NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017175

Metagenome / Metatranscriptome Family F017175

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017175
Family Type Metagenome / Metatranscriptome
Number of Sequences 242
Average Sequence Length 46 residues
Representative Sequence YLNGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Number of Associated Samples 188
Number of Associated Scaffolds 242

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.96 %
% of genes near scaffold ends (potentially truncated) 91.32 %
% of genes from short scaffolds (< 2000 bps) 90.50 %
Associated GOLD sequencing projects 173
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.926 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.967 % of family members)
Environment Ontology (ENVO) Unclassified
(26.033 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.132 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.58%    β-sheet: 0.00%    Coil/Unstructured: 53.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 242 Family Scaffolds
PF00583Acetyltransf_1 12.81
PF07859Abhydrolase_3 3.72
PF00196GerE 2.89
PF13561adh_short_C2 2.48
PF00135COesterase 2.48
PF00756Esterase 2.07
PF00440TetR_N 2.07
PF11139SfLAP 2.07
PF08241Methyltransf_11 1.65
PF01370Epimerase 1.65
PF02909TetR_C_1 1.24
PF01177Asp_Glu_race 1.24
PF00561Abhydrolase_1 1.24
PF03176MMPL 1.24
PF13673Acetyltransf_10 1.24
PF00296Bac_luciferase 1.24
PF04672Methyltransf_19 0.83
PF13649Methyltransf_25 0.83
PF02518HATPase_c 0.83
PF00753Lactamase_B 0.83
PF07730HisKA_3 0.83
PF12697Abhydrolase_6 0.83
PF06108DUF952 0.83
PF09957VapB_antitoxin 0.41
PF00106adh_short 0.41
PF06941NT5C 0.41
PF02985HEAT 0.41
PF05016ParE_toxin 0.41
PF00775Dioxygenase_C 0.41
PF08281Sigma70_r4_2 0.41
PF12802MarR_2 0.41
PF12680SnoaL_2 0.41
PF00400WD40 0.41
PF04343DUF488 0.41
PF06902Fer4_19 0.41
PF13602ADH_zinc_N_2 0.41
PF00027cNMP_binding 0.41
PF00486Trans_reg_C 0.41
PF07885Ion_trans_2 0.41
PF02720DUF222 0.41
PF08327AHSA1 0.41
PF01471PG_binding_1 0.41
PF00005ABC_tran 0.41
PF03136Pup_ligase 0.41
PF12535Nudix_N 0.41
PF13460NAD_binding_10 0.41
PF13560HTH_31 0.41
PF07719TPR_2 0.41
PF16859TetR_C_11 0.41
PF02861Clp_N 0.41
PF07690MFS_1 0.41
PF13676TIR_2 0.41
PF09360zf-CDGSH 0.41
PF01047MarR 0.41
PF12051DUF3533 0.41
PF14310Fn3-like 0.41
PF11695DUF3291 0.41
PF01844HNH 0.41
PF02322Cyt_bd_oxida_II 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 242 Family Scaffolds
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 3.72
COG2272Carboxylesterase type BLipid transport and metabolism [I] 2.48
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 1.24
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 1.24
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.24
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 1.24
COG3502Uncharacterized conserved protein, DUF952 familyFunction unknown [S] 0.83
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.83
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.83
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.83
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.83
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.41
COG1294Cytochrome bd-type quinol oxidase, subunit 2Energy production and conversion [C] 0.41
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.41
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.41
COG45025'(3')-deoxyribonucleotidaseNucleotide transport and metabolism [F] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.34 %
UnclassifiedrootN/A20.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10016587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5497Open in IMG/M
3300004152|Ga0062386_100650832Not Available863Open in IMG/M
3300005186|Ga0066676_10661530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300005332|Ga0066388_104618453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300005363|Ga0008090_15026519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300005434|Ga0070709_10366310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300005434|Ga0070709_10406587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1017Open in IMG/M
3300005435|Ga0070714_100154525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2070Open in IMG/M
3300005435|Ga0070714_102338928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300005436|Ga0070713_100268218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1562Open in IMG/M
3300005436|Ga0070713_100796778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300005436|Ga0070713_101818050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300005440|Ga0070705_100777483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300005468|Ga0070707_100177948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2073Open in IMG/M
3300005533|Ga0070734_10904942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces500Open in IMG/M
3300005553|Ga0066695_10293139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1026Open in IMG/M
3300005553|Ga0066695_10371373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia893Open in IMG/M
3300005591|Ga0070761_10472327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300005602|Ga0070762_11316382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces502Open in IMG/M
3300005614|Ga0068856_100147115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2363Open in IMG/M
3300005764|Ga0066903_104958116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M
3300005841|Ga0068863_100840875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces916Open in IMG/M
3300005921|Ga0070766_10590746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia745Open in IMG/M
3300006028|Ga0070717_10329396All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300006028|Ga0070717_11702846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hokutonensis571Open in IMG/M
3300006175|Ga0070712_101439973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300006176|Ga0070765_102122535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300006806|Ga0079220_10111215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1441Open in IMG/M
3300006854|Ga0075425_100553199All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300006904|Ga0075424_102562394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces534Open in IMG/M
3300006954|Ga0079219_10156331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1226Open in IMG/M
3300006954|Ga0079219_12020269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces549Open in IMG/M
3300007076|Ga0075435_100323750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1319Open in IMG/M
3300009147|Ga0114129_11497214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia829Open in IMG/M
3300009148|Ga0105243_10699724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria988Open in IMG/M
3300009520|Ga0116214_1065110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1327Open in IMG/M
3300009520|Ga0116214_1399524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii536Open in IMG/M
3300009522|Ga0116218_1101111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1312Open in IMG/M
3300009672|Ga0116215_1392493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300009698|Ga0116216_10073331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2104Open in IMG/M
3300009698|Ga0116216_10150054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1433Open in IMG/M
3300009698|Ga0116216_10323987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia938Open in IMG/M
3300009700|Ga0116217_10946809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300010046|Ga0126384_10297344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300010048|Ga0126373_11509035Not Available737Open in IMG/M
3300010048|Ga0126373_13143270Not Available514Open in IMG/M
3300010154|Ga0127503_11028466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300010159|Ga0099796_10192684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia823Open in IMG/M
3300010320|Ga0134109_10433974All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010359|Ga0126376_12871359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300010361|Ga0126378_11195947Not Available858Open in IMG/M
3300010361|Ga0126378_11385840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii796Open in IMG/M
3300010366|Ga0126379_10802024All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300010373|Ga0134128_11940708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia648Open in IMG/M
3300010373|Ga0134128_12769509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300010376|Ga0126381_100612763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1550Open in IMG/M
3300010376|Ga0126381_104293894Not Available552Open in IMG/M
3300010379|Ga0136449_103336927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii616Open in IMG/M
3300010396|Ga0134126_11945946All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300010396|Ga0134126_12243865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300010398|Ga0126383_11733671All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300010398|Ga0126383_12201561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300010398|Ga0126383_12460311All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300010398|Ga0126383_12804302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300010399|Ga0134127_13660696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300010401|Ga0134121_12922074Not Available525Open in IMG/M
3300010858|Ga0126345_1028544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae617Open in IMG/M
3300010867|Ga0126347_1250021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces605Open in IMG/M
3300010880|Ga0126350_10691156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300012181|Ga0153922_1173033Not Available511Open in IMG/M
3300012209|Ga0137379_10026310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5594Open in IMG/M
3300012210|Ga0137378_10792084All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300012210|Ga0137378_10797763All Organisms → cellular organisms → Eukaryota → Opisthokonta857Open in IMG/M
3300012356|Ga0137371_10053919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3111Open in IMG/M
3300012356|Ga0137371_10213965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300012357|Ga0137384_10640239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia866Open in IMG/M
3300012685|Ga0137397_11025117Not Available606Open in IMG/M
3300012917|Ga0137395_11300598Not Available502Open in IMG/M
3300012929|Ga0137404_10629167Not Available967Open in IMG/M
3300012957|Ga0164303_10242455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1027Open in IMG/M
3300012971|Ga0126369_11789550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300013297|Ga0157378_11329175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300015356|Ga0134073_10117796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300015372|Ga0132256_102251555Not Available649Open in IMG/M
3300016341|Ga0182035_10048539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2866Open in IMG/M
3300016341|Ga0182035_10485622Not Available1053Open in IMG/M
3300016357|Ga0182032_11337985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300016371|Ga0182034_10354614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora corrugata1192Open in IMG/M
3300016371|Ga0182034_10763609Not Available825Open in IMG/M
3300016404|Ga0182037_12024071All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300016422|Ga0182039_10528977Not Available1022Open in IMG/M
3300016445|Ga0182038_10496837All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300016445|Ga0182038_11914267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300017821|Ga0187812_1302930Not Available508Open in IMG/M
3300017924|Ga0187820_1139754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae722Open in IMG/M
3300017926|Ga0187807_1078205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1033Open in IMG/M
3300017928|Ga0187806_1381503Not Available507Open in IMG/M
3300017937|Ga0187809_10390035Not Available529Open in IMG/M
3300017959|Ga0187779_10061302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2208Open in IMG/M
3300017972|Ga0187781_11454556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300017973|Ga0187780_10667088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium749Open in IMG/M
3300017973|Ga0187780_10739453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300017973|Ga0187780_11076797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura alba587Open in IMG/M
3300017974|Ga0187777_10243184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1220Open in IMG/M
3300017974|Ga0187777_10925769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300017975|Ga0187782_10083579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2339Open in IMG/M
3300017975|Ga0187782_10124865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1904Open in IMG/M
3300018043|Ga0187887_10589388Not Available656Open in IMG/M
3300018047|Ga0187859_10594471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia623Open in IMG/M
3300018058|Ga0187766_11274241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae535Open in IMG/M
3300018085|Ga0187772_11082851Not Available587Open in IMG/M
3300018090|Ga0187770_11699453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. H16431516Open in IMG/M
3300018433|Ga0066667_11277865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300018482|Ga0066669_10620419All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300020021|Ga0193726_1064469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora1715Open in IMG/M
3300020081|Ga0206354_10112786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1443Open in IMG/M
3300020579|Ga0210407_10395028Not Available1082Open in IMG/M
3300020580|Ga0210403_10599473Not Available890Open in IMG/M
3300020581|Ga0210399_10438343All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300020581|Ga0210399_10588409All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300020581|Ga0210399_10879579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae728Open in IMG/M
3300021088|Ga0210404_10698267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300021171|Ga0210405_10443267Not Available1021Open in IMG/M
3300021374|Ga0213881_10016491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3035Open in IMG/M
3300021374|Ga0213881_10416691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300021388|Ga0213875_10561674Not Available550Open in IMG/M
3300021401|Ga0210393_11545829Not Available527Open in IMG/M
3300021406|Ga0210386_11108950Not Available672Open in IMG/M
3300021432|Ga0210384_10199993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1796Open in IMG/M
3300021475|Ga0210392_10865969All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300021479|Ga0210410_11077361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae693Open in IMG/M
3300021559|Ga0210409_10140189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2218Open in IMG/M
3300021559|Ga0210409_10809609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia809Open in IMG/M
3300021560|Ga0126371_13695351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinocrispum → Actinocrispum wychmicini516Open in IMG/M
3300022718|Ga0242675_1117487Not Available529Open in IMG/M
3300023101|Ga0224557_1000385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia49524Open in IMG/M
3300024181|Ga0247693_1056341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300024271|Ga0224564_1080183Not Available655Open in IMG/M
3300024283|Ga0247670_1037389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300024288|Ga0179589_10113920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300024331|Ga0247668_1056676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia794Open in IMG/M
3300025634|Ga0208589_1071057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales847Open in IMG/M
3300025898|Ga0207692_10006577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus4722Open in IMG/M
3300025903|Ga0207680_11117102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300025910|Ga0207684_10903320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia742Open in IMG/M
3300025915|Ga0207693_11482633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300025916|Ga0207663_11297713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300025922|Ga0207646_10149904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2103Open in IMG/M
3300025928|Ga0207700_10400280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1203Open in IMG/M
3300025929|Ga0207664_10365867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300025929|Ga0207664_10382678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1249Open in IMG/M
3300025929|Ga0207664_10981557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300026217|Ga0209871_1016240All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300026356|Ga0257150_1064399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae551Open in IMG/M
3300026508|Ga0257161_1091306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter632Open in IMG/M
3300027297|Ga0208241_1070144Not Available561Open in IMG/M
3300027619|Ga0209330_1054080Not Available916Open in IMG/M
3300027662|Ga0208565_1168364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300027725|Ga0209178_1165435All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300027725|Ga0209178_1299589Not Available591Open in IMG/M
3300027867|Ga0209167_10686508Not Available560Open in IMG/M
3300027894|Ga0209068_10449697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300027905|Ga0209415_10321907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Haloglycomyces → Haloglycomyces albus1313Open in IMG/M
3300028380|Ga0268265_10253267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1561Open in IMG/M
3300028787|Ga0307323_10062070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1324Open in IMG/M
3300029944|Ga0311352_10448258Not Available1050Open in IMG/M
3300029999|Ga0311339_10307577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1701Open in IMG/M
3300030494|Ga0310037_10419453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300030503|Ga0311370_12012404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. DvalAA-14576Open in IMG/M
3300030618|Ga0311354_10586840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300030707|Ga0310038_10468521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300031027|Ga0302308_10466526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia goodfellowii747Open in IMG/M
3300031234|Ga0302325_10303023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2591Open in IMG/M
3300031544|Ga0318534_10182778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia crassostreae1211Open in IMG/M
3300031544|Ga0318534_10729678Not Available559Open in IMG/M
3300031680|Ga0318574_10830919Not Available541Open in IMG/M
3300031708|Ga0310686_115632355Not Available622Open in IMG/M
3300031713|Ga0318496_10185304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1142Open in IMG/M
3300031713|Ga0318496_10228490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1025Open in IMG/M
3300031713|Ga0318496_10276848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales926Open in IMG/M
3300031719|Ga0306917_10441076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1019Open in IMG/M
3300031719|Ga0306917_11365939Not Available547Open in IMG/M
3300031724|Ga0318500_10019402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae2574Open in IMG/M
3300031744|Ga0306918_10464929All Organisms → cellular organisms → Bacteria → Terrabacteria group989Open in IMG/M
3300031744|Ga0306918_10688860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia800Open in IMG/M
3300031747|Ga0318502_10500970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MnatMP-M17728Open in IMG/M
3300031747|Ga0318502_10677809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300031754|Ga0307475_10951459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300031765|Ga0318554_10252188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1005Open in IMG/M
3300031765|Ga0318554_10352926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia836Open in IMG/M
3300031770|Ga0318521_10657828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300031770|Ga0318521_10661042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300031771|Ga0318546_11022923Not Available581Open in IMG/M
3300031781|Ga0318547_10969775Not Available531Open in IMG/M
3300031781|Ga0318547_11003658Not Available522Open in IMG/M
3300031795|Ga0318557_10383707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia646Open in IMG/M
3300031795|Ga0318557_10438727Not Available600Open in IMG/M
3300031805|Ga0318497_10471643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL F-525703Open in IMG/M
3300031821|Ga0318567_10020933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3161Open in IMG/M
3300031845|Ga0318511_10174468Not Available948Open in IMG/M
3300031845|Ga0318511_10211449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia864Open in IMG/M
3300031860|Ga0318495_10258275All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031879|Ga0306919_10470761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia968Open in IMG/M
3300031879|Ga0306919_10768703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300031890|Ga0306925_11743709Not Available599Open in IMG/M
3300031896|Ga0318551_10712181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300031910|Ga0306923_10063654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4101Open in IMG/M
3300031910|Ga0306923_11145401All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300031912|Ga0306921_10497972All Organisms → cellular organisms → Bacteria → Terrabacteria group1417Open in IMG/M
3300031912|Ga0306921_11965687All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300031912|Ga0306921_12367230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300031938|Ga0308175_102203279All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031942|Ga0310916_10281199Not Available1407Open in IMG/M
3300031942|Ga0310916_10923019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300031981|Ga0318531_10133854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1105Open in IMG/M
3300032008|Ga0318562_10822776Not Available531Open in IMG/M
3300032009|Ga0318563_10172680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora1163Open in IMG/M
3300032009|Ga0318563_10436879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300032041|Ga0318549_10518989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300032043|Ga0318556_10359521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces761Open in IMG/M
3300032044|Ga0318558_10489664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300032055|Ga0318575_10445780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinocrispum → Actinocrispum wychmicini657Open in IMG/M
3300032059|Ga0318533_11259816Not Available541Open in IMG/M
3300032067|Ga0318524_10236661Not Available938Open in IMG/M
3300032076|Ga0306924_10012872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8650Open in IMG/M
3300032076|Ga0306924_12043846Not Available589Open in IMG/M
3300032089|Ga0318525_10382059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300032090|Ga0318518_10266064All Organisms → cellular organisms → Bacteria → Terrabacteria group880Open in IMG/M
3300032160|Ga0311301_10112130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5219Open in IMG/M
3300032160|Ga0311301_11010110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1098Open in IMG/M
3300032261|Ga0306920_100429654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1963Open in IMG/M
3300032261|Ga0306920_101105835All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300032770|Ga0335085_11131088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia837Open in IMG/M
3300032805|Ga0335078_11274969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae841Open in IMG/M
3300032892|Ga0335081_12317270Not Available561Open in IMG/M
3300032893|Ga0335069_10170736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2677Open in IMG/M
3300032898|Ga0335072_10664021Not Available1030Open in IMG/M
3300032954|Ga0335083_10783423Not Available766Open in IMG/M
3300033158|Ga0335077_11125045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300033818|Ga0334804_000345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia27738Open in IMG/M
3300033822|Ga0334828_076039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300034817|Ga0373948_0006110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1979Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.20%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.07%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.07%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.07%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.24%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.24%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.24%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.83%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.41%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.41%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.41%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.41%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.41%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.41%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.41%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.41%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.41%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012181Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaGHost-AssociatedOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1001658743300001356Peatlands SoilVALLGTVFFGYLNGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEETLTES*
Ga0062386_10065083213300004152Bog Forest SoilVALLGTVFFGYLNGHSSEAAIVHTAPYAMGAFALCAVLAMLLPRTAVSEEALTES*
Ga0066676_1066153013300005186SoilGVALIGTVFFGYLDGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES*
Ga0066388_10461845313300005332Tropical Forest SoilSFQASLMHTAPYAIGAFAVCALLSLLLPRTAVSEEALTQS*
Ga0008090_1502651923300005363Tropical Rainforest SoilGHSFQAALIRTAPYAMGAFALCACLSMLLPRTAVSEEALLES*
Ga0070709_1036631013300005434Corn, Switchgrass And Miscanthus RhizosphereFFGYLDGHSYEAALIRTVPYAMGAFAVCAVLSLLLPRTAVPEEALVEALAE*
Ga0070709_1040658713300005434Corn, Switchgrass And Miscanthus RhizosphereLLGSVFFGYLNGHSFEAALVHTAPYAMGAFALCAVLALLLPRTAVSEEALTES*
Ga0070714_10015452513300005435Agricultural SoilLDGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVAEDELTDS*
Ga0070714_10233892813300005435Agricultural SoilALGVALLGTVFFGYLGGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE*
Ga0070713_10026821813300005436Corn, Switchgrass And Miscanthus RhizosphereFFGYLGGGHSFGAALVHAAPYAIGAFALCAVLSMLLPRTAVAEETLTAS*
Ga0070713_10079677813300005436Corn, Switchgrass And Miscanthus RhizosphereYLNGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES*
Ga0070713_10181805023300005436Corn, Switchgrass And Miscanthus RhizosphereFFGYLNGHSFQAALVHAAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0070705_10077748313300005440Corn, Switchgrass And Miscanthus RhizosphereLGSVFFGYLGGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0070707_10017794843300005468Corn, Switchgrass And Miscanthus RhizosphereVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0070734_1090494223300005533Surface SoilHSFEAALVHTTPYAMGAFALCGLLAVLLPRTAVGEDVASEI*
Ga0066695_1029313933300005553SoilLLGTVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEDALTDS*
Ga0066695_1037137313300005553SoilNGHSFEAALVHTAPYAMGAFALCGVLALLLPRNAVSEEALTES*
Ga0070761_1047232723300005591SoilLLGTVFFGYLNGHSFEAAIVHTSPYAIGAFALCAVLSLLLPRTAVSEQALTES*
Ga0070762_1131638213300005602SoilGVAVFGTVFFGYLNGHSFEAAIVHTTPYAIGAFALCAVLSMLLPRTAVAGEALIEP*
Ga0068856_10014711513300005614Corn RhizosphereGYLGGGHSFGAALVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTAS*
Ga0066903_10495811613300005764Tropical Forest SoilGGHSFEAALVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTGS*
Ga0068863_10084087513300005841Switchgrass RhizosphereGYLGGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0070766_1059074613300005921SoilYLNGHSFEASIVHTAPYAMGAFALCAVLSLLLPRTAVSEEAHL*
Ga0070717_1032939633300006028Corn, Switchgrass And Miscanthus RhizosphereVFFGYLGGHSFQASLMHTAPYAVGAFAVCGVLSLLLPRTAVSEEALTQA*
Ga0070717_1170284613300006028Corn, Switchgrass And Miscanthus RhizosphereGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEDALTDS*
Ga0070712_10143997313300006175Corn, Switchgrass And Miscanthus RhizosphereGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVAEDELTDS*
Ga0070765_10212253513300006176SoilALGVALLGTVFFGYLDGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES*
Ga0079220_1011121513300006806Agricultural SoilHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTDS*
Ga0075425_10055319933300006854Populus RhizosphereGTVFFGYLGGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE*
Ga0075424_10256239423300006904Populus RhizosphereMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE*
Ga0079219_1015633113300006954Agricultural SoilSVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTALSEEALAES*
Ga0079219_1202026923300006954Agricultural SoilDGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE*
Ga0075435_10032375033300007076Populus RhizosphereHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVAEDELTDS*
Ga0114129_1149721433300009147Populus RhizosphereVALLGTVFFGYLGDGRSFEAALVHAAPYAIGAFALCAVLSMLLPRTAMAEEALTGS*
Ga0105243_1069972433300009148Miscanthus RhizosphereALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0116214_106511023300009520Peatlands SoilVGVALLGTVFFGYLNGHSFEAAIVRTAPYAIGAFALCAILSMLLPRTAVSEEALTES*
Ga0116214_139952423300009520Peatlands SoilTICQRHKISAGYTFQAALVHTAPYAMGAFALCAVLSLLLPRTAASEQTLTES*
Ga0116218_110111113300009522Peatlands SoilTVFFGYLSGHTFQAALVHTAPYAMGAFALCAVLSLLLPHTATSEQTLTES*
Ga0116215_139249323300009672Peatlands SoilSMVHTAPYAMGAFALCAALSMLLPRTAVSEEALTES*
Ga0116216_1007333123300009698Peatlands SoilLVHTAPYAIGAFALCAVLSLLLPRTAVSEQALTEP*
Ga0116216_1015005423300009698Peatlands SoilFGYLSGHTFQAALVHTAPYAMGAFALCAVLSLLLPHTAVSEQTLTES*
Ga0116216_1032398723300009698Peatlands SoilVGVALLGTVFFGYLNGHTFEAAIVHTAPYAMGAFALCAVLSMLLPRTAASEEALTEF*
Ga0116217_1094680913300009700Peatlands SoilTVFFGYLNGHSFEAALVHTGPYAMGAFALCGVLSLLLPRTAVSEEVLTAS*
Ga0126384_1029734413300010046Tropical Forest SoilHSFEAALVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTAS*
Ga0126373_1150903513300010048Tropical Forest SoilHSFQAALIHTAPYAVGAFALCGIASMLLPRTAVSEEALTES*
Ga0126373_1314327013300010048Tropical Forest SoilVLGTVFFGYASGHSFQAAIVHTAPYAMGAFALCAILSMLLPRTAVSEEALTGS*
Ga0127503_1102846623300010154SoilSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES*
Ga0099796_1019268423300010159Vadose Zone SoilVALLGSIFFGYLNGHSFEAALVHTAPYAMGAFALCGILSLLLPRTAVSEEALTES*
Ga0134109_1043397413300010320Grasslands SoilLLGTVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVAEDELTDS*
Ga0126376_1287135923300010359Tropical Forest SoilGTVFFGYLGGGHSFEAALVHAAPYAIGAFALCCVLSMLLPRTAVAEEALTGS*
Ga0126378_1119594723300010361Tropical Forest SoilLLGTVFFGYLDGHSFQAALIHTAPYAVGAFALCGIASMLLPRTAVSEEALTES*
Ga0126378_1138584013300010361Tropical Forest SoilVALLGTVFFGYVSGHSFQAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTGS*
Ga0126379_1080202423300010366Tropical Forest SoilVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTGS*
Ga0134128_1194070823300010373Terrestrial SoilALLGSVFFGYLGGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0134128_1276950923300010373Terrestrial SoilALLGSVFFGYLGGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSE*
Ga0126381_10061276313300010376Tropical Forest SoilVFFGYLNAHSFRGALVHTAPYAMSAFALCAILSMLLPRTAVSEEAMLQS*
Ga0126381_10429389413300010376Tropical Forest SoilFFGYLDGHSFQAALIHTAPYAVGAFALCGIASMLLPRTAVSEEALTES*
Ga0136449_10333692713300010379Peatlands SoilGHSFQAALIHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES*
Ga0134126_1194594623300010396Terrestrial SoilHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0134126_1224386523300010396Terrestrial SoilGYLNGHSFEAAMVHTAPYAMGAFALCGILSLLLPRTAVSEEALTE*
Ga0126383_1173367123300010398Tropical Forest SoilHSFQAALVHTAPYAMGAFALCGVLSMLLPRTAVSEEAVTES*
Ga0126383_1220156123300010398Tropical Forest SoilGGHSFGAALVHAAPFAIGAFALCAVLSMLLPRTAVAEEALTGS*
Ga0126383_1246031113300010398Tropical Forest SoilTVFFGYLNGHSFEAAMVHTAPYAMGAFALCGVLSMLLPRTAVSEEALTE*
Ga0126383_1280430223300010398Tropical Forest SoilLVHAAPYAIGAFAVCAVLSMLLPRTAVAEEALTAS*
Ga0134127_1366069623300010399Terrestrial SoilTVFFGYLGGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE*
Ga0134121_1292207413300010401Terrestrial SoilLGGHSFQASLMHTAPYAVGAFAVCGLLSLLLPRTAVSEEALTQA*
Ga0126345_102854433300010858Boreal Forest SoilAVIGTVFFGYLNGHSFGASMVHAAPYAIGAFALCAVLSMLLPRTALAEEALIES*
Ga0126347_125002133300010867Boreal Forest SoilAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE*
Ga0126350_1069115623300010880Boreal Forest SoilVALIGTVFFGYLNGHSFEAAMVHTAPYAMGAFALCGALSLLLPRTAVSEEALTE*
Ga0153922_117303313300012181Attine Ant Fungus GardensSLEAAVVHAAPYAMGAFALCGVLSLLLPRTAVSEQALTGS*
Ga0137379_1002631023300012209Vadose Zone SoilVALLGTVFFGYLNGHSCEAAIVHTAPYAMGAFALCAILSMLLPRTAVSEEALTES*
Ga0137378_1079208413300012210Vadose Zone SoilHSFEAALVHTAPYAMGAFALCAILSLLLPRTAVSEDALTDS*
Ga0137378_1079776323300012210Vadose Zone SoilFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0137371_1005391913300012356Vadose Zone SoilGYLGGGHSFEAALVHAAPYAIGAFALCCILSMLLPRTAVAEEALTGS*
Ga0137371_1021396513300012356Vadose Zone SoilGYLGGGHSFEAALVHAAPYAIGAFALCCILSMLLPRTAVADEALTGS*
Ga0137384_1064023923300012357Vadose Zone SoilVALLGSVFFGYLGGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0137397_1102511723300012685Vadose Zone SoilGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVTEEALTDS*
Ga0137395_1130059813300012917Vadose Zone SoilVALLGTVFFGYLNGHSCETAIVHTAPYAMGAFALCGVLSLLLPRTAVAEDALTDS*
Ga0137404_1062916743300012929Vadose Zone SoilGELNGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE*
Ga0164303_1024245533300012957SoilGVALLGSVFFGYLNGHSFEAALVHTAPYAMGALALCGVLALLLPRTAVSEEALTES*
Ga0126369_1178955023300012971Tropical Forest SoilEAALVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTGP*
Ga0157378_1132917533300013297Miscanthus RhizosphereLVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0134073_1011779613300015356Grasslands SoilYLNGHSFEAALVHTAPYAMGAFALCGILSLLLPRTAVSEEALTES*
Ga0132256_10225155513300015372Arabidopsis RhizosphereGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES*
Ga0182035_1004853943300016341SoilSSQAALIHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0182035_1048562223300016341SoilEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0182032_1133798523300016357SoilFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0182034_1035461423300016371SoilLGVALLGTVFFGYLNGHSFQAALVHTAPYAMGAFAICAVLSMLLPRTAVSEQALTES
Ga0182034_1076360913300016371SoilSGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0182037_1202407113300016404SoilNGHSFQAALVHTAPYAMGAFAICAVLSMLLPRTAVSEQALTES
Ga0182039_1052897713300016422SoilVFFGYLGGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0182038_1049683723300016445SoilSLQAALVHTAPYAMGAFALCGILSMLLPRTAVSEEAVTES
Ga0182038_1191426723300016445SoilSFEAALVRTAPYAMGAFALCGVLSLLLPRTAVSEEALTGS
Ga0187812_130293023300017821Freshwater SedimentHSFEAAIVHTASYAMGAFGLCAVLCLLLPRTAVSEEAVLES
Ga0187820_113975413300017924Freshwater SedimentGTVFFGYLSGHSFGASIVHTAPYAMGAFALCAVLALLLPRTAVAGEALIES
Ga0187807_107820513300017926Freshwater SedimentLGGAAGQAVDEDVALLGTVFFGYLNGHSFEAAMVHTAPYAIGAFALCAILSMLLPRTAVSEEALTQS
Ga0187806_138150323300017928Freshwater SedimentQAAIVHTAPYAMGAFALCAILSMLLPRTAVSEEALTES
Ga0187809_1039003523300017937Freshwater SedimentFQAAIVHTAPYAMGAFALCALLSMLLPRTAVSEEALTES
Ga0187779_1006130243300017959Tropical PeatlandGVALLGTVFCGYLNGHSFEAAIVHTAPYAIGAFALCAVLSMLLPRTAVSEEALTEA
Ga0187781_1145455623300017972Tropical PeatlandGHSFEAAIVHTAPYAMGAFALCAVLPLLLPRTAVSEDALTES
Ga0187780_1066708813300017973Tropical PeatlandVALLGTVFFGYAAGHSLQATLIHTAPYAMGAFALCGVLSMLLPRTAVAEETLTGS
Ga0187780_1073945323300017973Tropical PeatlandGVALLGTVFFGYLDGHSFQAALIHTAPYAVGAFALCGILSLLLPRTAVSEGALTEA
Ga0187780_1107679713300017973Tropical PeatlandLDDHSFEAALVRTAPYAMGAFALCAALSMLLPRTAVSEEALTEA
Ga0187777_1024318413300017974Tropical PeatlandHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTEA
Ga0187777_1092576923300017974Tropical PeatlandFFGYLDGHSFQAALVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0187782_1008357943300017975Tropical PeatlandMFFGYLNGHSFEAAIVHTAPYAMGAFALCAALSMLLTRTAVSEEALTES
Ga0187782_1012486533300017975Tropical PeatlandVAGRAGVFFGYLNGPFQAAIIHTAPYAVGAFAPCAILSMLLPRTTVSEEALTQS
Ga0187887_1058938813300018043PeatlandNGHSFQAALVRTVPYAMGAFALCAALSMLLPRTAVSQE
Ga0187859_1059447133300018047PeatlandRAALVHTTPYSMGAFALCAILSMLLPRTAVSEESLTGRGDAAH
Ga0187766_1127424113300018058Tropical PeatlandALVHTAPYAMSAFALCGILSMLLPRTAVSEEAVTES
Ga0187772_1108285123300018085Tropical PeatlandVALLGTVFFGYLNGHSFEAAIVHTAPYAVGAFALCAILSLLLPRTAVSEAVLTES
Ga0187770_1169945313300018090Tropical PeatlandAVGVALLGTVFFGYLNGHSFEAAVVHTAPYAVGAFALCAILSLLLPRTAVSEAVLTES
Ga0066667_1127786523300018433Grasslands SoilLGTVFFGYLNGHSFEAALVHTALYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0066669_1062041923300018482Grasslands SoilVFFGYLNGHSFEAALVHTAPYAMGAFALCGLLALLLPRTAVSEEALTES
Ga0193726_106446933300020021SoilDAFSHAAPYAMGAFALCGIAALLLPRTAVSDEVLAAD
Ga0206354_1011278633300020081Corn, Switchgrass And Miscanthus RhizosphereTVFFGYLDGHSFADAFVRTAPYSMAAFALCAVAALLLPKTAVADEVLAGD
Ga0210407_1039502813300020579SoilMVHTAPYAMGAFALCAVLALLLPRTAVSEEALTES
Ga0210403_1059947323300020580SoilIVHTAPYVIGAFALCAVLSMLLPRTAVSEEALTES
Ga0210399_1043834343300020581SoilFEAALVHTAPYAMGAFALCGVLSLLLPRTAVAEDELTDS
Ga0210399_1058840923300020581SoilVALLGTIFFGYLGGHSFEAALVHTAPWAMGAFALCGVLSLLLPRTAVSGEALTES
Ga0210399_1087957933300020581SoilALLGTVFFGYLNGHSFEASMVHTAPYAIGAFALCAVLALLLPRTAVSEDALSGQDELRTARTSR
Ga0210404_1069826723300021088SoilDGHSFEAALVHTAPYAMGAFALCAVLSLLLPRTAVSEEALAES
Ga0210405_1044326723300021171SoilSFQAALIHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0213881_1001649133300021374Exposed RockSFEAALVHTAPYAMGAFALCALLSMLLPRTAVSEEALTES
Ga0213881_1041669123300021374Exposed RockFQAALTHTAPYAIGAFALCGILSLLLPRTAVTEDVLTEP
Ga0213875_1056167413300021388Plant RootsGTVFFGYLGGGHSFQAAIVHTAPYAMGAFAPCAVLSLLLPRTAVPE
Ga0210393_1154582913300021401SoilVFGTVFFGYLSGHSFAASMVHTAPYAIGAFALCAVLALLLPRTAVSEEALTES
Ga0210386_1110895013300021406SoilYASSHSFEASIVHTAPYAMGAFALCAVLSLLLPRTAVSEEAHL
Ga0210384_1019999313300021432SoilFEAALVHTAPYAMGAFALCAVLSLLLPRTAVSEEALAES
Ga0210392_1086596923300021475SoilGTVFFGYLNGHSFEAALVHTAPYAMGAFALCAVLSLLLPRTAVSEEEALTES
Ga0210410_1107736113300021479SoilSMVHTAPYAMGAFVLCAVLSMLLPRTAVAEEALIES
Ga0210409_1014018953300021559SoilLGTVFFGYLDGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVAEDELTDS
Ga0210409_1080960913300021559SoilTVFFGYLDGHSFEAALVHTAPYAMGAFALCAVLSLLLPRTAVSEEALAES
Ga0126371_1369535113300021560Tropical Forest SoilALLGTVFFGYLNGHSFQAAMVHTAPYAMGAFALCGILSLLLPRTAVSEEALTES
Ga0242675_111748723300022718SoilFGTVFFGYLSGHSFEASMVHTAPYAIGAFALCAVLALLLPRTAVSEDALIES
Ga0224557_1000385293300023101SoilVALGGTVFFGYLNGHSFQAALVHTVPYAMGAFVLCAVLSMLLPRTAVPEESLPNPPAR
Ga0247693_105634123300024181SoilYLGRHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0224564_108018323300024271SoilVGVALLGTVFFGYLNGHSFQAAIVHTAPYAMGAFALCAILAMLLPRTAVPEEALTES
Ga0247670_103738913300024283SoilGVALLGSVFFGYLGGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0179589_1011392013300024288Vadose Zone SoilVALLGSVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0247668_105667633300024331SoilYLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0208589_107105713300025634Arctic Peat SoilGTVFFDYLGAHSFEASLVHTAPYAIGAFALCAVLSMLLPRTAASREALTEP
Ga0207692_1000657713300025898Corn, Switchgrass And Miscanthus RhizosphereHSFEAALVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTGS
Ga0207680_1111710213300025903Switchgrass RhizosphereVFFGYLGRHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0207684_1090332033300025910Corn, Switchgrass And Miscanthus RhizosphereVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVTEEALTES
Ga0207693_1148263313300025915Corn, Switchgrass And Miscanthus RhizosphereLGGGHSFGAALVHAAPYAIGAFALCAVLSMLLPRTAVAEETLTAS
Ga0207663_1129771323300025916Corn, Switchgrass And Miscanthus RhizosphereGTVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE
Ga0207646_1014990443300025922Corn, Switchgrass And Miscanthus RhizosphereLGSVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0207700_1040028013300025928Corn, Switchgrass And Miscanthus RhizosphereEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0207664_1036586713300025929Agricultural SoilAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE
Ga0207664_1038267833300025929Agricultural SoilLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0207664_1098155713300025929Agricultural SoilLLGSVFFGYLNGHSFEAALVHTAPYAMGAFALCAVLALLLPRTAVSEEALTES
Ga0209871_101624033300026217Permafrost SoilVALGGTVFFGDLDGHSFRAALVHTAPYSMGAFALCAVLSMLLPRVRPQPVAGAAH
Ga0257150_106439913300026356SoilSFEASMVHTAPYAIGAFALCAVLSMLLPRTAVSEEALTES
Ga0257161_109130613300026508SoilVALLGTVFFGYLGIHSFEAALVHTAPYAMGAFALCAVLSMLLPRTAVSEEVLTES
Ga0208241_107014413300027297Forest SoilSFAASMVHTAPYAMGAFALCAVLSMLLPRTAVAEEALIES
Ga0209330_105408013300027619Forest SoilGRHSFAAAFTHTAPYAIGAFALCALLSLLLPGTARTDEELTAD
Ga0208565_116836423300027662Peatlands SoilSMVHTAPYAMGAFALCAALSMLLPRTAVSEEALTES
Ga0209178_116543513300027725Agricultural SoilLGVALLGTVFFGYLGGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE
Ga0209178_129958913300027725Agricultural SoilFGYLGGGHSFGAALVHAAPYAIGAFALCCILSMLLPRTAVTEEALTTS
Ga0209167_1068650823300027867Surface SoilVALLGTVFFGYAGSHSFEASIVHTAPYAMGAFALCAVLSLLLPRTALSKEALLEA
Ga0209068_1044969723300027894WatershedsALVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTAS
Ga0209415_1032190743300027905Peatlands SoilSFEAALVHTGPYAMGAFALCGVLSLLLPRTAVSEEVLTAS
Ga0268265_1025326713300028380Switchgrass RhizosphereGRHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0307323_1006207033300028787SoilALLGSVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0311352_1044825813300029944PalsaSIVHTAPYAMGAFALCAVLALLLPRTAVSEQALTES
Ga0311339_1030757733300029999PalsaVGVAVFGTVFFGYLTGHSFEASIVHTAPYAMGAFALCAVLALLLPRTAVSEQALTES
Ga0310037_1041945313300030494Peatlands SoilVGVALLGTVFFGYLNGHTFEAAIVHTAPYAMGAFALCAVLSMLLPRTAASEEALTEF
Ga0311370_1201240423300030503PalsaLGTVFFGYLSGHPFQAALVHVAPYAMGAFALCAVLSMLLPRTAVSEESLTGS
Ga0311354_1058684013300030618PalsaGTVFFGYLTGHSFEASIVHTAPYAMGAFALCAGLALLLPRTAVSEQALTES
Ga0310038_1046852113300030707Peatlands SoilGTVFFGYLSGHTFQAALIHTAPYAIGAFALCAVLSLLLPRTAVSEQALPES
Ga0302308_1046652623300031027PalsaLDGHSFQAALVHVAPYAMGAFALCAVLSMLLPRTAVSEESLTES
Ga0302325_1030302353300031234PalsaIVHTAPYAMGAFALCAVLALLLPRTAVSEQALTES
Ga0318534_1018277823300031544SoilHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0318534_1072967823300031544SoilDGHSLQAALIHTAPYAMGAFALCGVLSMLLPRTAVSEEAVTES
Ga0318574_1083091913300031680SoilATPTAPYAMGAFALCAVLSMLLPRTAVSEEALTGS
Ga0310686_11563235513300031708SoilYLSSHTFEAALVHTAPYVMGAFALCAVLSLLLPRTAVSEQTLTES
Ga0318496_1018530433300031713SoilPKNTVPYAMGAFALCAVLSMLLPRTAVSEEALTGS
Ga0318496_1022849023300031713SoilAVGAALLGTVFFGFLNGHSFQAAMVHTAPYAMGAFALCAVLAMLLPRTAVADEALTES
Ga0318496_1027684823300031713SoilFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEAITES
Ga0306917_1044107623300031719SoilTGHSFEAAIVHTAPYAMVAFALCAVLSMLLPRTAVSEEALTES
Ga0306917_1136593923300031719SoilALIGTVFFGYLSGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318500_1001940213300031724SoilTVFFGYLGGGHSFQAALVHAAPYAIGAFALCCVLSMLLPRTAVAEETLTGS
Ga0306918_1046492923300031744SoilLGTAFFGYLNGHSFQAALVHTAPYAMGAFAICAVLSMLLPRTAVSEQALTES
Ga0306918_1068886013300031744SoilGTVFFGYLNGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318502_1050097013300031747SoilLGTVFFGYLNGHSFQAALVHTAPYAMGAFAICAVLSMLLPRTAVSEQALTES
Ga0318502_1067780923300031747SoilALLGTIFFGAVTSGHTFTAAMSHSAPYAIGAFALCAALALLLPRTAVSEEAMISADG
Ga0307475_1095145923300031754Hardwood Forest SoilLNDHSFEAAIVHVAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318554_1025218813300031765SoilALLGTVFFGYASGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTGS
Ga0318554_1035292623300031765SoilFEAALVHAAPYAIGAFALCCVLSMLLPRTAVAEEAVTGS
Ga0318521_1065782813300031770SoilVALLGTVFFGYLSGHSFEAAIVHTAPYAMGAFVLCAILSMLLPRTAASEKALTES
Ga0318521_1066104213300031770SoilHSANAPYAIGAFALCCVLSMLLPRTAVAEETLTGS
Ga0318546_1102292313300031771SoilALVHTAPYAMGAFALCGVLSLLLPRTAVSEEAITES
Ga0318547_1096977523300031781SoilGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTDS
Ga0318547_1100365823300031781SoilAALIHTAPYAMGAFALCGVLSMLLPRTAVSEEAVTES
Ga0318557_1038370723300031795SoilFFGYLNGHSFAAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318557_1043872713300031795SoilLTGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318497_1047164313300031805SoilGVALLGTVFFGYLDGHSFQAALVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318567_1002093313300031821SoilFFGYLGGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0318511_1017446813300031845SoilLGTVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEAITES
Ga0318511_1021144923300031845SoilVFFGYLNGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318495_1025827513300031860SoilLQAALIHTAPYAMGAFALCGVLSMLLPRTAVSEEAVTES
Ga0306919_1047076123300031879SoilGGGHSFEAALVHAAPYAIGAFALCCVLSMLLPRTAVAEEAVTGS
Ga0306919_1076870323300031879SoilAVGVALLGTVFFGYASGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTGS
Ga0306925_1174370913300031890SoilEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTDS
Ga0318551_1071218113300031896SoilFGYLSGHPFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0306923_1006365453300031910SoilHSLQAALIHTAPYAMGAFALCGVLSMLLPRTAVSEEAVTES
Ga0306923_1114540123300031910SoilFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0306921_1049797223300031912SoilAIVHSAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0306921_1196568713300031912SoilGHSLQAALIHTAPYAMGAFALCGVLSMLLPRTAVSEEAVTES
Ga0306921_1236723013300031912SoilDGHSFQAALIHTAPYAIGAFALCGILSMLLPRTAVSEEALTGS
Ga0308175_10220327913300031938SoilLNGHSFEAAMVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTE
Ga0310916_1028119913300031942SoilLGTVFFGYLDDGHSFEAALVHTAPYAMGAFALCAVLSMLLPRTAVSEETLTES
Ga0310916_1092301923300031942SoilVFFGYLNGHSFQAALLHTAPYAIGAFALCAVLSMLLPRTAVAEEALTES
Ga0318531_1013385433300031981SoilAALIHTAPYAIGAFALCGILSMLLPRTAVSEEALTES
Ga0318562_1082277613300032008SoilTVFFGYLDGHSFQAALVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318563_1017268033300032009SoilLGTVFFGYLDGHSFQAALVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318563_1043687923300032009SoilFEAAIVHTAPYAMGAFVLCAILSMLLPRTAVSEEALTES
Ga0318549_1051898913300032041SoilLGTVFFGYLDGHSFQAALIHTAPYAIGAFALCGILSMLLPRTAVSEEALTGS
Ga0318556_1035952113300032043SoilVALLGTVFFGYLGGHSFEAALVHTAPYAMGAFALCAVLSLLLPRTAVSEEALTES
Ga0318558_1048966423300032044SoilAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTES
Ga0318575_1044578023300032055SoilALLGTVFFGYLGGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0318533_1125981613300032059SoilGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEEALTGS
Ga0318524_1023666113300032067SoilGGRHSLEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEAVTGS
Ga0306924_1001287213300032076SoilSFEAAIVHTAPYAMVAFALCAVLSMLLPRTAVSEEALTES
Ga0306924_1204384623300032076SoilLGTVFFGYLNGHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTDS
Ga0318525_1038205913300032089SoilLFGTVFFGYLGGGHSFQAALVHTTPYAMGAFALCGVLSMLLPRTAVSEEAVTEA
Ga0318518_1026606413300032090SoilALVHTAPYAMGAFAICAVLSMLLPRTAVSEQALTES
Ga0311301_1011213023300032160Peatlands SoilGHTFEAALVHTAPYAIGAFALCAVLSLLLPRTAVSEQALTES
Ga0311301_1101011023300032160Peatlands SoilVGVALLGTVFFGYLNGHSFEAAIVHTAPYAMGAFALCAVLSMLLPRTAVSEETLTES
Ga0306920_10042965433300032261SoilLVHTAPYAMGAFAICAVLSMLLPRTAVSEQALTES
Ga0306920_10110583523300032261SoilGVALLGTVFFGYADGHTIQAALVHTAPYAMGAFALCGILSMLLPRTAVSEEAVTES
Ga0335085_1113108813300032770SoilAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0335078_1127496923300032805SoilGYLGGGHSFEAALVHAAPYAIGAFALCCILSMLLPRTAVAEEALTAA
Ga0335081_1231727013300032892SoilFQAAIVHTAPYAMGAFALCAILSMLLPRTAVSEEALTES
Ga0335069_1017073643300032893SoilLLGTIFFGYLGAHSFEAALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0335072_1066402113300032898SoilGTVFFGYLGSHSFEASIVHVGPWAMGAFGVCAGLCLLLPRTAVAGDAMGD
Ga0335083_1078342323300032954SoilLNRHSFEGALVHTAPYAMGAFALCGVLSLLLPRTAVSEEALTES
Ga0335077_1112504513300033158SoilSFEAALVHTAPYAMGAFALCGVLALLLPRTAVSEEALTES
Ga0334804_000345_5667_58493300033818SoilVGVALGGTVFFGYLNGHSFQAALVHTVPYAMGAFVLCAVLSMLLPRTAVPEESLPNPPAR
Ga0334828_076039_689_8653300033822SoilVGVALGGTVFFGYLNGHSFQAALVHTVPYAMGAFVLCAVLSMLLPRTAVPEESLPNPPA
Ga0373948_0006110_2_1663300034817Rhizosphere SoilLLGTVFFGYLGGGHSFGAALVHAAPYAIGAFALCAVLSMLLPRTAVAEEALTAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.