Basic Information | |
---|---|
Family ID | F017112 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 242 |
Average Sequence Length | 37 residues |
Representative Sequence | MANVGDRLTVFAFAAFVLAAIVGLAFLAGYLIGRILL |
Number of Associated Samples | 158 |
Number of Associated Scaffolds | 242 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.08 % |
% of genes near scaffold ends (potentially truncated) | 12.81 % |
% of genes from short scaffolds (< 2000 bps) | 86.78 % |
Associated GOLD sequencing projects | 149 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.281 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.074 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.537 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.025 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 242 Family Scaffolds |
---|---|---|
PF12773 | DZR | 28.51 |
PF08245 | Mur_ligase_M | 10.33 |
PF00334 | NDK | 9.09 |
PF10458 | Val_tRNA-synt_C | 2.89 |
PF02545 | Maf | 2.48 |
PF08241 | Methyltransf_11 | 1.24 |
PF14264 | Glucos_trans_II | 0.83 |
PF13400 | Tad | 0.41 |
PF04846 | Herpes_pp38 | 0.41 |
PF12847 | Methyltransf_18 | 0.41 |
PF05545 | FixQ | 0.41 |
PF00296 | Bac_luciferase | 0.41 |
PF00392 | GntR | 0.41 |
PF06723 | MreB_Mbl | 0.41 |
COG ID | Name | Functional Category | % Frequency in 242 Family Scaffolds |
---|---|---|---|
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 9.09 |
COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.48 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.41 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.41 |
COG4736 | Cbb3-type cytochrome oxidase, subunit 3 | Energy production and conversion [C] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.28 % |
Unclassified | root | N/A | 3.72 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908009|FWIRA_GRAM18401CQI2T | Not Available | 532 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig815615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
2170459017|G14TP7Y02FVJDS | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 687 | Open in IMG/M |
3300000156|NODE_c0377367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
3300000878|AL9A1W_1194697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300000880|AL20A1W_1002850 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300000956|JGI10216J12902_104680311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300000956|JGI10216J12902_104823169 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300000956|JGI10216J12902_110924509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 812 | Open in IMG/M |
3300000956|JGI10216J12902_113608760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300000956|JGI10216J12902_118530916 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300001305|C688J14111_10017121 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
3300002557|JGI25381J37097_1013786 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300002916|JGI25389J43894_1045701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
3300004081|Ga0063454_100487474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
3300004479|Ga0062595_100405610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
3300005176|Ga0066679_10426311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
3300005526|Ga0073909_10018105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2254 | Open in IMG/M |
3300005526|Ga0073909_10183693 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005532|Ga0070739_10171049 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300005540|Ga0066697_10542940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 653 | Open in IMG/M |
3300005540|Ga0066697_10568747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
3300005543|Ga0070672_100197540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
3300005552|Ga0066701_10032886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2717 | Open in IMG/M |
3300005552|Ga0066701_10147784 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300005552|Ga0066701_10631056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300005552|Ga0066701_10774184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300005553|Ga0066695_10035661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2902 | Open in IMG/M |
3300005553|Ga0066695_10373670 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300005553|Ga0066695_10615389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
3300005554|Ga0066661_10610514 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005556|Ga0066707_10500187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300005556|Ga0066707_10799900 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005558|Ga0066698_10460060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
3300005559|Ga0066700_10247851 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300005559|Ga0066700_10310368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1113 | Open in IMG/M |
3300005559|Ga0066700_10903506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300005560|Ga0066670_10239517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1098 | Open in IMG/M |
3300005560|Ga0066670_10526362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
3300005561|Ga0066699_10691195 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300005568|Ga0066703_10756377 | Not Available | 557 | Open in IMG/M |
3300005568|Ga0066703_10835128 | Not Available | 526 | Open in IMG/M |
3300005575|Ga0066702_10054660 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
3300005576|Ga0066708_10409602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
3300005587|Ga0066654_10590314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
3300005598|Ga0066706_11307862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 548 | Open in IMG/M |
3300005617|Ga0068859_102842360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300005618|Ga0068864_100404275 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300005713|Ga0066905_100253526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1354 | Open in IMG/M |
3300005713|Ga0066905_100646844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
3300005764|Ga0066903_100685007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1802 | Open in IMG/M |
3300005764|Ga0066903_102742056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
3300005842|Ga0068858_100698223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
3300005937|Ga0081455_10164192 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
3300006031|Ga0066651_10014184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3303 | Open in IMG/M |
3300006031|Ga0066651_10528934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
3300006034|Ga0066656_10054349 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
3300006034|Ga0066656_10665169 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300006046|Ga0066652_100817719 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300006794|Ga0066658_10214296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300006796|Ga0066665_11015676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300006796|Ga0066665_11281233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300006797|Ga0066659_11013077 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300006800|Ga0066660_10162849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1665 | Open in IMG/M |
3300006800|Ga0066660_10193167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1546 | Open in IMG/M |
3300006804|Ga0079221_11600487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300006845|Ga0075421_101047939 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300006847|Ga0075431_101484404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 637 | Open in IMG/M |
3300006854|Ga0075425_100153280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2641 | Open in IMG/M |
3300007255|Ga0099791_10374207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300007790|Ga0105679_10041753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
3300009012|Ga0066710_100119869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3580 | Open in IMG/M |
3300009012|Ga0066710_100182174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2968 | Open in IMG/M |
3300009012|Ga0066710_100714413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
3300009012|Ga0066710_100747936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1495 | Open in IMG/M |
3300009012|Ga0066710_102194150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
3300009038|Ga0099829_10463135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
3300009089|Ga0099828_10389744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1256 | Open in IMG/M |
3300009090|Ga0099827_10001573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12000 | Open in IMG/M |
3300009090|Ga0099827_10074484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2631 | Open in IMG/M |
3300009100|Ga0075418_12902946 | Not Available | 523 | Open in IMG/M |
3300009137|Ga0066709_100367758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1982 | Open in IMG/M |
3300009137|Ga0066709_100496050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1718 | Open in IMG/M |
3300009137|Ga0066709_101257182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1088 | Open in IMG/M |
3300009137|Ga0066709_101268677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
3300009137|Ga0066709_102379421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300009146|Ga0105091_10414395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300009147|Ga0114129_10247000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2397 | Open in IMG/M |
3300009147|Ga0114129_10381914 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
3300009147|Ga0114129_12066878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
3300009176|Ga0105242_10774664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 947 | Open in IMG/M |
3300009817|Ga0105062_1123840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300009818|Ga0105072_1057929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
3300009840|Ga0126313_10287141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1284 | Open in IMG/M |
3300009840|Ga0126313_11520883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300010036|Ga0126305_10798140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300010039|Ga0126309_10577956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
3300010044|Ga0126310_10435550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
3300010166|Ga0126306_10863784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300010304|Ga0134088_10308353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
3300010325|Ga0134064_10271600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300010326|Ga0134065_10104820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 944 | Open in IMG/M |
3300010358|Ga0126370_12028600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300010373|Ga0134128_13176378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300010376|Ga0126381_105140846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300010999|Ga0138505_100045221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
3300011003|Ga0138514_100047459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
3300011003|Ga0138514_100058259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300012093|Ga0136632_10320691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
3300012198|Ga0137364_10488274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300012198|Ga0137364_10586086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
3300012198|Ga0137364_11066541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300012200|Ga0137382_10054395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2512 | Open in IMG/M |
3300012200|Ga0137382_10655682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
3300012200|Ga0137382_11012677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
3300012201|Ga0137365_10003445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12609 | Open in IMG/M |
3300012201|Ga0137365_10145812 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300012201|Ga0137365_10163520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1669 | Open in IMG/M |
3300012201|Ga0137365_11068662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300012204|Ga0137374_10022275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7151 | Open in IMG/M |
3300012204|Ga0137374_10038335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5112 | Open in IMG/M |
3300012204|Ga0137374_10106008 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
3300012204|Ga0137374_10182543 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
3300012204|Ga0137374_10243868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1511 | Open in IMG/M |
3300012204|Ga0137374_10287865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1355 | Open in IMG/M |
3300012204|Ga0137374_10311543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1286 | Open in IMG/M |
3300012204|Ga0137374_10366405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1157 | Open in IMG/M |
3300012204|Ga0137374_10858374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300012204|Ga0137374_11033530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300012206|Ga0137380_10579983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
3300012208|Ga0137376_10992721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
3300012210|Ga0137378_10979160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300012211|Ga0137377_10771166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
3300012212|Ga0150985_110699947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
3300012212|Ga0150985_114332153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300012212|Ga0150985_115745022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300012349|Ga0137387_10306401 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300012350|Ga0137372_10012712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8027 | Open in IMG/M |
3300012350|Ga0137372_10377562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
3300012350|Ga0137372_11187017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300012353|Ga0137367_10007360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8839 | Open in IMG/M |
3300012353|Ga0137367_10826426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300012356|Ga0137371_10578264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300012356|Ga0137371_10676723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
3300012357|Ga0137384_10473960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
3300012359|Ga0137385_10122488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2295 | Open in IMG/M |
3300012469|Ga0150984_119615651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300012684|Ga0136614_10229435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1392 | Open in IMG/M |
3300012912|Ga0157306_10341023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300012931|Ga0153915_11524466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
3300012955|Ga0164298_10590234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300012955|Ga0164298_10714231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
3300012957|Ga0164303_10854354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
3300012958|Ga0164299_10922300 | Not Available | 636 | Open in IMG/M |
3300012958|Ga0164299_11395609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
3300012984|Ga0164309_10215432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1331 | Open in IMG/M |
3300012985|Ga0164308_10823208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
3300012986|Ga0164304_10176644 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300012989|Ga0164305_11301502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300012989|Ga0164305_12113250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300014157|Ga0134078_10097380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
3300014157|Ga0134078_10484052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300014157|Ga0134078_10640562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300014166|Ga0134079_10109824 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300014326|Ga0157380_12996152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
3300015209|Ga0167629_1164106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300015359|Ga0134085_10224416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
3300017654|Ga0134069_1339236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300017654|Ga0134069_1391528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300017944|Ga0187786_10361512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
3300017965|Ga0190266_11057514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300017966|Ga0187776_10885551 | Not Available | 647 | Open in IMG/M |
3300017997|Ga0184610_1062660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
3300017997|Ga0184610_1124917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300017997|Ga0184610_1278475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300018027|Ga0184605_10000157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19599 | Open in IMG/M |
3300018027|Ga0184605_10003133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5682 | Open in IMG/M |
3300018027|Ga0184605_10056942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1673 | Open in IMG/M |
3300018027|Ga0184605_10219026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
3300018027|Ga0184605_10262658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
3300018028|Ga0184608_10257823 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300018051|Ga0184620_10320076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
3300018071|Ga0184618_10054827 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300018071|Ga0184618_10113839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
3300018071|Ga0184618_10181667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
3300018433|Ga0066667_10120764 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
3300018433|Ga0066667_10170763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
3300018433|Ga0066667_10668725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 869 | Open in IMG/M |
3300018433|Ga0066667_10929051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300018433|Ga0066667_11981591 | Not Available | 534 | Open in IMG/M |
3300018465|Ga0190269_12003439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300018468|Ga0066662_10504972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
3300018468|Ga0066662_10783507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
3300018468|Ga0066662_12257046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
3300018482|Ga0066669_10896246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
3300019869|Ga0193705_1076768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300019875|Ga0193701_1014333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1590 | Open in IMG/M |
3300019887|Ga0193729_1000059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 47684 | Open in IMG/M |
3300019887|Ga0193729_1246317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300021073|Ga0210378_10401073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300021080|Ga0210382_10006507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3832 | Open in IMG/M |
3300021418|Ga0193695_1002852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3103 | Open in IMG/M |
3300025905|Ga0207685_10617908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300025910|Ga0207684_10058238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3278 | Open in IMG/M |
3300025910|Ga0207684_10979937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
3300025922|Ga0207646_10475704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300025931|Ga0207644_10670423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300026295|Ga0209234_1046067 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
3300026297|Ga0209237_1220920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300026312|Ga0209153_1010426 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
3300026312|Ga0209153_1027343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1924 | Open in IMG/M |
3300026312|Ga0209153_1048529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1500 | Open in IMG/M |
3300026323|Ga0209472_1273533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300026327|Ga0209266_1192179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
3300026538|Ga0209056_10165107 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300026542|Ga0209805_1129529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
3300026552|Ga0209577_10296630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1207 | Open in IMG/M |
3300027379|Ga0209842_1077772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300027465|Ga0207626_102672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
3300027773|Ga0209810_1044265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2418 | Open in IMG/M |
3300027821|Ga0209811_10213839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300027866|Ga0209813_10425138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300027875|Ga0209283_10810193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300027882|Ga0209590_10083211 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
3300027882|Ga0209590_10140741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
3300028047|Ga0209526_10237524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
3300028721|Ga0307315_10165400 | Not Available | 676 | Open in IMG/M |
3300028799|Ga0307284_10064572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1314 | Open in IMG/M |
3300028799|Ga0307284_10209918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
3300028807|Ga0307305_10295390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
3300028828|Ga0307312_10268060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1108 | Open in IMG/M |
3300028872|Ga0307314_10038517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1164 | Open in IMG/M |
3300028878|Ga0307278_10011686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4102 | Open in IMG/M |
3300028881|Ga0307277_10481045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300028884|Ga0307308_10113248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1294 | Open in IMG/M |
3300028884|Ga0307308_10493885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300031229|Ga0299913_10183437 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
3300031421|Ga0308194_10175607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300031469|Ga0170819_13612898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300032180|Ga0307471_100829486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1092 | Open in IMG/M |
3300034377|Ga0334931_128401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.07% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.50% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.13% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.89% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.48% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.07% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.24% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.24% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.24% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.41% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.41% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.41% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.41% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.41% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.41% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.41% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.41% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.41% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.41% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.41% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.41% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027465 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRA_04764080 | 2124908009 | Soil | MANVGDRLTVFAFAVFVLAAIVGLAFLAGYVIGRILL |
KansclcFeb2_09379440 | 2124908045 | Soil | MTGAGERLTVFAFAAFVVLAIVGLAFAIGYLIGKIFL |
4ZMR_01643470 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MANVGDKVSVFAVAGFVLLVIVGGAFLAGYLIGRMIL |
NODE_03773672 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MANVGDKLTVFAFAAFVLAAIVGLGFLAGYVIGRILL* |
AL9A1W_11946971 | 3300000878 | Permafrost | MANVGDRLIVFAFAAFVLAAIVGLAFLAGYVIGRILL* |
AL20A1W_10028501 | 3300000880 | Permafrost | MANVGDRLIVLAFAAFVLAAIVGLAFLAGYVIGRILL* |
JGI10216J12902_1046803112 | 3300000956 | Soil | MAGVGERLTVFAFAACVVLAIVGLAFAVGYLIGRIFL* |
JGI10216J12902_1048231692 | 3300000956 | Soil | MARAGDRLTVFAFATFVLMAIVGIAFAAGYVIGRILL* |
JGI10216J12902_1109245092 | 3300000956 | Soil | MPNVGDRLTVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
JGI10216J12902_1136087602 | 3300000956 | Soil | MANVGDKLTVFAFAAFVLGAIVGLAFLAGYLIGRILL* |
JGI10216J12902_1185309162 | 3300000956 | Soil | MASVGERLTVFAFAGFVVLAIVGIAFAAGYLIGRIFL* |
C688J14111_100171215 | 3300001305 | Soil | MANVGDRVTVFAFAALVLAAIVGIAFLIGYVIGRILL* |
JGI25381J37097_10137864 | 3300002557 | Grasslands Soil | VAARTPTMAAAGDKVSVLVFAVLVVLAIVGFAFAAGYLIGRIFL* |
JGI25389J43894_10457012 | 3300002916 | Grasslands Soil | RTMANVGDRLTVFAFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0063454_1004874743 | 3300004081 | Soil | ERTMANVGDRLTVFAFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0062595_1004056103 | 3300004479 | Soil | PTMANVGDRLTVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0066679_104263113 | 3300005176 | Soil | TRRRMAGAGDRLTVFAFAAFVLVAIVGLAFAAGYLIGRILL* |
Ga0073909_100181051 | 3300005526 | Surface Soil | MANVGDRVTVFAFAALVLAAIVGIAFLVGYVIGRILL* |
Ga0073909_101836932 | 3300005526 | Surface Soil | MARAGDRLTVFAFATFVLMAIVGLAFAAGYFVGRILL* |
Ga0070739_101710493 | 3300005532 | Surface Soil | MANVREQVSVFAVAAFVLVIVVGGAFLAGWLIGRMIL* |
Ga0066697_105429402 | 3300005540 | Soil | MANVGDRLTVLAFAIFVLAAIVGLAFLAGYLIGRVLL* |
Ga0066697_105687472 | 3300005540 | Soil | MANVGDRLTVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0070672_1001975402 | 3300005543 | Miscanthus Rhizosphere | MANVGDRLTVFAFAAFVLAAIVGLAFLAGYVIGRMLL* |
Ga0066701_100328861 | 3300005552 | Soil | MASVGERLTVFAFAAFVVLALVGLAFAAGYLIGRILL* |
Ga0066701_101477844 | 3300005552 | Soil | RTMANVRDRLTVFLFAALVLAAIVGGAFLVGYLVGRMIL* |
Ga0066701_106310562 | 3300005552 | Soil | MANVGDRLTVFAFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0066701_107741841 | 3300005552 | Soil | MANVGDRLTVFAFAVFVLAAIVGLAFLAGYLIGRILL* |
Ga0066695_100356615 | 3300005553 | Soil | MASVGERLTVFAFAAFVVLAIVGVAFAAGYLIGRIFL* |
Ga0066695_103736701 | 3300005553 | Soil | MANVGDRLTVFAFATFVLVAIVGLAFLVGYLIGRILL* |
Ga0066695_106153892 | 3300005553 | Soil | MANVGDRLTVLAFAVFVLAAIVGLAFLAGYLIGRI |
Ga0066661_106105142 | 3300005554 | Soil | MANVGDRLTVFAFAVFVLAAIVGLAFLAGYVIGRILL* |
Ga0066707_105001872 | 3300005556 | Soil | MASVGERLTVFAFAAFVVLAIVGIAFAAGYLIGRIFL* |
Ga0066707_107999002 | 3300005556 | Soil | MANVADRLTVFAFAALVLAAIVGLAFLAGYLIGRILL* |
Ga0066698_104600602 | 3300005558 | Soil | MASAGDRLVVFAFAVFVVLAIVGFAFGAGYVIGRIFL* |
Ga0066700_102478512 | 3300005559 | Soil | MAAAGDKVSVLVFAVLVVLAIVGFAFAAGYLIGRIFL* |
Ga0066700_103103682 | 3300005559 | Soil | MASVGERLTVFAFAAFVVLAIVGLAFAAGYLIGRILL* |
Ga0066700_109035062 | 3300005559 | Soil | GRKRTMANVRDRLSVFLFAAFVLVAIVGGAFLVGYLVGRMIL* |
Ga0066670_102395172 | 3300005560 | Soil | MANVGDRLTVLAFATLVLAAIVGLAFLAGYLIGRILL* |
Ga0066670_105263622 | 3300005560 | Soil | MANVGDRLTVFAFATFVLVAIVGLAFLAGYLIGRTLL* |
Ga0066699_106911952 | 3300005561 | Soil | MGSVGERLTVFAFAAFVVLAIVGITFAAGYLIGRIFL* |
Ga0066703_107563772 | 3300005568 | Soil | MANVGDKLTVLGFAVFVLAAIVGLAFLAGYLIGRILL* |
Ga0066703_108351282 | 3300005568 | Soil | MAGVGERLTVFAFAAFVVLAIVAAAFAVGYLIGRILL* |
Ga0066702_100546602 | 3300005575 | Soil | LSMAGVGERLTVFAFAAFVVLAIVAAAFAVGYLIGRILL* |
Ga0066708_104096022 | 3300005576 | Soil | MAAAGDKVSVLVFAVLVVLAIVGVAFATGYLIGRIFL* |
Ga0066654_105903142 | 3300005587 | Soil | MARAGDRITVLAFAAFVLMAIVGIAFAAGYLIGRILL* |
Ga0066706_113078622 | 3300005598 | Soil | MAAFREKLGVFAFALFVLVAIVGGAFLAGYLIGKMLL* |
Ga0068859_1028423601 | 3300005617 | Switchgrass Rhizosphere | MANVGERLSVFAFAAFVLVAIVGLAFLAGYLIGRILL* |
Ga0068864_1004042754 | 3300005618 | Switchgrass Rhizosphere | LAMANVGDRLIVLAFAAFVLAAIVGLAFLAGYVIGRMLL* |
Ga0066905_1002535262 | 3300005713 | Tropical Forest Soil | MRKLFERLSVFAFAAFVLAAIVGLAFAAGYIVGQLLL* |
Ga0066905_1006468442 | 3300005713 | Tropical Forest Soil | MANVGDRVTVFAFATFVLVAIVGVAFLVGYLIGRILL* |
Ga0066903_1006850072 | 3300005764 | Tropical Forest Soil | MANVGERLTVFAFATFVLVAIVGLAFLAGYLIGRIIL* |
Ga0066903_1027420561 | 3300005764 | Tropical Forest Soil | MANIRDRLSVFALAAFLLIGIVGGAFLAGYLIGRMLL* |
Ga0068858_1006982232 | 3300005842 | Switchgrass Rhizosphere | MANVGDRLIVFAFAAFVLAAIVGLAFLAGYVIGRMLL* |
Ga0081455_101641923 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MANVGERLSVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0081539_101423244 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGAAGGRASVIAFAAFVVLAIVGIAFAVGYVIGRMLL* |
Ga0066651_100141844 | 3300006031 | Soil | MANVGERLTVFAFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0066651_105289342 | 3300006031 | Soil | MANVGDRLTVFAFAALVLAAIVGLAFLAGYLIGRILL* |
Ga0066656_100543492 | 3300006034 | Soil | MANLGDRLIVFAFAAFVLAAIVGLAFLAGYVIGRILL* |
Ga0066656_106651692 | 3300006034 | Soil | MANVGDRLTIFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0066652_1008177192 | 3300006046 | Soil | MARAGDRITVLAFAAFVLIAIVGIAFAAGYLIGRILL* |
Ga0066658_102142962 | 3300006794 | Soil | LSMAGVGERLTVFAFAAFVVLAIVAAAFAVGYVIGRILL* |
Ga0066665_110156762 | 3300006796 | Soil | GTRTRTMAAAGGRFSVFIFAAFVVAAIVGLAFAAGYLIGRIFL* |
Ga0066665_112812331 | 3300006796 | Soil | VGDRLTVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0066659_110130772 | 3300006797 | Soil | MANVGDRLTVFAFAVFVLAAILGLAFLAGYVIGRILL* |
Ga0066660_101628494 | 3300006800 | Soil | MASVGERFTVFAFAAFVVLAIVGIAFAAGYLIGRIFL* |
Ga0066660_101931672 | 3300006800 | Soil | MAAAGDKVSVLVFAALVVVAIVGIAFAVGYLIGRIFL* |
Ga0079221_116004871 | 3300006804 | Agricultural Soil | MANVGDRLTVFAFATFVLVAIVGVAFLVGYLIGRI |
Ga0075421_1010479393 | 3300006845 | Populus Rhizosphere | MANVGDKLTVFAFAAFVLAAIVGLGFLAGYLIGRILL* |
Ga0075431_1014844042 | 3300006847 | Populus Rhizosphere | MKQLAERLSVLALAAFVVAAVVGLAFLAGYAVGKLLL* |
Ga0075425_1001532802 | 3300006854 | Populus Rhizosphere | MASVGERLSVFAFAAFVVLAIVGIAFAAGYLIGRIFL* |
Ga0099791_103742072 | 3300007255 | Vadose Zone Soil | MANVGDRLIVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0105679_100417532 | 3300007790 | Soil | MTRLGERLTVFAFAAFVVASVVGLAFAAGYVIGKLLL* |
Ga0066710_1001198695 | 3300009012 | Grasslands Soil | MANVGDRLTVFAFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0066710_1001821745 | 3300009012 | Grasslands Soil | MAAAGGRFSVFIFAAFVVAAIVGLAFAAGYLIGRIFL |
Ga0066710_1007144132 | 3300009012 | Grasslands Soil | MANVGDRLTVFAFAVFVLAAIVGLAFLAGYLIGRILL |
Ga0066710_1007479362 | 3300009012 | Grasslands Soil | MASVGERLTVFAFAAFVVLAIVGLAFAAGYLIGRIFL |
Ga0066710_1021941502 | 3300009012 | Grasslands Soil | MASVGERLTVFAFAPFVVLAIVGVAFAAGYLIGRIFL |
Ga0099829_104631352 | 3300009038 | Vadose Zone Soil | MANVGDRLTVFAFAAFVLAAIVGLAFLAGYVIGRILL* |
Ga0099828_103897442 | 3300009089 | Vadose Zone Soil | MAAAGDRVSVLVFAAFVVLAIVGIAFAAGYLIGRIFL* |
Ga0099827_1000157312 | 3300009090 | Vadose Zone Soil | MANLGDRLTVFAFAVFVLAAIVGLGFLAGYLIGRILL* |
Ga0099827_100744843 | 3300009090 | Vadose Zone Soil | MAAAGDKVSVLVFAAFVVLAIVGIAFAAGYLIGRIFL* |
Ga0075418_129029462 | 3300009100 | Populus Rhizosphere | MANVGDKLTVFAFAAFVLAAIVGLGFLAGYVIGRMLL* |
Ga0066709_1003677583 | 3300009137 | Grasslands Soil | MANVGDRLTVFAVAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0066709_1004960504 | 3300009137 | Grasslands Soil | MAAAGGRFSVFIFAAFVVAAIVGLAFAAGYLIGRIFL* |
Ga0066709_1012571822 | 3300009137 | Grasslands Soil | MANVGERLTVFAFAAFVVLAIVGLAFAAGYLIGRIFL* |
Ga0066709_1012686773 | 3300009137 | Grasslands Soil | MANVGDRLIVFAFAAFVLAAIVGLAFLVGYLIGRILL* |
Ga0066709_1023794212 | 3300009137 | Grasslands Soil | VGERLTVFAFAAFVVLAIVGLAFAAGYLIGRIFL* |
Ga0105091_104143952 | 3300009146 | Freshwater Sediment | MGRLAERLSVFAFAAFVLAAIVGLAFAAGYIVGQLLL* |
Ga0114129_102470003 | 3300009147 | Populus Rhizosphere | MANVGDRLTVFAFATFVLAAIVGLAFLAGYLIGRILL* |
Ga0114129_103819143 | 3300009147 | Populus Rhizosphere | MANVGDRLTVFAFATLILVAIVGLAFLAGYVLGRIIL* |
Ga0114129_120668781 | 3300009147 | Populus Rhizosphere | MANVGERLTVFAVAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0105242_107746642 | 3300009176 | Miscanthus Rhizosphere | MVRAGDRLTVFAFAAFVLMAIVGLAFAAGYFVGRILL* |
Ga0105062_11238402 | 3300009817 | Groundwater Sand | MANVGDRLTVFTFAALVLAAIVGLGFLAGYLIGRILL* |
Ga0105072_10579291 | 3300009818 | Groundwater Sand | MANVGDRLTVFAFAALVLAAIVGLGFLAGYLIGRILL* |
Ga0126313_102871412 | 3300009840 | Serpentine Soil | MRKLVERLSVFAFAAFVLAAIVGLAFAAGYIVGQLLL* |
Ga0126313_115208832 | 3300009840 | Serpentine Soil | MADARDRVAVFAFAAFVLAAIVGIAFAAGYVIGRILL* |
Ga0126305_107981402 | 3300010036 | Serpentine Soil | MANVGERLTVLAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0126309_105779562 | 3300010039 | Serpentine Soil | MANVGDRLTVFAFAAFVLAAIVGLGFLAGYLIGRILL* |
Ga0126310_104355502 | 3300010044 | Serpentine Soil | MANVGEKLTVFAFATFVLAAIVGLAFLAGYLIGRILL* |
Ga0126306_108637842 | 3300010166 | Serpentine Soil | MANVGDRLTVFAFAAIVLAAIVGLAFLAGYLIGRILL* |
Ga0134088_103083532 | 3300010304 | Grasslands Soil | MANVGERLTVFAVAAFVLAAIVGLAFLAGYLMGRILL* |
Ga0134064_102716002 | 3300010325 | Grasslands Soil | MANVGERLTVFAFATFVLVAIVGLAFLVGYLIGRILL* |
Ga0134065_101048202 | 3300010326 | Grasslands Soil | MADAGERLTVFAFAAFVVLAIVGLAFAVGYLIGRIFL* |
Ga0126370_120286001 | 3300010358 | Tropical Forest Soil | MSAVGDRVSVFAFAAFVVAAIIGLAFAAGYLIGRIFL* |
Ga0134128_131763782 | 3300010373 | Terrestrial Soil | MANVGDRLTVFAFAALVLAAIVGLAFLAGYVIGRILL* |
Ga0126381_1051408462 | 3300010376 | Tropical Forest Soil | MGAVGDRASVFLFAAFIVLAIVGVAFAAGYLIGRIFL* |
Ga0138505_1000452212 | 3300010999 | Soil | MANVGDRVTVFTFAALVLAAIVGIAFLVGYVIGRILL* |
Ga0138514_1000474591 | 3300011003 | Soil | MANVGDRLIVLAFAAFVLAAIVGLAFLAGYVLGRILL* |
Ga0138514_1000582592 | 3300011003 | Soil | MAATTGVRLIVFAFAAFLVLAIVGLAFAAGYLIGRIFL* |
Ga0136632_103206912 | 3300012093 | Polar Desert Sand | MGSVGERLTVFAFAAFVLAAVVGLAFAAGYMVGKLLL* |
Ga0137364_104882742 | 3300012198 | Vadose Zone Soil | MANVGDRLTVLAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0137364_105860862 | 3300012198 | Vadose Zone Soil | MAGVGERLTVFAFAAFVVLAIVGLAFAVGYFIGKIFL* |
Ga0137364_110665412 | 3300012198 | Vadose Zone Soil | MANVADRLIVLAFAAFVLAAIVGLAFLAGYVIGRILL* |
Ga0137382_100543951 | 3300012200 | Vadose Zone Soil | MANVGDRLIVFAFAAFVLAAIVGLAFLADYVIGRILL* |
Ga0137382_106556822 | 3300012200 | Vadose Zone Soil | MANVGDRVTVFAFAALVLAAIVGIAFLAGYVIGRILL* |
Ga0137382_110126772 | 3300012200 | Vadose Zone Soil | MANVGDRLTVLAFAAFVLAAIVGLAFLAGYLVGRILL* |
Ga0137365_100034456 | 3300012201 | Vadose Zone Soil | MANVGDRLIVFAFAAFVLAAIVGVAFLVGYLIGRILL* |
Ga0137365_101458124 | 3300012201 | Vadose Zone Soil | MANVRDKLTVFAVAGFVLLAIVGGAFLAGYLIGRMLL* |
Ga0137365_101635202 | 3300012201 | Vadose Zone Soil | MAGAGDRLTVFAFAAFVLVTIVGLAFAAGYLIGRILL* |
Ga0137365_110686622 | 3300012201 | Vadose Zone Soil | MTAVGDRVSVLVFAAFVVAAIVGLAFGAGYLIGRIFL* |
Ga0137374_100222753 | 3300012204 | Vadose Zone Soil | MANVGDKLTILAFAIFVLATIVGLAFLAGYLIGRILL* |
Ga0137374_100383353 | 3300012204 | Vadose Zone Soil | MPNVGDRLIVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0137374_101060083 | 3300012204 | Vadose Zone Soil | MANVGDKLIVIAFAAFVLATIVGLAFLAGYLIGRILL* |
Ga0137374_101825433 | 3300012204 | Vadose Zone Soil | MAGAGDRLTVFAFAAFVLVAIVGLAFAAGYLIGRILL* |
Ga0137374_102438682 | 3300012204 | Vadose Zone Soil | MAGAGDRLTVFAFAAFVLMAIVGLAFAAGYLIGRILL* |
Ga0137374_102878652 | 3300012204 | Vadose Zone Soil | MANVGDRLIVFAFAAFVIVAIVGVAFLAGYLIGRILL* |
Ga0137374_103115433 | 3300012204 | Vadose Zone Soil | MANVGEKLTVFAVAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0137374_103664052 | 3300012204 | Vadose Zone Soil | MANVGDRLIVFAFAAFVLAAIVGLGFLAGYLIGRILL* |
Ga0137374_108583742 | 3300012204 | Vadose Zone Soil | MAGAGDRLTVFALSSFVLVAIAGPAFAAGYFIGRILL* |
Ga0137374_110335301 | 3300012204 | Vadose Zone Soil | MANVGDKLTVFAFATFVLAAIVGLAFLAGYLIGRILL* |
Ga0137380_105799832 | 3300012206 | Vadose Zone Soil | MASVGERLSVFSFAVFVVLAIIGLAFAAGYLIGRIFL* |
Ga0137376_109927212 | 3300012208 | Vadose Zone Soil | MANVGDRLIVFAFAAFVLAAIVGIAFLVGYLIGRILL* |
Ga0137378_109791602 | 3300012210 | Vadose Zone Soil | MAGVGERLTVFAFAAFVVLSIVALAFAAGWLIGRILL* |
Ga0137377_107711662 | 3300012211 | Vadose Zone Soil | MATVGERLSVFSFAVFVVLAIIGLAFAAGYLIGRIFL* |
Ga0150985_1106999471 | 3300012212 | Avena Fatua Rhizosphere | MANVRDRLSVFAFAAFVLLVIVGGAFLAGWLIGRMLL* |
Ga0150985_1143321532 | 3300012212 | Avena Fatua Rhizosphere | MARAGDRLTVFAFAAFVLMAIVGLAFAAGYLLGRMLL* |
Ga0150985_1157450221 | 3300012212 | Avena Fatua Rhizosphere | ANVGDRVTVFAFAALVLAAIVGIAFLIGYVIGRILL* |
Ga0137387_103064013 | 3300012349 | Vadose Zone Soil | MANVGERLTVFAFAALVLAAIVGLAFLAGYLIGRILL* |
Ga0137372_1001271212 | 3300012350 | Vadose Zone Soil | VSERISVFAMAVFVLVAIVGLAFAAGYLIGRMLL* |
Ga0137372_103775622 | 3300012350 | Vadose Zone Soil | MANVGDRLTVLAFAALVLAAIVGLGFLAGYLIGRILL* |
Ga0137372_111870172 | 3300012350 | Vadose Zone Soil | MAAVGDRVSVLAFAAFVVAAIVGIAFAAGYLIGRIFL* |
Ga0137367_100073605 | 3300012353 | Vadose Zone Soil | MANVGDRLIVFAFAAFVIVAIVGLAFLAGYLIGRILL* |
Ga0137367_108264261 | 3300012353 | Vadose Zone Soil | VGDKLTILAFAIFVLATIVGLAFLAGYLIGRILL* |
Ga0137371_105782642 | 3300012356 | Vadose Zone Soil | MTGTGERLTVFAFAAFVVLAIVGLAFAVGYFIGKIFL* |
Ga0137371_106767232 | 3300012356 | Vadose Zone Soil | MASVGERLTVFAFAAFVVVAIVGLAFAAGYLIGRIFL* |
Ga0137384_104739602 | 3300012357 | Vadose Zone Soil | MANVRDQLTVFAVAGFVLLAIVGGAFLAGYLIGRMLL* |
Ga0137385_101224884 | 3300012359 | Vadose Zone Soil | MANVGDRLIVFAFAEFVLAAIVGLAFLAGYLIGRILL* |
Ga0150984_1196156511 | 3300012469 | Avena Fatua Rhizosphere | ANVGDRLTVFAFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0136614_102294352 | 3300012684 | Polar Desert Sand | MGPVGERLTVFAFAAFVLAAVVGLAFAAGYMVGKLLL* |
Ga0157306_103410232 | 3300012912 | Soil | MANVGDRLTVFVFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0153915_115244662 | 3300012931 | Freshwater Wetlands | MANLRDKVSVFVFAAVVLAAIVGGAFLAGYLIGRMIL* |
Ga0164298_105902342 | 3300012955 | Soil | MANVGDRLSVLAFAAFVLAAIVGLAFLAGYVIGRILL* |
Ga0164298_107142311 | 3300012955 | Soil | MANVGDRVTVFAFAALVLAAIVGIAFLVGYVIGRI |
Ga0164303_108543542 | 3300012957 | Soil | MANVGERLTVFAFATFVLAAIVGLAFLAGYLIGRILL* |
Ga0164299_109223002 | 3300012958 | Soil | MANVGERLSVFAFAAFVLVAIVGLAFLAGYVIGRMLL* |
Ga0164299_113956092 | 3300012958 | Soil | MANVGDRLTVFAFVTFVLVAIVGLAFLAVYLIGRILL* |
Ga0164309_102154322 | 3300012984 | Soil | MANVGDRLTVFAFVTFVLVAIVGLAFLAGYLIGRILL* |
Ga0164308_108232083 | 3300012985 | Soil | VGDRLTVFAFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0164304_101766442 | 3300012986 | Soil | VDAGDRLIVLAFAAFVLAAIVGLAFLAGYVIGRILL* |
Ga0164305_113015021 | 3300012989 | Soil | NVGDRLTVFAFATFVLVAIVGLAFLAGYLIGRILL* |
Ga0164305_121132502 | 3300012989 | Soil | MAGVGERLTVFAFAAFVVLAIVGLAFAVGYLIGRVFL* |
Ga0134078_100973802 | 3300014157 | Grasslands Soil | MANVGDRLTVFTFAVFVLAAIVGLAFLAGYVIGRILL* |
Ga0134078_104840522 | 3300014157 | Grasslands Soil | MGKAGDRLTVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0134078_106405622 | 3300014157 | Grasslands Soil | MAGVGERLTVFAFAAFVVLAIVAAAFAVGYLTGRILL* |
Ga0134079_101098242 | 3300014166 | Grasslands Soil | MANVGDRLTVFAFATFVLVAMVGLAFLAGYLIGRILL* |
Ga0157380_129961522 | 3300014326 | Switchgrass Rhizosphere | MARAGDRLTVFAFAAFVLMAIVGLAFAAGYFVGRILL* |
Ga0167629_11641061 | 3300015209 | Glacier Forefield Soil | MANVGDRLIVFAFAAFVLAAIVGLAFLAGYVLGRILL* |
Ga0134085_102244162 | 3300015359 | Grasslands Soil | MANVGERLTVFAFAAFVLAAIVGLAFLAGYLIGRILL* |
Ga0134069_13392362 | 3300017654 | Grasslands Soil | MANVGDRLTVFAFATFVLVAIVGLAFLVGYLIGRILL |
Ga0134069_13915282 | 3300017654 | Grasslands Soil | MTGTGERLTVFAFAAFVVLAIVGLAFAVGYFIGKIFL |
Ga0187786_103615122 | 3300017944 | Tropical Peatland | MANVGDRLTVFGFATFVLVAIVGLAFLAGYLIGRILL |
Ga0190266_110575142 | 3300017965 | Soil | MANVGDRLTVLAFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0187776_108855512 | 3300017966 | Tropical Peatland | MANVGDRLTVFAFATFVLVAIVGLAFLAGYLIGRILL |
Ga0184610_10626602 | 3300017997 | Groundwater Sediment | MANVGDKLTVFAFAAFVLAAIVGLGFLAGYLIGRILL |
Ga0184610_11249172 | 3300017997 | Groundwater Sediment | MANVGDRLIVLAFAAFVLAAIVGLAFLAGYVIGRILL |
Ga0184610_12784752 | 3300017997 | Groundwater Sediment | MANVGDRLTVFAFAAIVLAAIVGLAFLAGYLIGRILL |
Ga0184605_100001573 | 3300018027 | Groundwater Sediment | MANVGDRLIVFAFAAFVLAAIVGLAFLAGYVIGRILL |
Ga0184605_100031333 | 3300018027 | Groundwater Sediment | MANVGDRVTVFTFAALVLAAIVGIAFLVGYVIGRILL |
Ga0184605_100569423 | 3300018027 | Groundwater Sediment | MASVGERLSVFAFAAFVVVAIVGLAFAAGYLIGRIFL |
Ga0184605_102190262 | 3300018027 | Groundwater Sediment | MANVGDRLTVFAFAAFILAAIVGLGFLAGYLIGRILL |
Ga0184605_102626583 | 3300018027 | Groundwater Sediment | MANVGDRLMVLAFAAFVLAAIVGLAFLAGYVIGRILL |
Ga0184608_102578232 | 3300018028 | Groundwater Sediment | MANVGERLTVLAFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0184620_103200761 | 3300018051 | Groundwater Sediment | MANVGDRLIVFAVAAFILAAIVGLAFLAGYVIGRILL |
Ga0184618_100548271 | 3300018071 | Groundwater Sediment | ANVGDRLMVFAFAAFVLAAIVGLAFLAGYVIGRILL |
Ga0184618_101138392 | 3300018071 | Groundwater Sediment | MANVGDRLIVLAFAAFVLAAIVGLAFLGGYVIGRILL |
Ga0184618_101816672 | 3300018071 | Groundwater Sediment | MANVGERLIVFAFAAFVLAAIVGLAFLVGYLIGRILL |
Ga0066667_101207643 | 3300018433 | Grasslands Soil | MAAAGDKVSVLVFAVLVVLAIVGYAFAAGYLIGRIFL |
Ga0066667_101707632 | 3300018433 | Grasslands Soil | MANVRDRLSVFLFAAFVLVAIVGGAFLVGYLVGRMIL |
Ga0066667_106687252 | 3300018433 | Grasslands Soil | MANVGDRLTVLAFATLVLAAIVGLAFLAGYLIGRILL |
Ga0066667_109290512 | 3300018433 | Grasslands Soil | MASVGERLTVFAFAAFVVLAIVGVAFAAGYLIGRIFL |
Ga0066667_119815912 | 3300018433 | Grasslands Soil | MAGVGERLTVFAFAAFVVLAIVAAAFAVGYLIGRILL |
Ga0190269_120034392 | 3300018465 | Soil | MANVGDRLTVFAFAAFVLAAIVGLGFLAGYLIGRILL |
Ga0066662_105049722 | 3300018468 | Grasslands Soil | MAAAGDKVSVLVFAALVVLAIVGIAFAAGYLIGRIFL |
Ga0066662_107835072 | 3300018468 | Grasslands Soil | MASVGERLTVFAFAAFVVLAIVGLAFAAGYLIGRILL |
Ga0066662_122570462 | 3300018468 | Grasslands Soil | MANVGDRLTVFAFAALVLAAIVGLAFLAGYLIGRILL |
Ga0066669_108962462 | 3300018482 | Grasslands Soil | MANVGDRLTVFAVAAFVLAAIVGLAFLAGYLIGRILL |
Ga0193705_10767682 | 3300019869 | Soil | MANVGDRVTVFAFAALVLAAIVGIAFLVGYVIGRILL |
Ga0193701_10143332 | 3300019875 | Soil | MANVGDRLIVLAFAAFVLAAIVGLAFLAGYVLGRILL |
Ga0193729_100005937 | 3300019887 | Soil | MANVGDRLIVFAFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0193729_12463171 | 3300019887 | Soil | MANVGDRLIVFAFAAFVLAAIVGVAFLVGYLIGRILL |
Ga0210378_104010732 | 3300021073 | Groundwater Sediment | MANVGDRLTVFTFAALVLAAIVGLGFLAGYLIGRILL |
Ga0210382_100065073 | 3300021080 | Groundwater Sediment | MANVGDRLIVFAVAAFILAAIVGLAFLAGYVLGRILL |
Ga0193695_10028522 | 3300021418 | Soil | MANVGDRLIVFAFAAFVLAAIVGLAFLVGYLIGRILL |
Ga0207685_106179082 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRSSQGCGPTMANVGDRLTVFAFATFVLAAIVGLAFLAGYLIGRILL |
Ga0207684_100582382 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVGERLTVLAFAAVVLAAIVGLCFLAGYLIGRILL |
Ga0207684_109799372 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MASAGERLTVFAFAVFVILAIIGIAFAAGYLIGRIFL |
Ga0207646_104757042 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAFREKLGVFAFALFVLVAIVGGAFLAGYLIGKMLL |
Ga0207644_106704232 | 3300025931 | Switchgrass Rhizosphere | MANVGDRLIVFAFAAFVLAAIVGLAFLAGYVIGRMLL |
Ga0209234_10460674 | 3300026295 | Grasslands Soil | PTMAAAGDKVSVLVFAVLVVLAIVGFAFAAGYLIGRIFL |
Ga0209237_12209202 | 3300026297 | Grasslands Soil | MASVGERLTVFAFAAFVVLALVGLAFAAGYLIGRILL |
Ga0209153_10104263 | 3300026312 | Soil | MAAAGDKVSVLVFAVLVVLAIVGFAFAAGYLIGRIFL |
Ga0209153_10273432 | 3300026312 | Soil | MANVGDKLTVLGFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0209153_10485292 | 3300026312 | Soil | MGSVGERLTVFAFAAFVVLAIVGITFAAGYLIGRIFL |
Ga0209472_12735332 | 3300026323 | Soil | MVNVGERLTVFAFATFVLVAIVGLAFLAGYLIGRILL |
Ga0209266_11921792 | 3300026327 | Soil | MASAGDRLVVFAFAVFVVLAIVGFAFGAGYVIGRIFL |
Ga0209056_101651072 | 3300026538 | Soil | MANVADRLTVFAFAALVLAAIVGLAFLAGYLIGRILL |
Ga0209805_11295293 | 3300026542 | Soil | MAAAGDKVSVLVFAALVVVAIVGIAFAVGYLIGRIFL |
Ga0209577_102966302 | 3300026552 | Soil | MANVGDRLTVFAFAALVLAAIVGLAFLAGYLIGRI |
Ga0209842_10777722 | 3300027379 | Groundwater Sand | MANVGDRLTVFAFAALVLAAIVGLGFLAGYLIGRILL |
Ga0207626_1026722 | 3300027465 | Soil | MANVGDRLTVLAFAVFVLAAIVGLAFLAGYLIGRILL |
Ga0209810_10442655 | 3300027773 | Surface Soil | MANVREQVSVFAVAAFVLVIVVGGAFLAGWLIGRMIL |
Ga0209811_102138392 | 3300027821 | Surface Soil | MARAGDRLTVFAFATFVLMAIVGLAFAAGYFVGRILL |
Ga0209813_104251382 | 3300027866 | Populus Endosphere | MANVGERLSVFAFAAFVLVAIVGLAFLAGYLIGRILL |
Ga0209283_108101931 | 3300027875 | Vadose Zone Soil | MANVGDRLTVFAFAAFVLAAIVGLAFLAGYVIGRILL |
Ga0209590_100832112 | 3300027882 | Vadose Zone Soil | MANLGDRLTVFAFAVFVLAAIVGLGFLAGYLIGRILL |
Ga0209590_101407414 | 3300027882 | Vadose Zone Soil | MAAAGDKVSVLVFAAFVVLAIVGIAFAAGYLIGRIFL |
Ga0209526_102375242 | 3300028047 | Forest Soil | MANVGDRLIVFAVAAFVLAAIVGLAFLAGYLIGRILL |
Ga0307315_101654001 | 3300028721 | Soil | MANVGDRLIVLAFAAFVLAAIVGLAFLAGYVIGRI |
Ga0307284_100645721 | 3300028799 | Soil | ANVGERLTVLAFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0307284_102099181 | 3300028799 | Soil | NVGERLTVLAFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0307305_102953902 | 3300028807 | Soil | MANVGERLIVFAFAAFVLAAIVGLAFLVGYLIGRI |
Ga0307312_102680602 | 3300028828 | Soil | MANVGDRLIVFAVAVFVLAAIVGLAFLAGYVIGRILL |
Ga0307314_100385173 | 3300028872 | Soil | MATVGERLTVLAFAAFVLAAIVGLAFLAGYLIGRILL |
Ga0307278_100116863 | 3300028878 | Soil | MANVGDRVTVLAFAALVLAAIVGIAFLVGYVIGRILL |
Ga0307277_104810452 | 3300028881 | Soil | MANVGERLIVFAFAAFVLAAIVGLAFLVGYLIGRIL |
Ga0307308_101132483 | 3300028884 | Soil | MANVGERLTVFAFAAFILAAIVGLGFLAGYLIGRILL |
Ga0307308_104938852 | 3300028884 | Soil | MAKAGDKLTVFAFAAFVLAAIVGLGFLAGYLIGRILL |
Ga0299913_101834373 | 3300031229 | Soil | MTRVGERLVVFGFAAFVVAAIVGLAFAAGYLIGKLIL |
Ga0308194_101756071 | 3300031421 | Soil | MANVGDRLIVFAVAAFVLAAIVGLAFLAGYVIGRILL |
Ga0170819_136128981 | 3300031469 | Forest Soil | PAMANVGDRVTVFAFAALVLAAIVGIAFLVGYVIGRILL |
Ga0307471_1008294861 | 3300032180 | Hardwood Forest Soil | MASVGERLSVFAFAAFVVLAIVGIAFAAGYLIGRIFL |
Ga0334931_128401_158_271 | 3300034377 | Sub-Biocrust Soil | MAGAGDRLTVLAFAAFVLLAIVGLAFAAGYLIGRILL |
⦗Top⦘ |