | 836 | Open in IMG/M |
| 3300012708|Ga0157595_1001058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1352 | Open in IMG/M |
| 3300012709|Ga0157608_1093642 | Not Available | 1184 | Open in IMG/M |
| 3300012709|Ga0157608_1137127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1266 | Open in IMG/M |
| 3300012711|Ga0157607_1167274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 813 | Open in IMG/M |
| 3300012711|Ga0157607_1244624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 880 | Open in IMG/M |
| 3300012715|Ga0157599_1025818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1342 | Open in IMG/M |
| 3300012715|Ga0157599_1040842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 1280 | Open in IMG/M |
| 3300012715|Ga0157599_1088959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 769 | Open in IMG/M |
| 3300012717|Ga0157609_1198503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
| 3300012719|Ga0157600_1141549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 657 | Open in IMG/M |
| 3300012722|Ga0157630_1257981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1319 | Open in IMG/M |
| 3300012724|Ga0157611_1287989 | Not Available | 1402 | Open in IMG/M |
| 3300012726|Ga0157597_1129945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 1341 | Open in IMG/M |
| 3300012729|Ga0157625_1181511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1330 | Open in IMG/M |
| 3300012730|Ga0157602_1286310 | Not Available | 1371 | Open in IMG/M |
| 3300012754|Ga0138278_1143979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1321 | Open in IMG/M |
| 3300012758|Ga0138285_1049295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1251 | Open in IMG/M |
| 3300012758|Ga0138285_1156962 | Not Available | 1402 | Open in IMG/M |
| 3300012758|Ga0138285_1184365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 544 | Open in IMG/M |
| 3300012761|Ga0138288_1009335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 1278 | Open in IMG/M |
| 3300012761|Ga0138288_1041989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1387 | Open in IMG/M |
| 3300012763|Ga0138289_1003776 | Not Available | 1448 | Open in IMG/M |
| 3300012763|Ga0138289_1020274 | Not Available | 1397 | Open in IMG/M |
| 3300012763|Ga0138289_1087261 | Not Available | 539 | Open in IMG/M |
| 3300012763|Ga0138289_1103469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus | 1523 | Open in IMG/M |
| 3300012763|Ga0138289_1115008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1170 | Open in IMG/M |
| 3300012768|Ga0138276_1191502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 668 | Open in IMG/M |
| 3300012769|Ga0138279_1102465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1381 | Open in IMG/M |
| 3300012769|Ga0138279_1202955 | Not Available | 1388 | Open in IMG/M |
| 3300012770|Ga0138291_1065359 | Not Available | 1241 | Open in IMG/M |
| 3300012772|Ga0138287_1086971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 1266 | Open in IMG/M |
| 3300012772|Ga0138287_1215133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus | 1553 | Open in IMG/M |
| 3300012772|Ga0138287_1240042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1331 | Open in IMG/M |
| 3300012773|Ga0138290_1109303 | Not Available | 1444 | Open in IMG/M |
| 3300012773|Ga0138290_1210404 | Not Available | 1415 | Open in IMG/M |
| 3300012773|Ga0138290_1295628 | Not Available | 749 | Open in IMG/M |
| 3300012774|Ga0138283_1165298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus | 1578 | Open in IMG/M |
| 3300012775|Ga0138280_1103894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1486 | Open in IMG/M |
| 3300012775|Ga0138280_1143777 | Not Available | 1445 | Open in IMG/M |
| 3300012775|Ga0138280_1263616 | Not Available | 1355 | Open in IMG/M |
| 3300012776|Ga0138275_1349777 | Not Available | 806 | Open in IMG/M |
| 3300012777|Ga0138292_1183389 | Not Available | 690 | Open in IMG/M |
| 3300012968|Ga0129337_1079178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus planktonicus | 1716 | Open in IMG/M |
| 3300012968|Ga0129337_1084358 | Not Available | 547 | Open in IMG/M |
| 3300012968|Ga0129337_1254307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300012968|Ga0129337_1288249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 570 | Open in IMG/M |
| 3300012968|Ga0129337_1296302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1320 | Open in IMG/M |
| 3300012968|Ga0129337_1315619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1392 | Open in IMG/M |
| 3300012968|Ga0129337_1347782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 735 | Open in IMG/M |
| 3300012968|Ga0129337_1351348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1313 | Open in IMG/M |
| 3300012968|Ga0129337_1404163 | Not Available | 1339 | Open in IMG/M |
| 3300012968|Ga0129337_1405277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1356 | Open in IMG/M |
| 3300012968|Ga0129337_1423526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1301 | Open in IMG/M |
| 3300012970|Ga0129338_1011534 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300012970|Ga0129338_1026724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1109 | Open in IMG/M |
| 3300012970|Ga0129338_1056651 | Not Available | 1166 | Open in IMG/M |
| 3300012970|Ga0129338_1057716 | Not Available | 580 | Open in IMG/M |
| 3300012970|Ga0129338_1087904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1324 | Open in IMG/M |
| 3300012970|Ga0129338_1251679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1296 | Open in IMG/M |
| 3300012970|Ga0129338_1259610 | Not Available | 1404 | Open in IMG/M |
| 3300012970|Ga0129338_1286834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1310 | Open in IMG/M |
| 3300012970|Ga0129338_1302907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1314 | Open in IMG/M |
| 3300012970|Ga0129338_1309556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
| 3300012970|Ga0129338_1315799 | Not Available | 1363 | Open in IMG/M |
| 3300012970|Ga0129338_1321621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 641 | Open in IMG/M |
| 3300012970|Ga0129338_1337429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 876 | Open in IMG/M |
| 3300012970|Ga0129338_1380152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1344 | Open in IMG/M |
| 3300012970|Ga0129338_1436796 | Not Available | 1189 | Open in IMG/M |
| 3300012970|Ga0129338_1529112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1540 | Open in IMG/M |
| 3300012970|Ga0129338_1573641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1311 | Open in IMG/M |
| 3300012970|Ga0129338_1587213 | Not Available | 646 | Open in IMG/M |
| 3300012970|Ga0129338_1603425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 565 | Open in IMG/M |
| 3300013295|Ga0170791_10879940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 1353 | Open in IMG/M |
| 3300013295|Ga0170791_12471001 | Not Available | 1454 | Open in IMG/M |
| 3300013295|Ga0170791_13821156 | Not Available | 1117 | Open in IMG/M |
| 3300013295|Ga0170791_15441552 | Not Available | 820 | Open in IMG/M |
| 3300013295|Ga0170791_15920667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus planktonicus | 1634 | Open in IMG/M |
| 3300019191|Ga0180035_1063736 | Not Available | 810 | Open in IMG/M |
| 3300019201|Ga0180032_1008734 | Not Available | 1134 | Open in IMG/M |
| 3300019201|Ga0180032_1064086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 718 | Open in IMG/M |
| 3300019201|Ga0180032_1118116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus turicensis | 694 | Open in IMG/M |
| 3300019201|Ga0180032_1147146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1372 | Open in IMG/M |
| 3300021323|Ga0210295_1055224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera | 713 | Open in IMG/M |
| 3300021323|Ga0210295_1111319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 686 | Open in IMG/M |
| 3300021847|Ga0210305_1117129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 500 | Open in IMG/M |
| 3300022156|Ga0213934_1005714 | Not Available | 1539 | Open in IMG/M |
| 3300023708|Ga0228709_1019778 | Not Available | 1406 | Open in IMG/M |
| 3300023708|Ga0228709_1020410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1384 | Open in IMG/M |
| 3300023708|Ga0228709_1021212 | Not Available | 1358 | Open in IMG/M |
| 3300023708|Ga0228709_1110059 | Not Available | 559 | Open in IMG/M |
| 3300024480|Ga0255223_1022731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1028 | Open in IMG/M |
| 3300024480|Ga0255223_1094010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 519 | Open in IMG/M |
| 3300024483|Ga0255224_1011146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 1660 | Open in IMG/M |
| 3300024483|Ga0255224_1020111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1305 | Open in IMG/M |
| 3300024483|Ga0255224_1023982 | Not Available | 1209 | Open in IMG/M |
| 3300024483|Ga0255224_1064578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 759 | Open in IMG/M |
| 3300024485|Ga0256318_1018697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1418 | Open in IMG/M |
| 3300024485|Ga0256318_1022444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1311 | Open in IMG/M |
| 3300024485|Ga0256318_1072754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
| 3300024487|Ga0255222_1011521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1232 | Open in IMG/M |
| 3300024530|Ga0256322_1059908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 680 | Open in IMG/M |
| 3300024531|Ga0255228_1022106 | Not Available | 1232 | Open in IMG/M |
| 3300024531|Ga0255228_1091596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
| 3300024533|Ga0256299_1015718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus | 1406 | Open in IMG/M |
| 3300024533|Ga0256299_1016107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1393 | Open in IMG/M |
| 3300024533|Ga0256299_1035771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 972 | Open in IMG/M |
| 3300024534|Ga0256357_1017219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1389 | Open in IMG/M |
| 3300024534|Ga0256357_1019305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus universalis | 1313 | Open in IMG/M |
| 3300024542|Ga0256350_1014812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1343 | Open in IMG/M |
| 3300024547|Ga0255292_1113755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus planktonicus | 532 | Open in IMG/M |
| 3300024549|Ga0256308_1021162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus planktonicus | 1424 | Open in IMG/M |
| 3300024556|Ga0256341_1022098 | Not Available | 1340 | Open in IMG/M |
| 3300024558|Ga0255232_1018126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1388 | Open in IMG/M |
| 3300024558|Ga0255232_1044144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera | 916 | Open in IMG/M |
| 3300024559|Ga0255284_1021663 | Not Available | 1408 | Open in IMG/M |
| 3300024561|Ga0255288_1022263 | Not Available | 1414 | Open in IMG/M |
| 3300024562|Ga0256336_1082921 | Not Available | 688 | Open in IMG/M |
| 3300024564|Ga0255237_1027677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1326 | Open in IMG/M |
| 3300024566|Ga0256309_1044117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1182 | Open in IMG/M |
| 3300024567|Ga0256307_1026330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1395 | Open in IMG/M |
| 3300024568|Ga0255238_1030928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1317 | Open in IMG/M |
| 3300024568|Ga0255238_1037856 | Not Available | 1187 | Open in IMG/M |
| 3300024568|Ga0255238_1158556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300024569|Ga0255243_1030941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1382 | Open in IMG/M |
| 3300024569|Ga0255243_1090083 | Not Available | 758 | Open in IMG/M |
| 3300024571|Ga0256302_1027094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1322 | Open in IMG/M |
| 3300024848|Ga0255229_1073976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
| 3300024851|Ga0255293_1106733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
| 3300024852|Ga0255295_1018275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1360 | Open in IMG/M |
| 3300024853|Ga0255252_1016312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1335 | Open in IMG/M |
| 3300024853|Ga0255252_1073180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 651 | Open in IMG/M |
| 3300024854|Ga0255287_1028733 | Not Available | 1353 | Open in IMG/M |
| 3300024860|Ga0256344_1021932 | Not Available | 1431 | Open in IMG/M |
| 3300024862|Ga0256317_1019464 | Not Available | 1435 | Open in IMG/M |
| 3300025747|Ga0255247_1005898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1420 | Open in IMG/M |
| 3300025749|Ga0256314_1009364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1351 | Open in IMG/M |
| 3300025753|Ga0255235_1013046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1273 | Open in IMG/M |
| 3300025761|Ga0256310_1019328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1098 | Open in IMG/M |
| 3300025761|Ga0256310_1034900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 786 | Open in IMG/M |
| 3300026409|Ga0255307_1036259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 693 | Open in IMG/M |
| 3300026428|Ga0255309_1029251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 972 | Open in IMG/M |
| 3300026429|Ga0255253_1009176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1512 | Open in IMG/M |
| 3300026444|Ga0256364_1062111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 644 | Open in IMG/M |
| 3300026567|Ga0256303_1042934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 986 | Open in IMG/M |
| 3300026569|Ga0255277_1008746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 2565 | Open in IMG/M |
| 3300026569|Ga0255277_1029072 | Not Available | 1452 | Open in IMG/M |
| 3300026569|Ga0255277_1035028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1317 | Open in IMG/M |
| 3300026572|Ga0255270_1028399 | Not Available | 1410 | Open in IMG/M |
| 3300028085|Ga0255255_1011643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1431 | Open in IMG/M |
| 3300028113|Ga0255234_1039278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1236 | Open in IMG/M |
| 3300028113|Ga0255234_1046840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1134 | Open in IMG/M |
| 3300028113|Ga0255234_1196501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
| 3300028261|Ga0256316_1033821 | Not Available | 898 | Open in IMG/M |
| 3300028530|Ga0255279_1014195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1383 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 26.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.25% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.25% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.08% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004764 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004768 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004786 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005415 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007319 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012471 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012686 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES055 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012689 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES065 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES070 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012692 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES073 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012693 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES075 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012701 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES061 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012777 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300019191 | Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021847 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024530 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024534 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024542 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024547 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024851 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024852 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024854 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024860 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025747 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025749 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025753 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025761 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026409 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026428 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026429 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026444 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028085 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028261 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0007746_10108602 | 3300004763 | Freshwater Lake | ILLLFLKPHQLLDEKVRELSHQAIDEVSKTIGELYEQEY* |
| Ga0007746_10365041 | 3300004763 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQKY* |
| Ga0007746_10375492 | 3300004763 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQEH* |
| Ga0007746_10387042 | 3300004763 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVSKTIGEIYEQKY* |
| Ga0007746_10532352 | 3300004763 | Freshwater Lake | HIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0007746_10573262 | 3300004763 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEY* |
| Ga0007746_10688722 | 3300004763 | Freshwater Lake | VHIFLLLFLKPHQLIDEKVRELSHQSIDEVLKIIGEIYEQEY* |
| Ga0007754_10113482 | 3300004764 | Freshwater Lake | IFLLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0007750_10004582 | 3300004767 | Freshwater Lake | FLLIVLKPHQLLDEKVRELSHQAIDEVLKQLGEIYEQEY* |
| Ga0007750_10194972 | 3300004767 | Freshwater Lake | IFLLLFLKPHQLLDVKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0007750_10224232 | 3300004767 | Freshwater Lake | IFLLLFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEY* |
| Ga0007750_10480992 | 3300004767 | Freshwater Lake | VHIFLLLFLKLHQSLDEKVRELFHQAIDEVLKTIGEIYEQEY* |
| Ga0007762_10025442 | 3300004768 | Freshwater Lake | FLLLFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEY* |
| Ga0007762_10229442 | 3300004768 | Freshwater Lake | IFLLLFLKPHQSLDEKVRELSHQAIDEVSKTIGEIYEQKY* |
| Ga0007762_10244892 | 3300004768 | Freshwater Lake | VHIFLLLFLKPHQLLDQKVRELSDQAIDEVLKTIGEIYEQEY* |
| Ga0007762_10259222 | 3300004768 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0007748_100193232 | 3300004769 | Freshwater Lake | FLLLFLKPHQSLDEKVRELSHQAIDEVSKTIGEIYEQEY* |
| Ga0007748_100279602 | 3300004769 | Freshwater Lake | FLLFFLKPHQLLDEKVRELSHQAIDEVLKKIGEIYEQEY* |
| Ga0007748_101860832 | 3300004769 | Freshwater Lake | HIFLLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQEH* |
| Ga0007748_102137132 | 3300004769 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELFHQAIDEVLKTIGEIYEQEH* |
| Ga0007753_10045662 | 3300004786 | Freshwater Lake | VLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0007753_10068942 | 3300004786 | Freshwater Lake | IFLLLFLKPHQLLDEKVRELSHQAVDEVLKTIGEIYEQEY* |
| Ga0007755_10135622 | 3300004787 | Freshwater Lake | IFLLLFLKPHQLLDEKVRELSHQAIDEVLKITGEIYEQEH* |
| Ga0007755_10288272 | 3300004787 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQATDEVLKTIGEIYEQEY* |
| Ga0007755_10291882 | 3300004787 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTTGEIYEQEY* |
| Ga0007755_10501652 | 3300004787 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIGEVLKTIGEIYEQEY* |
| Ga0007742_100027162 | 3300004788 | Freshwater Lake | FLLLFLKPHQLLDEKVRELSHQAIGEVLKTIGEIYEQEY* |
| Ga0007742_100184482 | 3300004788 | Freshwater Lake | IFLLLFLKPHQLLDEKVRELFHQAIDEVLKTIGEIYEQEH* |
| Ga0007752_100233172 | 3300004789 | Freshwater Lake | FLLLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0007752_100984082 | 3300004789 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0007752_101134532 | 3300004789 | Freshwater Lake | HIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0007758_100224372 | 3300004790 | Freshwater Lake | FLLLFLKPHQSLDEKVRELSHQAIDEVSKTIGEIYEQKY* |
| Ga0007758_100283402 | 3300004790 | Freshwater Lake | IFLLLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0007761_101140442 | 3300004792 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0007760_100577782 | 3300004793 | Freshwater Lake | IFLLLFLKPHQSLDEKVRELSHQAIDEVSKTIGEIYEQEY* |
| Ga0007756_100018552 | 3300004795 | Freshwater Lake | ILLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0007756_100101022 | 3300004795 | Freshwater Lake | FLLLFLNPHQLLDEKVRELSHQAIDEDLKTIGEIYEQKY* |
| Ga0007756_100751122 | 3300004795 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTTGEIYEQEY* |
| Ga0007756_100766702 | 3300004795 | Freshwater Lake | VHIFLLMFLKPHQLLDEKVRELSHQAIDEVLKTLGEIYEQEY* |
| Ga0007756_100983351 | 3300004795 | Freshwater Lake | IFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0007756_101187262 | 3300004795 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQAN* |
| Ga0007756_101324971 | 3300004795 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQGH* |
| Ga0007756_101612782 | 3300004795 | Freshwater Lake | IHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYE* |
| Ga0007763_101583102 | 3300004796 | Freshwater Lake | VHIILLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0007763_101902991 | 3300004796 | Freshwater Lake | HIFLLLFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEH* |
| Ga0007764_101245502 | 3300004797 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEH* |
| Ga0007759_100843362 | 3300004836 | Freshwater Lake | VHIFLLLFLKPHQLPDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0007759_100932502 | 3300004836 | Freshwater Lake | VHIFLLLFLKPHQLLDVKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0007743_10172982 | 3300005415 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0068881_11182502 | 3300005418 | Freshwater Lake | HIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQES* |
| Ga0068879_10478521 | 3300005420 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQKY* |
| Ga0068885_10014252 | 3300005565 | Freshwater Lake | LLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEH* |
| Ga0068885_10544212 | 3300005565 | Freshwater Lake | FLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0068885_11072882 | 3300005565 | Freshwater Lake | LLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQES* |
| Ga0068885_19111352 | 3300005565 | Freshwater Lake | LKPHQLLDEKVRELSHQAIGEVLKTIGEIYEQEH* |
| Ga0102689_10213702 | 3300007304 | Freshwater Lake | IVLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEH* |
| Ga0102689_10936002 | 3300007304 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQAIGEVLKTIGEIYEQEH* |
| Ga0102689_11321041 | 3300007304 | Freshwater Lake | LFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0102689_11851211 | 3300007304 | Freshwater Lake | LFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0102689_11977732 | 3300007304 | Freshwater Lake | LKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0102691_10529012 | 3300007319 | Freshwater Lake | VHIVLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEH* |
| Ga0102691_11089762 | 3300007319 | Freshwater Lake | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0102692_10654372 | 3300007321 | Freshwater Lake | FLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0102692_10670992 | 3300007321 | Freshwater Lake | FLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQES* |
| Ga0102692_10691241 | 3300007321 | Freshwater Lake | LKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0102692_11655261 | 3300007321 | Freshwater Lake | HIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0102690_10787822 | 3300007534 | Freshwater Lake | FLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQES* |
| Ga0102690_11756091 | 3300007534 | Freshwater Lake | HIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0102690_12046042 | 3300007534 | Freshwater Lake | LFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0102688_10133712 | 3300011381 | Freshwater Lake | VLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEH* |
| Ga0102688_11252802 | 3300011381 | Freshwater Lake | LLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0102688_11258102 | 3300011381 | Freshwater Lake | LLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0129334_10367102 | 3300012471 | Aqueous | LKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0129334_11298832 | 3300012471 | Aqueous | FLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157560_11697042 | 3300012686 | Freshwater | FLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157565_10189422 | 3300012689 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0157565_11038592 | 3300012689 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157569_10614752 | 3300012691 | Freshwater | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157571_11063521 | 3300012692 | Freshwater | LVHIILLLFLKPHQLLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0157573_10683491 | 3300012693 | Freshwater | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0157562_11183672 | 3300012701 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0157596_10952032 | 3300012702 | Freshwater | FLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157627_10798141 | 3300012706 | Freshwater | LFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0157627_12078492 | 3300012706 | Freshwater | LVHIFLLIVLKPHQLLDEKVRELSHQAIDEVLKQLGEIYEQEY* |
| Ga0157623_10126981 | 3300012707 | Freshwater | LVHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0157623_11013931 | 3300012707 | Freshwater | LLLFLKPHPLLDEKIPELSHQAIYEVLKTIGEIYEQEY* |
| Ga0157595_10010582 | 3300012708 | Freshwater | LVHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157608_10936422 | 3300012709 | Freshwater | LVHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157608_11371272 | 3300012709 | Freshwater | LFLKPHQSLDEKVRELSHQAIDEVLKTTGEIYEQEY* |
| Ga0157607_11672741 | 3300012711 | Freshwater | LFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQEH* |
| Ga0157607_12446241 | 3300012711 | Freshwater | LLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0157599_10258182 | 3300012715 | Freshwater | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0157599_10408422 | 3300012715 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKTTGEIYEQEY* |
| Ga0157599_10889591 | 3300012715 | Freshwater | MFLLLFVKPFLFLDGKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0157609_11985031 | 3300012717 | Freshwater | IHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYE* |
| Ga0157600_11415492 | 3300012719 | Freshwater | LFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0157630_12579812 | 3300012722 | Freshwater | LLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0157611_12879892 | 3300012724 | Freshwater | FFLKPHQLLDEKVRELSHQAIDEVLKKTNGEIYEN* |
| Ga0157597_11299452 | 3300012726 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTTGEIYEQEY* |
| Ga0157625_11815111 | 3300012729 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0157602_12863102 | 3300012730 | Freshwater | LLLFLKPHQSLDEKVRELSHQAIDEVLKTIGELYEQEY* |
| Ga0138278_11439792 | 3300012754 | Freshwater Lake | FLLLFLTPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0138285_10492951 | 3300012758 | Freshwater Lake | LVHIFLLLFLKPHQLLDEKVRELSHQAIGEVLKTIGEIYEQEY* |
| Ga0138285_11569622 | 3300012758 | Freshwater Lake | FLLLFLKPHQMLDEKVRELSHQAFDEVLKTIGEIYEQEY* |
| Ga0138285_11843653 | 3300012758 | Freshwater Lake | LFLKTPKLLDEKISELSHKAIDEILKKIGEKYEKDN* |
| Ga0138288_10093351 | 3300012761 | Freshwater Lake | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0138288_10419891 | 3300012761 | Freshwater Lake | LVHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQDN* |
| Ga0138289_10037762 | 3300012763 | Freshwater Lake | LFVLKPHQLLDEKVRELSHQAIDEVLKQIGEIYET* |
| Ga0138289_10202742 | 3300012763 | Freshwater Lake | LAHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0138289_10872612 | 3300012763 | Freshwater Lake | FLLLFLKPHQLPDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0138289_11034692 | 3300012763 | Freshwater Lake | FLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIHEKQST* |
| Ga0138289_11150082 | 3300012763 | Freshwater Lake | LLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQEY* |
| Ga0138276_11915022 | 3300012768 | Freshwater Lake | LVHIFLLLFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEY* |
| Ga0138279_11024651 | 3300012769 | Freshwater Lake | LVHIFLLLFLTPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0138279_12029552 | 3300012769 | Freshwater Lake | LLLFVLKPHQLLDEKVRELSHQAIDEVLKQIGEVYET* |
| Ga0138291_10653592 | 3300012770 | Freshwater Lake | LVHIFLLLFLKPHQLIDKKVRELSYQSIDEVLKTIGEIYEQEY* |
| Ga0138287_10869712 | 3300012772 | Freshwater Lake | LVHIFLLLFLKPHQLLGEKVRELSHQAIDEVLKTIGEIYEQEH* |
| Ga0138287_12151332 | 3300012772 | Freshwater Lake | LLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIHEKQST* |
| Ga0138287_12400421 | 3300012772 | Freshwater Lake | FLLLFLKPHQLLDEKVRELSHQAIDEALKTIGEIYEQEY* |
| Ga0138290_11093032 | 3300012773 | Freshwater Lake | LFLKPHQLPDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0138290_12104042 | 3300012773 | Freshwater Lake | FLLFVLKPHQLLDEKVRELSHQAIDEVLKQIGEIYET* |
| Ga0138290_12956281 | 3300012773 | Freshwater Lake | LFLKPHQLLDEKVRELSHQANDEVLKTIGEIYEQEY* |
| Ga0138283_11652982 | 3300012774 | Freshwater Lake | FLKHHQLLDEKVRELSHQAIDDVLKTKLGEIHETQQT* |
| Ga0138280_11038942 | 3300012775 | Freshwater Lake | LFLTPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0138280_11437771 | 3300012775 | Freshwater Lake | LVHIFLLLFLKPHHLLDEKVRELSHQANDEVLKTIGEIYEQEY* |
| Ga0138280_12636162 | 3300012775 | Freshwater Lake | FLLMFLKPHQLLDEKVRELSHQAIDEVLKTLGEIYEQEH* |
| Ga0138275_13497772 | 3300012776 | Freshwater Lake | LFLKPHQLIDEKILELSHQAIDEVLKTIGEIYEQEY* |
| Ga0138292_11833891 | 3300012777 | Freshwater Lake | IVLKPHQLLDEKVRELSHQAIDEVLKQLGEIYEQEY* |
| Ga0129337_10791782 | 3300012968 | Aqueous | LFLKPHQLLDEKVRELSHQVIDEVLKTIGDIYEQEY* |
| Ga0129337_10843582 | 3300012968 | Aqueous | LVHIFLLLFLKPHQLFDEKVRELSHQTIDEVLKTIGEIYEQEY* |
| Ga0129337_12543071 | 3300012968 | Aqueous | LLMFLKPHQLLDEKVRELSHQAIDEVLKTLGEIYE* |
| Ga0129337_12882492 | 3300012968 | Aqueous | LVHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTTGEIYEQEY* |
| Ga0129337_12963022 | 3300012968 | Aqueous | LIHIFLLLFLKPHQSLDEKVRELSHQAIDEVSKIIGEIYE* |
| Ga0129337_13156192 | 3300012968 | Aqueous | FLLLFLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQKY* |
| Ga0129337_13477822 | 3300012968 | Aqueous | LLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQKH* |
| Ga0129337_13513482 | 3300012968 | Aqueous | ILKKPHQSLDEKVRELSHQAIDEVFLKLGEIYEQEH* |
| Ga0129337_14041631 | 3300012968 | Aqueous | LVHIFLLLFLKPHQFLDEKVRELSHQEIDEVLKTIGEIYEQEY* |
| Ga0129337_14052772 | 3300012968 | Aqueous | LFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEC* |
| Ga0129337_14235262 | 3300012968 | Aqueous | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQDY* |
| Ga0129338_10115341 | 3300012970 | Aqueous | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYE* |
| Ga0129338_10267241 | 3300012970 | Aqueous | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEC* |
| Ga0129338_10566511 | 3300012970 | Aqueous | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQDY* |
| Ga0129338_10577161 | 3300012970 | Aqueous | LFVKPHQLLDEIVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0129338_10879042 | 3300012970 | Aqueous | MFLLMFLKPHQSLDEKVRELSHQAIDEVLKTLGETYEQ |
| Ga0129338_12516791 | 3300012970 | Aqueous | LIVLKPHQLLDEKVRELSHQAIDEVLKQLGEIYEQEY* |
| Ga0129338_12596101 | 3300012970 | Aqueous | LLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYE* |
| Ga0129338_12868341 | 3300012970 | Aqueous | LVHIFLLLCLKPHQLLDEKVRELSHQAIDEVLNTIGEIYEQEH* |
| Ga0129338_13029071 | 3300012970 | Aqueous | LLLFLKPHQSLDEKVRELSHQAIDEVLKTIGETYEQEY* |
| Ga0129338_13095562 | 3300012970 | Aqueous | LVHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTKGEIYEQEY* |
| Ga0129338_13157991 | 3300012970 | Aqueous | LLFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEY* |
| Ga0129338_13216211 | 3300012970 | Aqueous | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQKH* |
| Ga0129338_13374291 | 3300012970 | Aqueous | LVHIFLLILKKPHQSLDEKVRELSHQAIDEVFLKLGEIYEQEH* |
| Ga0129338_13801521 | 3300012970 | Aqueous | FNILVHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0129338_14367962 | 3300012970 | Aqueous | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQAN* |
| Ga0129338_15291121 | 3300012970 | Aqueous | LVHIFLLLFLKPHQSLDEKVRELSHQAIGEVLKTIGEIYEQEH* |
| Ga0129338_15736412 | 3300012970 | Aqueous | LLLFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQEH* |
| Ga0129338_15872131 | 3300012970 | Aqueous | LFLKPHQLIDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0129338_16034251 | 3300012970 | Aqueous | MFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGETYEQ |
| Ga0170791_108799401 | 3300013295 | Freshwater | LKPHQMLDEKVRELSHQAFDEVLKTIGEIYEQEY* |
| Ga0170791_124710011 | 3300013295 | Freshwater | LVHIFLLLFLKPHQLPDEKVRELSHQAIDEVLKTIGEIYEQEY* |
| Ga0170791_138211561 | 3300013295 | Freshwater | LVHVFLLLFLKPHQLLDEKVREPSHQAVDEVLKTIGEIHEQEY* |
| Ga0170791_154415522 | 3300013295 | Freshwater | LFLKHHQLLDEKVRELSHQAIDDVLKKKLGEIHETQQT* |
| Ga0170791_159206672 | 3300013295 | Freshwater | LFLKPHQLLDEKVRELSHQVIDEVLKTIGEIYEQEY* |
| Ga0180035_10637361 | 3300019191 | Estuarine | FLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0180032_10087341 | 3300019201 | Estuarine | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0180032_10640861 | 3300019201 | Estuarine | MFLKPHQLLDEKVRELSHQAIDEVLKTLGEIYEQEY |
| Ga0180032_11181162 | 3300019201 | Estuarine | LFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0180032_11471461 | 3300019201 | Estuarine | LVHIFLLLFLKPHQLLDEKVRELSHQATDEVLKTIGEIYEQEY |
| Ga0210295_10552242 | 3300021323 | Estuarine | FLLLFLKPHQSLDEKVRELSHQAIDEVLKTTGEIYEQEY |
| Ga0210295_11113192 | 3300021323 | Estuarine | LVHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0210305_11171292 | 3300021847 | Estuarine | FLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0213934_10057143 | 3300022156 | Freshwater | LLFLKPHQLLDENVRELSHQAIDEVLKIIGEIYEQEY |
| Ga0228709_10197781 | 3300023708 | Freshwater | LFLKPHQLLDVKVRDVSHQAMDEVLKTIGEIYEQEYYISSGG |
| Ga0228709_10204102 | 3300023708 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKIIGEIYEQEY |
| Ga0228709_10212122 | 3300023708 | Freshwater | LKPHQLLDEKVRELSHQAIDEVLKKTNGEIYEKESN |
| Ga0228709_11100592 | 3300023708 | Freshwater | LLLFLKPHQLLDEKVGELSHQAIDEVLKTIGEIYEQEY |
| Ga0255223_10227311 | 3300024480 | Freshwater | LLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255223_10940102 | 3300024480 | Freshwater | LVHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255224_10111462 | 3300024483 | Freshwater | LFIYFSYLFLKPHQLLDEKVRELSHQEIDEALKTIGEIYEQEY |
| Ga0255224_10201112 | 3300024483 | Freshwater | FLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0255224_10239822 | 3300024483 | Freshwater | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255224_10645781 | 3300024483 | Freshwater | LLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256318_10186971 | 3300024485 | Freshwater | RLVHIFLLLFLKPHQLLDEKVRALSHQAIDEVLKTIGEIYEQEY |
| Ga0256318_10224442 | 3300024485 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0256318_10727542 | 3300024485 | Freshwater | FLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255222_10115212 | 3300024487 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256322_10599082 | 3300024530 | Freshwater | FLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255228_10221062 | 3300024531 | Freshwater | FLKPHQLLDEKVSELSHQAIDEVLKTIGEIYEQEH |
| Ga0255228_10915962 | 3300024531 | Freshwater | VHIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256299_10157182 | 3300024533 | Freshwater | MFLLLFLKPHQLLDENVRELSHQAIDEALKTIGEIYEQEY |
| Ga0256299_10161072 | 3300024533 | Freshwater | LFLKPHQSLYEKVRELSHQDIDEVLKKIGEIYEQEY |
| Ga0256299_10357712 | 3300024533 | Freshwater | FLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256357_10172191 | 3300024534 | Freshwater | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256357_10193052 | 3300024534 | Freshwater | VHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0256350_10148122 | 3300024542 | Freshwater | LVHIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0255292_11137552 | 3300024547 | Freshwater | MFLLMFLKPHQSLDEKVRELSHQAIDEVLKTLGETYEQEY |
| Ga0256308_10211623 | 3300024549 | Freshwater | LFLKPHQLLDEKFRELSHQAIDEVLKTIGEIYEQEY |
| Ga0256341_10220982 | 3300024556 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEN |
| Ga0255232_10181262 | 3300024558 | Freshwater | LLYLKPHQLLDEKVRELSHQAIDEVLNTIGEIYEQEY |
| Ga0255232_10441442 | 3300024558 | Freshwater | LFLKPHQSLDEKVRELSHQAIDEVLKTTGEIYEQEY |
| Ga0255284_10216632 | 3300024559 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTNGEIYEKQ |
| Ga0255288_10222631 | 3300024561 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEN |
| Ga0256336_10829212 | 3300024562 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKTIGETYEQEY |
| Ga0255237_10276772 | 3300024564 | Freshwater | HIFLLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256309_10441172 | 3300024566 | Freshwater | HIFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256307_10263301 | 3300024567 | Freshwater | MFLKPHQLFDEKVRELSHQAIDEVLKTLGEIYEQEY |
| Ga0255238_10309282 | 3300024568 | Freshwater | LLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255238_10378562 | 3300024568 | Freshwater | LYLKPHQLLDEKVRELSHQAIDEVLNTIGEIYEQEY |
| Ga0255238_11585562 | 3300024568 | Freshwater | LFLKPHQSLDKKVGELSHQAIDEDLKTIGEIYEQEH |
| Ga0255243_10309412 | 3300024569 | Freshwater | YLKPHQLLDEKVRELSHQAIDEVLNTIGEIYEQEY |
| Ga0255243_10900832 | 3300024569 | Freshwater | LFLKPHQLLDEKVRELSHLAIDEVLKTIGEIYEQEY |
| Ga0256302_10270942 | 3300024571 | Freshwater | LLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0255229_10739762 | 3300024848 | Freshwater | LFLKPHQSLDEKVPELSHQAIDEVLKTIGEIYEQEY |
| Ga0255293_11067331 | 3300024851 | Freshwater | LFLKPHQSLDEKVRELSHQAIDEVLKIIGEIYEQKY |
| Ga0255295_10182752 | 3300024852 | Freshwater | LFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0255252_10163122 | 3300024853 | Freshwater | LLLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0255252_10731801 | 3300024853 | Freshwater | LFLKPHQWLDEKVLEVSHQAIDEVLKTKGEIYEQEY |
| Ga0255287_10287331 | 3300024854 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTIGELYEQEY |
| Ga0256344_10219322 | 3300024860 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTNGEIYENQ |
| Ga0256317_10194642 | 3300024862 | Freshwater | IFLLLFLKPHQLLDEKVSELSHKAIDEVLKTIGEIYEQEY |
| Ga0255247_10058981 | 3300025747 | Freshwater | HIFLLLFLKPHQLLDEKVRALSHQAIDEVLKTIGEIYEQEY |
| Ga0256314_10093642 | 3300025749 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQKY |
| Ga0255235_10130461 | 3300025753 | Freshwater | LLLFLKPHQLLDEEVRELSHQAIDEVLKTIGEIYE |
| Ga0256310_10193282 | 3300025761 | Freshwater | SYCFLKAHQLLDEKVSELSHQAIDEVLKTIGEIYE |
| Ga0256310_10349001 | 3300025761 | Freshwater | FNILVHIFLLLFLKPHQLLDEEVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255307_10362591 | 3300026409 | Freshwater | LFLKPNQSVDEKVRDFSYQAIDEVLKTIGEIYEQEY |
| Ga0255309_10292512 | 3300026428 | Freshwater | PIVLKPHQLLDEKNRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255253_10091762 | 3300026429 | Freshwater | FLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQEH |
| Ga0256364_10621112 | 3300026444 | Freshwater | LLLFLKPHQSLDAKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0256303_10429341 | 3300026567 | Freshwater | NILVHIFLLLFLKPHQLIDEKVRELSHQATDEVLKTIGEIYEQEY |
| Ga0255277_10087462 | 3300026569 | Freshwater | LFLKPHQLLDEKVREISHQAIDAVLKTKGEIYEQEY |
| Ga0255277_10290722 | 3300026569 | Freshwater | LFLKPHQLLDEKVRELSHQAIDEVLKKNGEIYEKQ |
| Ga0255277_10350282 | 3300026569 | Freshwater | LLFLKPHQLLDEKVRELSHQAIDEVLKTIGEIYEQKY |
| Ga0255270_10283992 | 3300026572 | Freshwater | LVHMFLLLFLKPHQLLDEKVRELSHQAIDEVLKTIGETYEQEY |
| Ga0255255_10116432 | 3300028085 | Freshwater | LFLKPHQFLVETVSELSHQAIDEILKTIGEIYEKEY |
| Ga0255234_10392782 | 3300028113 | Freshwater | FLKPHQSLDEKVRELSHQAIDEVLKTTGEIYEQEY |
| Ga0255234_10468402 | 3300028113 | Freshwater | LFSKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255234_11965012 | 3300028113 | Freshwater | LLLFLKPHQSLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0256316_10338211 | 3300028261 | Freshwater | VALPIFNIVVHILLLLFVKPHRLLDEKVRELSHQAIDEVLKTIGEIYEQEY |
| Ga0255279_10141952 | 3300028530 | Freshwater | LFLKPHQLLDENVRELSHQAIDEVLKTTGEIYEQEY |
| ⦗Top⦘ |