NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016608

Metagenome / Metatranscriptome Family F016608

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016608
Family Type Metagenome / Metatranscriptome
Number of Sequences 246
Average Sequence Length 42 residues
Representative Sequence RAFLQENNVPYLVKPFEVADLISQARRLLQKAHAASAS
Number of Associated Samples 203
Number of Associated Scaffolds 246

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.34 %
% of genes from short scaffolds (< 2000 bps) 82.11 %
Associated GOLD sequencing projects 191
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.959 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.195 % of family members)
Environment Ontology (ENVO) Unclassified
(22.358 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.967 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.42%    β-sheet: 0.00%    Coil/Unstructured: 57.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 246 Family Scaffolds
PF12840HTH_20 30.89
PF02811PHP 12.60
PF05036SPOR 8.54
PF00174Oxidored_molyb 6.91
PF07733DNA_pol3_alpha 2.44
PF01145Band_7 2.03
PF01957NfeD 1.63
PF01494FAD_binding_3 0.81
PF14579HHH_6 0.81
PF13313DUF4082 0.81
PF01022HTH_5 0.81
PF00082Peptidase_S8 0.81
PF00092VWA 0.41
PF13432TPR_16 0.41
PF13426PAS_9 0.41
PF08281Sigma70_r4_2 0.41
PF09278MerR-DNA-bind 0.41
PF05362Lon_C 0.41
PF07992Pyr_redox_2 0.41
PF00486Trans_reg_C 0.41
PF11154DUF2934 0.41
PF14559TPR_19 0.41
PF01566Nramp 0.41
PF07700HNOB 0.41
PF01554MatE 0.41
PF00144Beta-lactamase 0.41
PF12804NTP_transf_3 0.41
PF03255ACCA 0.41
PF02518HATPase_c 0.41
PF13531SBP_bac_11 0.41
PF07730HisKA_3 0.41
PF09411PagL 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 246 Family Scaffolds
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 6.91
COG3915Uncharacterized conserved proteinFunction unknown [S] 6.91
COG0587DNA polymerase III, alpha subunitReplication, recombination and repair [L] 2.44
COG2176DNA polymerase III, alpha subunit (gram-positive type)Replication, recombination and repair [L] 2.44
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.63
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.81
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.81
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.81
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.41
COG0789DNA-binding transcriptional regulator, MerR familyTranscription [K] 0.41
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.41
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.41
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.41
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.41
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.41
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.41
COG2367Beta-lactamase class ADefense mechanisms [V] 0.41
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.41
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.41
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.41
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.41
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.96 %
UnclassifiedrootN/A15.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101468590All Organisms → cellular organisms → Bacteria → Acidobacteria1775Open in IMG/M
3300001471|JGI12712J15308_10171297Not Available565Open in IMG/M
3300002245|JGIcombinedJ26739_100599997All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300002245|JGIcombinedJ26739_100890220All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300002245|JGIcombinedJ26739_101504832Not Available568Open in IMG/M
3300004092|Ga0062389_100525634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1335Open in IMG/M
3300004157|Ga0062590_101609237All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300004633|Ga0066395_10924724All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300004635|Ga0062388_102586429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300005331|Ga0070670_100973583All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300005339|Ga0070660_100077794All Organisms → cellular organisms → Bacteria2600Open in IMG/M
3300005435|Ga0070714_100597662All Organisms → cellular organisms → Bacteria → Proteobacteria1059Open in IMG/M
3300005436|Ga0070713_101761839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300005445|Ga0070708_100521907All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300005450|Ga0066682_10714148All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005454|Ga0066687_10387206All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005541|Ga0070733_10480634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17830Open in IMG/M
3300005542|Ga0070732_10551765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter699Open in IMG/M
3300005547|Ga0070693_100453449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter900Open in IMG/M
3300005554|Ga0066661_10538767All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300005555|Ga0066692_10181766All Organisms → cellular organisms → Bacteria → Acidobacteria1307Open in IMG/M
3300005560|Ga0066670_10753415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300005576|Ga0066708_10238809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1152Open in IMG/M
3300005602|Ga0070762_10095731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1710Open in IMG/M
3300005614|Ga0068856_101204298All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300005764|Ga0066903_103417553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae857Open in IMG/M
3300005842|Ga0068858_100275955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1600Open in IMG/M
3300005921|Ga0070766_11040338All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006028|Ga0070717_10100536All Organisms → cellular organisms → Bacteria2455Open in IMG/M
3300006028|Ga0070717_10767421All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300006028|Ga0070717_11931755All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006052|Ga0075029_101205963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300006086|Ga0075019_10052683All Organisms → cellular organisms → Bacteria2298Open in IMG/M
3300006102|Ga0075015_100824962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300006174|Ga0075014_100853044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. 17J65-9542Open in IMG/M
3300006176|Ga0070765_100526065All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300006800|Ga0066660_11606605Not Available515Open in IMG/M
3300006893|Ga0073928_10632831All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006904|Ga0075424_100628404All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300007982|Ga0102924_1211091All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300009089|Ga0099828_11139534All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300009090|Ga0099827_10809340All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300009522|Ga0116218_1070332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1593Open in IMG/M
3300009641|Ga0116120_1088967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1026Open in IMG/M
3300009644|Ga0116121_1009292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3263Open in IMG/M
3300009700|Ga0116217_10231158Not Available1206Open in IMG/M
3300009792|Ga0126374_11740580All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300009824|Ga0116219_10203050All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300010048|Ga0126373_10354968All Organisms → cellular organisms → Bacteria → Acidobacteria1479Open in IMG/M
3300010048|Ga0126373_11866666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium664Open in IMG/M
3300010320|Ga0134109_10038684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1545Open in IMG/M
3300010329|Ga0134111_10010679All Organisms → cellular organisms → Bacteria2934Open in IMG/M
3300010339|Ga0074046_10526542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300010361|Ga0126378_10232079All Organisms → cellular organisms → Bacteria → Acidobacteria1933Open in IMG/M
3300010366|Ga0126379_11579431All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300010371|Ga0134125_10123517All Organisms → cellular organisms → Bacteria2882Open in IMG/M
3300010371|Ga0134125_12253487All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300010379|Ga0136449_100938419Not Available1403Open in IMG/M
3300010379|Ga0136449_103710177All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010876|Ga0126361_10885232All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300011072|Ga0138563_1022279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium783Open in IMG/M
3300011269|Ga0137392_10122785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2073Open in IMG/M
3300012125|Ga0154006_1046098All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300012203|Ga0137399_11456927All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012211|Ga0137377_11091364All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300012351|Ga0137386_10637964All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300012356|Ga0137371_11359289All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012361|Ga0137360_10211207All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300012683|Ga0137398_10464773All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300012918|Ga0137396_11215117All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012922|Ga0137394_10219390All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300012923|Ga0137359_11669389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300012925|Ga0137419_10348229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1145Open in IMG/M
3300012927|Ga0137416_11255649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300012927|Ga0137416_11509982All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300012927|Ga0137416_12223218All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012930|Ga0137407_10612694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1022Open in IMG/M
3300012930|Ga0137407_11236830All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012937|Ga0162653_100086717All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300012957|Ga0164303_11286139Not Available540Open in IMG/M
3300012971|Ga0126369_10173598Not Available2052Open in IMG/M
3300012971|Ga0126369_10336507All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300012988|Ga0164306_11961680All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012989|Ga0164305_11838510All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300013100|Ga0157373_10627303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300014169|Ga0181531_10052738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2378Open in IMG/M
3300014489|Ga0182018_10272702All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300014495|Ga0182015_10045407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3250Open in IMG/M
3300014501|Ga0182024_12716702All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300014969|Ga0157376_10118812All Organisms → cellular organisms → Bacteria2340Open in IMG/M
3300014969|Ga0157376_10295344All Organisms → cellular organisms → Bacteria → Acidobacteria1532Open in IMG/M
3300015242|Ga0137412_10350509All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300015242|Ga0137412_10961556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300015372|Ga0132256_100082167All Organisms → cellular organisms → Bacteria → Acidobacteria3087Open in IMG/M
3300015374|Ga0132255_104311308All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300017823|Ga0187818_10528530Not Available531Open in IMG/M
3300017924|Ga0187820_1223484Not Available595Open in IMG/M
3300017943|Ga0187819_10322066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis896Open in IMG/M
3300017943|Ga0187819_10654237Not Available594Open in IMG/M
3300017947|Ga0187785_10007512All Organisms → cellular organisms → Bacteria → Acidobacteria3644Open in IMG/M
3300017948|Ga0187847_10107556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1535Open in IMG/M
3300017959|Ga0187779_10741951All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300017994|Ga0187822_10298315Not Available568Open in IMG/M
3300018006|Ga0187804_10033576Not Available1943Open in IMG/M
3300018006|Ga0187804_10172851All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300018012|Ga0187810_10209836All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300018019|Ga0187874_10312699All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300018032|Ga0187788_10203871All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300018034|Ga0187863_10012783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5350Open in IMG/M
3300018034|Ga0187863_10022823All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3793Open in IMG/M
3300018034|Ga0187863_10333335All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300018035|Ga0187875_10036557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2914Open in IMG/M
3300018058|Ga0187766_10319066Not Available1010Open in IMG/M
3300018062|Ga0187784_10308885All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300018085|Ga0187772_10868743All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300018085|Ga0187772_11195509All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300018085|Ga0187772_11449697All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300018086|Ga0187769_10480157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345937Open in IMG/M
3300018086|Ga0187769_11275246Not Available556Open in IMG/M
3300018090|Ga0187770_10968802Not Available684Open in IMG/M
3300018468|Ga0066662_10552983All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300019786|Ga0182025_1133755All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300019888|Ga0193751_1098314All Organisms → cellular organisms → Bacteria → Acidobacteria1131Open in IMG/M
3300020579|Ga0210407_10793976All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300020580|Ga0210403_10430152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1076Open in IMG/M
3300020581|Ga0210399_10523317All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300020583|Ga0210401_11167690All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300021088|Ga0210404_10446685All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300021170|Ga0210400_11191852All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300021171|Ga0210405_11004200Not Available629Open in IMG/M
3300021178|Ga0210408_10792044All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300021178|Ga0210408_11397769All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300021181|Ga0210388_10663721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300021181|Ga0210388_10999700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300021401|Ga0210393_10127629All Organisms → cellular organisms → Bacteria2037Open in IMG/M
3300021401|Ga0210393_11529862Not Available530Open in IMG/M
3300021403|Ga0210397_10735940All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300021406|Ga0210386_10456990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1103Open in IMG/M
3300021420|Ga0210394_11604596All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300021432|Ga0210384_10316861All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300021432|Ga0210384_10323673All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300021433|Ga0210391_11297152Not Available562Open in IMG/M
3300021475|Ga0210392_11466433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300021476|Ga0187846_10387455Not Available575Open in IMG/M
3300021478|Ga0210402_10314137All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300021479|Ga0210410_10878053All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300022733|Ga0224562_1011133All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300024179|Ga0247695_1049094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300025907|Ga0207645_10044003All Organisms → cellular organisms → Bacteria2858Open in IMG/M
3300025910|Ga0207684_10057014All Organisms → cellular organisms → Bacteria3314Open in IMG/M
3300025914|Ga0207671_10796042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Fastidiosipila → Fastidiosipila sanguinis750Open in IMG/M
3300025916|Ga0207663_10077325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium2166Open in IMG/M
3300025925|Ga0207650_10215840All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300025928|Ga0207700_10182977All Organisms → cellular organisms → Bacteria → Acidobacteria1756Open in IMG/M
3300025934|Ga0207686_10489221All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300025939|Ga0207665_10093197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium2091Open in IMG/M
3300025961|Ga0207712_11825667All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300026035|Ga0207703_10241582All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300026307|Ga0209469_1074241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1028Open in IMG/M
3300026318|Ga0209471_1056946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1790Open in IMG/M
3300026333|Ga0209158_1055371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1606Open in IMG/M
3300026334|Ga0209377_1067766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1544Open in IMG/M
3300026538|Ga0209056_10359205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis947Open in IMG/M
3300027073|Ga0208366_1036210All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300027076|Ga0208860_1030320All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300027110|Ga0208488_1041773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300027376|Ga0209004_1061302All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300027629|Ga0209422_1057442Not Available928Open in IMG/M
3300027729|Ga0209248_10065419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1108Open in IMG/M
3300027825|Ga0209039_10298154Not Available635Open in IMG/M
3300027842|Ga0209580_10384828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae699Open in IMG/M
3300027846|Ga0209180_10617520All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300027853|Ga0209274_10053550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1919Open in IMG/M
3300027862|Ga0209701_10375921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae798Open in IMG/M
3300027867|Ga0209167_10075106All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300027898|Ga0209067_10044522Not Available2261Open in IMG/M
3300027908|Ga0209006_10331197All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300027908|Ga0209006_11345219All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300027911|Ga0209698_10881918All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300028023|Ga0265357_1020352All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300028379|Ga0268266_11301863All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300028776|Ga0302303_10292713All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028780|Ga0302225_10529627All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300028906|Ga0308309_11236159All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300028906|Ga0308309_11666280All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300029636|Ga0222749_10224512All Organisms → cellular organisms → Bacteria → Proteobacteria947Open in IMG/M
3300029939|Ga0311328_10558850All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300029952|Ga0311346_10772412All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300029984|Ga0311332_10567977All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300030045|Ga0302282_1222747All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300030057|Ga0302176_10210982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300030518|Ga0302275_10371002All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300030737|Ga0302310_10581444All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031090|Ga0265760_10284761Not Available582Open in IMG/M
3300031231|Ga0170824_127792988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17609Open in IMG/M
3300031234|Ga0302325_11422822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis900Open in IMG/M
3300031236|Ga0302324_100162331All Organisms → cellular organisms → Bacteria3639Open in IMG/M
3300031525|Ga0302326_11473828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis914Open in IMG/M
3300031525|Ga0302326_11501982All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300031525|Ga0302326_11700385All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300031573|Ga0310915_11239625All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031711|Ga0265314_10525783Not Available619Open in IMG/M
3300031715|Ga0307476_10014846All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4949Open in IMG/M
3300031715|Ga0307476_10842405All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300031715|Ga0307476_11227596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300031718|Ga0307474_11105236All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300031718|Ga0307474_11253839All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031740|Ga0307468_100900076All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300031796|Ga0318576_10247252All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300031879|Ga0306919_10818686All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300031912|Ga0306921_10883549All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1016Open in IMG/M
3300031941|Ga0310912_10006418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7168Open in IMG/M
3300031941|Ga0310912_10086693All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2283Open in IMG/M
3300031947|Ga0310909_10901116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales726Open in IMG/M
3300032076|Ga0306924_12560090All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300032174|Ga0307470_10227656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1214Open in IMG/M
3300032180|Ga0307471_101110995All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300032180|Ga0307471_103596923Not Available548Open in IMG/M
3300032180|Ga0307471_103600701All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300032515|Ga0348332_13014124All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300032805|Ga0335078_10099081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4211Open in IMG/M
3300032805|Ga0335078_10312807All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300032828|Ga0335080_10700760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1055Open in IMG/M
3300032892|Ga0335081_10171744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3056Open in IMG/M
3300032892|Ga0335081_10855173All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300032893|Ga0335069_10074206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4366Open in IMG/M
3300032893|Ga0335069_10105668All Organisms → cellular organisms → Bacteria3550Open in IMG/M
3300032893|Ga0335069_10829149All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1039Open in IMG/M
3300032893|Ga0335069_12068897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium598Open in IMG/M
3300032897|Ga0335071_10037955All Organisms → cellular organisms → Bacteria4771Open in IMG/M
3300032954|Ga0335083_10019824All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7795Open in IMG/M
3300032954|Ga0335083_10616923Not Available891Open in IMG/M
3300033134|Ga0335073_11075780Not Available822Open in IMG/M
3300033158|Ga0335077_10091430Not Available3590Open in IMG/M
3300033808|Ga0314867_142931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola560Open in IMG/M
3300033888|Ga0334792_115755All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300033983|Ga0371488_0068885All Organisms → cellular organisms → Bacteria → Acidobacteria2080Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.20%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.28%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.47%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.47%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.66%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.44%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.22%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.22%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.63%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.41%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.41%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.41%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.41%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.41%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.41%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.41%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.41%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.41%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.41%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.41%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.41%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.81%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.81%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011072Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012125Attine ant fungus gardens microbial communities from Florida, USA - TSFL090 MetaGHost-AssociatedOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027425Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10146859013300000364SoilAYLQQHQLSSLVKPFEIADLISQARRLLQKAHAAAAAAQ*
JGI12712J15308_1017129723300001471Forest SoilSNGVEPGAGRRFLQENNVPFLVKPFEVAELIAQARHLLQLAQAAAAGAS*
JGI12627J18819_1006050143300001867Forest SoilVTFSSLADQEARKFLQENNVPLLVKPFEVGDLINHARRLLQKVEAASAS*
JGIcombinedJ26739_10059999743300002245Forest SoilSNVEQNDERAFLQENKIPFLVKPFEVADLISQARRLLQTAQAAAASAS*
JGIcombinedJ26739_10089022013300002245Forest SoilFLNNHNVPYLVKPFEVGDLIAHARRLLQKTLAATAG*
JGIcombinedJ26739_10150483213300002245Forest SoilDPGDGRAFLRENNVASLVKPFEVAELIAQARRLLHQTQAVGAGAS*
Ga0062389_10052563423300004092Bog Forest SoilIRNFLQEKNVPYLVKPFEVADLISHARRLLQKVQAAAAS*
Ga0062590_10160923723300004157SoilSDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAEAGGD*
Ga0066395_1092472423300004633Tropical Forest SoilGRTFLQENGIPYLVKPFEVAELISQARKLLQKAQAAAGGAD*
Ga0062388_10258642923300004635Bog Forest SoilFSNSVEQGDDRAFLQENNIPYLVKPFEVAELISQARKLLPKAQAAAAGLS*
Ga0070670_10097358313300005331Switchgrass RhizosphereEIRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG*
Ga0070660_10007779433300005339Corn RhizosphereLEPEIRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG*
Ga0070661_10137905313300005344Corn RhizosphereFSSALEPEIRDFLHHHNVPYLVKPFEVGDLISQARRLLQKTQSAVAS*
Ga0070714_10059766223300005435Agricultural SoilFSAGVEPSDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAGAGGN*
Ga0070713_10176183913300005436Corn, Switchgrass And Miscanthus RhizosphereEQDIRNYLQANGIASLVKPFEVVDLISQARRLLQRSQAAVAK*
Ga0070711_10003741523300005439Corn, Switchgrass And Miscanthus RhizosphereMFTFSTAVEPEIRAFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG*
Ga0070708_10052190713300005445Corn, Switchgrass And Miscanthus RhizosphereSVTEPETRAFLHDNNLPYLVKPFEVADLISQARRLLQKTQAAVAG*
Ga0066682_1071414813300005450SoilEPGDGRAFLQENSIPYLVKPFEVAELISQARKLLQKAQAAGAGAD*
Ga0066687_1038720613300005454SoilPETRAFLHDNNVPYLVKPFEVGDLISQARRLLQKAVAATAD*
Ga0070733_1048063423300005541Surface SoilPSDERAFLQQNNVPYLVKPFEVAELITQARKLLQKAHAAAAGAGSD*
Ga0070732_1055176513300005542Surface SoilRAFLQENNVSYLVKPFEVAELISQARRLLQKARAASASAG*
Ga0070693_10045344933300005547Corn, Switchgrass And Miscanthus RhizosphereLPEPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG*
Ga0066661_1053876713300005554SoilLQESGIPYLVKPFEVAELIAQSRRLLQNAQAASAGAS*
Ga0066692_1018176623300005555SoilFLQENSIPYLVKPFEVAELINQARKLLQKAQAAGAGAD*
Ga0066670_1075341523300005560SoilGFLQENNVPFLVKPFEVAELIAQARRLLLKAQAAGAD*
Ga0066708_1023880913300005576SoilPEPETRAFLQENKVASLVKPFEVADLISHARRLLQKSHAAVAG*
Ga0070762_1009573153300005602SoilRAFLQENNIPYLVKPFEVAELISQARRLLQKSKGTASGAN*
Ga0068856_10120429823300005614Corn RhizosphereFVQENNVPYLVRPFEVAELISQARKLLQKALAAEAGGD*
Ga0066903_10341755313300005764Tropical Forest SoilFLQENGIPYLVKPFEVAELISQARKLLQKAQAAAGGAD*
Ga0068858_10027595543300005842Switchgrass RhizosphereTLPEPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG*
Ga0070766_1104033823300005921SoilFSHGVAQGDERAFLQENNVPFLVKPFEVAELISQARRLLQKAQAAAASAG*
Ga0070717_1010053613300006028Corn, Switchgrass And Miscanthus RhizosphereGVEQGDERAFLQENNVPYLVKPFEVAELILQARRLLQKAHAAAAGAS*
Ga0070717_1076742133300006028Corn, Switchgrass And Miscanthus RhizosphereQGEIRVFLEESNIPYLVKPFEVADLISRARRLLQKASVAAAN*
Ga0070717_1193175523300006028Corn, Switchgrass And Miscanthus RhizosphereFLQENSVPYLVKPFEVAELIAQARKLLQKAHAAAAGAGSD*
Ga0075029_10120596313300006052WatershedsDERTFLQENNVSYLVKPFEVAELITQARKLLQKAQAAAAGLS*
Ga0075019_1005268333300006086WatershedsTFSHGVEQADERSFLQENNVPYLVKPFEVAELIAQTRRLLPKAQAAGAGAN*
Ga0075015_10082496223300006102WatershedsVDPGDGRAFLQENNVPYLVKPFEVAELITQARKLLQKAQAAGASAS*
Ga0070715_1034319133300006163Corn, Switchgrass And Miscanthus RhizosphereTFSSAVEPEIRGFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG*
Ga0075014_10085304413300006174WatershedsFSNGVEPGNGRAYLQENNVPCLVKPFEVAELIAQTRKLLQKAQAAGAGAN*
Ga0070765_10052606513300006176SoilVPEPETRSFLHEKNVPSLVKPFEVADLIAQTRRLLPKAQAASAS*
Ga0066660_1160660523300006800SoilQENNIPYLVKPFEVAELISQARKLLQKAQAAGAGAD*
Ga0073928_1063283113300006893Iron-Sulfur Acid SpringNNIPYLVKPFEVAELISQARRLLQKAQAAAAGAS*
Ga0075424_10062840413300006904Populus RhizosphereEIRAFLHDNNLPYLVKPFEVADLISQARRLLVKTQAATAG*
Ga0102924_121109123300007982Iron-Sulfur Acid SpringYLQEHSIPCLVKPFEVGELIAQARKLLQQAQAVTAGAD*
Ga0099828_1113953433300009089Vadose Zone SoilGLEQGETRVFLEESNIPYLVKPFEVADLILRARRLLQKTNAATAN*
Ga0099827_1080934033300009090Vadose Zone SoilETRAFLQENKVASLVKPFEVADLISHARRLLRKSHAAVAG*
Ga0116218_107033213300009522Peatlands SoilRSFLQEKNVPCLVKPFEVADLIAHARRLMQKAHAASAS*
Ga0116120_108896713300009641PeatlandVEQSDDRQFLQENHIPYLVKPFEVADLISQARRLLQKAQAAAASAS*
Ga0116121_100929213300009644PeatlandDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS*
Ga0116217_1023115813300009700Peatlands SoilDSGIPYLVKPFEVADLISQARRLLQKAQAAAAGVS*
Ga0126374_1174058023300009792Tropical Forest SoilRNYLQGNGIASLVKPFEVVDLISQARRILQRGQAAVAK*
Ga0116219_1020305013300009824Peatlands SoilFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS*
Ga0126373_1035496813300010048Tropical Forest SoilVLYTFSNTVEPGEGRAFLQENSIPYLVKPFEVAELISQARKLLLKAQAAGAGAD*
Ga0126373_1186666613300010048Tropical Forest SoilEGRTFLQENNVPYLVKPFEVAELISQARKLLQKTQAAAAGGD*
Ga0134109_1003868443300010320Grasslands SoilVRDFLAQNNLPHLVKPFEVADLIAQARRLLQKTHAVAAS*
Ga0134111_1001067953300010329Grasslands SoilLAQNNLPHLVKPFEVADLIAQARRLLQKTHAAAAS*
Ga0074046_1052654223300010339Bog Forest SoilRTFLQDSGVPYLVKPFEVADLISQARRLLQKAQAAAAGLS*
Ga0126378_1023207913300010361Tropical Forest SoilDPTDGRSFLQVNGVPFLVKPFEVAELITQARKLLPKARAAGAD*
Ga0126379_1157943123300010366Tropical Forest SoilVRNYLQSNGVPSLVKPFEVVDLISQARRLLQKTQAAIAN*
Ga0134125_1012351713300010371Terrestrial SoilLEPEIRDFLHNNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG*
Ga0134125_1225348713300010371Terrestrial SoilFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG*
Ga0136449_10093841923300010379Peatlands SoilQESNVPYLVKPFEVAELIAQARKLLQKAQVAAAGLS*
Ga0136449_10371017713300010379Peatlands SoilEQGDERAFLQENNVPYLVKPFEVAELILQARRLLQKSKAAASGS*
Ga0126361_1088523213300010876Boreal Forest SoilPGAGRRFLQENNVPFLVKPFEVAELIAQARHLLQLAQVAAAGAG*
Ga0138563_102227913300011072Peatlands SoilPEVRSFMQEKGVSHLVKPFEVADLITHARRLMQKAQAATAN*
Ga0137392_1012278513300011269Vadose Zone SoilLQENNVPYLVKPFEVAELISQSRRLLQKAHAAAASAD*
Ga0154006_104609823300012125Attine Ant Fungus GardensSSLADQEARKFLQENNVPLLVKPFEVGDLINHARRLLQKAEAASAS*
Ga0137399_1145692713300012203Vadose Zone SoilRAFLHDHNLPYLVKPFEVGDLISHARRLLQKTLAATAG*
Ga0137377_1109136413300012211Vadose Zone SoilSFLQEKNLPYLVKPFEVADLIAQARRLSQKTQAASAG*
Ga0137386_1063796423300012351Vadose Zone SoilDFLQQHNLPHLVKPFEVADLIAQARRLLQKTHAAVAS*
Ga0137371_1135928913300012356Vadose Zone SoilFLQEKNLPYLVKPFEVADLIAQARRLSQKALAATAG*
Ga0137360_1021120713300012361Vadose Zone SoilNAVEPEIRSFLHDNNIPYLVKPFEVGDLISQARRLLQKTLAATAG*
Ga0137398_1046477333300012683Vadose Zone SoilGDERAFLQENNVPYLVKPFEVAELISQSRRLLQKAQAATASAD*
Ga0137396_1121511733300012918Vadose Zone SoilIRVFLQESNIPYLVKPFEVAELISRARHLLQKANAATAN*
Ga0137394_1021939013300012922Vadose Zone SoilIAESDIRNYLQANGVPSLVKPFEVVDLISHARRLVQKTQAAIAK*
Ga0137359_1166938923300012923Vadose Zone SoilTFSNSPSDERAFLQENSVPYLVKPFEVAELITQARKLLQKAHAAAAGSD*
Ga0137419_1034822933300012925Vadose Zone SoilSHGLEQGEIRVFLEESNIPYLVKPFEVADLISQARRLLQKAHAATSN*
Ga0137416_1125564913300012927Vadose Zone SoilAFLHDHNLPYLVKPFEVGDLISHARRLLQKTLAASAG*
Ga0137416_1150998213300012927Vadose Zone SoilAFLHDHNLPYLVKPFEVGDLISHARRLLQKTLAATAG*
Ga0137416_1222321823300012927Vadose Zone SoilFLQENNVPCLVKPFEVGDLISQARRLLHKEQAAAAASSAS*
Ga0137407_1061269433300012930Vadose Zone SoilENSVACLVKPFEVGDLISQARRLLQKEQAAAASAS*
Ga0137407_1123683023300012930Vadose Zone SoilAESDIRNYLQANGVPSLVKPFEVVDLISQARRLVQKTQAAIAK*
Ga0162653_10008671713300012937SoilEPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG*
Ga0164303_1050831213300012957SoilTFSSALEPEIRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG*
Ga0164303_1128613923300012957SoilVDHSEGRTYLQECGIPYLVKPFEVAELISQARKLLQKTQAAGVGSD*
Ga0126369_1017359813300012971Tropical Forest SoilENGIPYLVKPFEVAELISQARKLLQKAQAASGGAD*
Ga0126369_1033650733300012971Tropical Forest SoilKDYLQANGIASLVKPFEVVDLISQARRLLQKTQAAIAN*
Ga0164306_1196168013300012988SoilPEIRDFLHNNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG*
Ga0164305_1183851023300012989SoilLQDNNLPCLVKPFEVADLINQARSLTQKVQAAGAS*
Ga0157373_1062730313300013100Corn RhizosphereQENNVPYLVRPFEVAELISQARKLLQKALAAGAGGT*
Ga0181531_1005273853300014169BogLQENNVPYLVKPFEVADLISHARRLLQKALAVAASSGS*
Ga0182018_1027270213300014489PalsaDERAFLHENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS*
Ga0182015_1004540763300014495PalsaGDERAFLQENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS*
Ga0182024_1271670223300014501PermafrostSNGVEQTDEWAFLQENNIPYLVKPFEVADLITQARRLLQKAHAAAASAS*
Ga0157376_1011881213300014969Miscanthus RhizosphereSAVEPEIRSFLHDNNIPYLVKPFEVSDLISQARRLLQKTQAAVAGVT*
Ga0157376_1029534413300014969Miscanthus RhizosphereENNVSFLVKPFEVAELISQARRLLPKAQAAGAGSD*
Ga0137412_1035050913300015242Vadose Zone SoilLQENDIPYLIKPFEVVELISQTRRLLQKAHTAAAGAS*
Ga0137412_1096155613300015242Vadose Zone SoilGRAFLQENNVPYLVKPFEVAELITQTRRLLQKEQAAAAAGI*
Ga0132256_10008216713300015372Arabidopsis RhizosphereVRAYLQQHQLSSLVKPFEIADLITQARRLLQKAHAAAASAK*
Ga0132255_10431130813300015374Arabidopsis RhizosphereVAEHDVRAYLQQHQLSSLVKPFEIADLITQARRLLQKAHAAAASAK*
Ga0187818_1052853013300017823Freshwater SedimentTFLQENSIPYLVKPFEVAELISQARKLLQKAQAAGAGLS
Ga0187820_122348413300017924Freshwater SedimentTDERTFLQENSVPYLVKPFEVAELIAQTRRLLPKAQAAGAGSD
Ga0187819_1032206613300017943Freshwater SedimentRGFLQENNVPYLVKPFEVADLISHARRLLQKTQAATAD
Ga0187819_1065423723300017943Freshwater SedimentAAELEMRNFLQDNNIPSLLKPFEVADLIMQTRLLLQKAQAVGAN
Ga0187785_1000751253300017947Tropical PeatlandSNVAELEVRNFLQENHVPYLVKPFEVADLISHARRLLQKAQAAAAS
Ga0187847_1010755613300017948PeatlandDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS
Ga0187779_1074195123300017959Tropical PeatlandAFLQENGIPYLVKPFEVAELIAQTRKLLQKAQAAGAS
Ga0187822_1029831513300017994Freshwater SedimentFLQENGTPYLVKPFEVAELIAQARKLLQKALGASAGAD
Ga0187804_1003357633300018006Freshwater SedimentEPEVRSFMQEKNVPCLVKPFEVADLIAHARRLMQKAHAASA
Ga0187804_1017285123300018006Freshwater SedimentLQENHVPYLVKPFEVADLISHARRLLHKAQAAGAS
Ga0187810_1020983613300018012Freshwater SedimentEVRSFLQGKGVPYLVKPFEVADLIVHTRRLMQKAQAASAS
Ga0187874_1031269913300018019PeatlandVEPGNGRAYLQENSVPCLVKPFEVAELISQARRLLQQTQAAAAGAS
Ga0187788_1020387113300018032Tropical PeatlandAEPEIRTFLQENNIPCLLKPFEVGDFISQARRLLQKTQAVGAS
Ga0187863_1001278383300018034PeatlandLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS
Ga0187863_1002282313300018034PeatlandSCLQENHVPYLVKPFEVGELIEQARKLMQKAQSASAR
Ga0187863_1033333513300018034PeatlandSGVEQGDERAFLQENNLPYLVKPFEVAELILQARRLLQKAQAAAAGA
Ga0187875_1003655713300018035PeatlandSDERAFLQENKIPFLVKPFEVADLISHARRLLQKAQAAAASAS
Ga0187766_1031906613300018058Tropical PeatlandRTFLQENNVPYLVKPFEVADLITHARQLLTKAQAAGAS
Ga0187784_1030888533300018062Tropical PeatlandSFLQEKNVPMLVKPFEVADLIAQVRRLSQKAEGASAS
Ga0187772_1086874313300018085Tropical PeatlandNGVEQSDGRAFLQENSVPSLVKPFEVAELISQARKLLQKTQAASAGTD
Ga0187772_1119550923300018085Tropical PeatlandSSGVEQGNDRIFLQENNVPYLVKPFEVAELITQARRLLQKAHAAAASAS
Ga0187772_1144969713300018085Tropical PeatlandHGDSRSFLQDSTVPYLVKPFEVAELISQARRLLQKTQAAAVGTD
Ga0187769_1048015723300018086Tropical PeatlandLQENNVPSLVKPFEVADLISQARRLLQKTQAASAGTS
Ga0187769_1127524613300018086Tropical PeatlandENSVPSLVKPFEVGELIAQARRLLQKSQTAAAGTD
Ga0187770_1096880223300018090Tropical PeatlandTFLQDNSIPYLVKPFEVAELISQARKLLQKTQTAAAGN
Ga0066662_1055298313300018468Grasslands SoilRGFLQSNDLPFLVKPFEVADFITAARSLLQKTQAAAAAGT
Ga0182025_113375513300019786PermafrostKQRPFLQQNNVPYLVKPFEVADLISQARRLLQKAHAAAASAS
Ga0193751_109831413300019888SoilNGVELSDGRAFLQENGVACLVKPFEVAELIAHARRLLQRAQAAAAGAS
Ga0210407_1079397623300020579SoilAYLQENNVPCLIKPFEVAELIAQARRLLQQAQAAAASAS
Ga0210403_1043015223300020580SoilANGLGDERAFLQENSIPYLVKPFEVAELIAQARKLLQKAHAAAASAS
Ga0210399_1052331713300020581SoilFSNGVEQGDERAFLQENNLPYLVKPFEVAELISQARRLLQKSKGTASGAN
Ga0210401_1116769023300020583SoilDVKNYLQSNGVPSLVKPFEVVDLISQARRLLQRTQAAIAN
Ga0210404_1044668513300021088SoilPEVRTFLQEKNIPCLVKPFEVADLITHARRLMQKAQAASAT
Ga0210400_1119185223300021170SoilHGVEQSNERAFLQENNVPYLVKPFEVADLISQARRLLQKAQAAAASAS
Ga0210405_1100420013300021171SoilSFLQEKSVPCLVKPFEVADLIAHARRLMQKAHAASAS
Ga0210408_1079204413300021178SoilAFLQENNVPYLVKPFEVGELISQARRLLLKTHAAAASAD
Ga0210408_1139776913300021178SoilGDERAFLQENNVPYLVKPFEVAELISQARRLLQKTRAASAS
Ga0210388_1066372123300021181SoilLQDKSVPCLVKPFEVADLITHARRLMQKAQAASAS
Ga0210388_1099970013300021181SoilSDERAFLQQNNVPYLVKPFEVAELITQARKLLQKAHYAAAGSS
Ga0210388_1174301013300021181SoilVTFASVAEPEVREFLQNNQVPYLVKPFEVGDLIGQARRLLQKASAAASSL
Ga0210393_1012762913300021401SoilSFLQEKSIPCLVKPFEVADLIAHARRLMQKVQAASAS
Ga0210393_1152986213300021401SoilFLEENHVPYLAKPFEVAELITQTRKLLQKAQAAGAGAS
Ga0210397_1073594013300021403SoilETRAFLHRNNLPYLVKPFEVADLISQARRLLQKSRATAAG
Ga0210386_1045699013300021406SoilAEPDVRSFLQDKSVPCLVKPFEVADLITHARRLMQKAQAASAS
Ga0210394_1160459613300021420SoilRAFLQENNVPYLVKPFEVADLISQARRLLQKAHAASAS
Ga0210384_1031686133300021432SoilNGLGDERAFLQENSIPYLVKPFEVAELIAQARKLLQKAHAAAASAS
Ga0210384_1032367313300021432SoilVVETETRAFLNNHNVPYLVKPFEVGDLIAHARRLLQKTLAATAG
Ga0210391_1129715213300021433SoilQENNVPFLVKPFEVAELIAQARHLLQLAQAAAAGAS
Ga0210392_1146643313300021475SoilSFLQEKNVPCLVKPFEVADLIAHARRLMQKAQAAGAS
Ga0187846_1038745523300021476BiofilmQENTIPYLVKPFEVAELISQARKLLQKTQAAGAGAD
Ga0210402_1031413743300021478SoilYLQSNGIASLVKPFEVVDLISQARRLLQRTQAAVAN
Ga0210410_1087805323300021479SoilFSSAVEPEIRGFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG
Ga0224562_101113313300022733SoilNGVEQGDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS
Ga0247695_104909423300024179SoilNSVEPGEGRSFLQENSVPYLVKPFEVAELISQARKLLVKAQAAGAGAD
Ga0207645_1004400343300025907Miscanthus RhizosphereIRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG
Ga0207684_1005701423300025910Corn, Switchgrass And Miscanthus RhizosphereVEPGNGRAYLQENSVPCLVKPFEVAELISQARRLLQQAQAAAASAD
Ga0207671_1079604223300025914Corn RhizosphereFSAGVEPSDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAGAGAD
Ga0207663_1007732523300025916Corn, Switchgrass And Miscanthus RhizosphereLYTFSNSVEPGEGRSFLQENSVPYLVKPFEVAELISQARKLLVKAQAAGAGAD
Ga0207663_1013437123300025916Corn, Switchgrass And Miscanthus RhizosphereMFTFSTAVEPEIRAFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVTG
Ga0207650_1021584043300025925Switchgrass RhizospherePDVRAFLSDNNLPSLVKPFEVADLISHARKLVQKTQSAAAGS
Ga0207700_1018297723300025928Corn, Switchgrass And Miscanthus RhizosphereVEPSDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAEAGGD
Ga0207686_1048922113300025934Miscanthus RhizosphereRDFLQQHDLPSLVKPFEVADLIAQAKRLLQKTQAASAG
Ga0207665_1009319713300025939Corn, Switchgrass And Miscanthus RhizospherePGEGRSFLQENSVPYLVKPFEVAELISQARKLLVKAQAAGAGAD
Ga0207712_1182566723300025961Switchgrass RhizosphereVRAFLSDNNLPSLVKPFEVADLISHARKLVQKTQSAAAGS
Ga0207703_1024158213300026035Switchgrass RhizosphereTLPEPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG
Ga0209469_107424133300026307SoilMRTFLQVKNVPSLVKPFEVADLISQTRRLLQKARAVAV
Ga0209471_105694613300026318SoilQGDERAFLQENSVPYLVKPFEVAELISQARRLLQKALATAASAD
Ga0209158_105537133300026333SoilEKNIPCLVKPFEVADLIAQARRLLQKSAAATASSS
Ga0209377_106776613300026334SoilVPEPEVRAVLQENNSASLVKPFEIAELISQARRLLQKAQAATAG
Ga0209056_1035920513300026538SoilLQENKVASLVKPFEVADLISHARRLLQKSHAAVAG
Ga0208366_103621013300027073Forest SoilDVRNYLQSNGVPSLVKPFEVVDLISQARRLLQKTQAAIAN
Ga0208860_103032023300027076Forest SoilTKNYLQANGIASLVKPFEVVDLIAQARRLLQKTQAAAN
Ga0208488_104177323300027110Forest SoilDIRTFLLEKSVPCLVKPFEVADLINHARRLMQKSQAASAS
Ga0209004_106130223300027376Forest SoilDVKNYLQSNGVASLVKPFEVVDLISQARRLLQKTQAAIAK
Ga0207522_10343613300027425SoilMFTFSSALEPEIRDFLHHNNVPYLVKPFEVGDLISQARRLLQKTHSAVAG
Ga0209422_105744213300027629Forest SoilFLQEKNVPCLVKPFEVADLIAHARRLMQKAHAAAAS
Ga0209248_1006541913300027729Bog Forest SoilTFLLEKSVPCLVKPFEVADLINHARRLMQKSQAASAS
Ga0209039_1029815413300027825Bog Forest SoilFLQENSVPSLVKPFEVAELISQARSLLQKTQAAATGAD
Ga0209580_1038482833300027842Surface SoilRAFLQENNVSYLVKPFEVAELISQARRLLQKARAASASAG
Ga0209180_1061752013300027846Vadose Zone SoilSVAEPEIRSFLHENNLPCLVKPFEVADLISQARRLLQKTQTAAAG
Ga0209274_1005355013300027853SoilLQDNDVAHLVKPFEVADLIAQARRLLQAHASAASAS
Ga0209701_1037592133300027862Vadose Zone SoilETRTFLHENNLPYLVKPFQVADLISRARRLLQKTRTATAG
Ga0209167_1007510643300027867Surface SoilSDERAFLQQNNVPYLVKPFEVAELITQARKLLQKAHAAAAGAGSD
Ga0209067_1004452213300027898WatershedsSHGVEQADERSFLQENNVPYLVKPFEVAELIAQTRRLLPKAQAAGAGAN
Ga0209006_1033119713300027908Forest SoilRAFLNNHNVPYLVKPFEVGDLIAHARRLLQKTLAATAG
Ga0209006_1134521933300027908Forest SoilEPEIREFLQNNQVPYLVKPFEVGDLIGHARRLLQKASAAAAS
Ga0209698_1088191833300027911WatershedsNSVEPADGRTFLQESSIPYLVKPFEVAELISQARKLLQKAQAAGAGAD
Ga0265357_102035223300028023RhizosphereFSNGVDLGDGRAYLQENNVPCLIKPFEVAELIAQARRLLQQAQAAAASAS
Ga0268266_1130186313300028379Switchgrass RhizosphereSFLHDNNIPYLVKPFEVSDLISQARRLLQKTQAAVAGVT
Ga0302303_1029271313300028776PalsaGDARSFLQDNNITHLVKPFEVADLIAQARLLLQKSHASAASAS
Ga0302225_1052962713300028780PalsaDERAFLQENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS
Ga0308309_1123615913300028906SoilMRKFLKENNVTYLVKPFEVGDLIAQARRLLQKTQAAVAG
Ga0308309_1166628013300028906SoilSNGVEPGDERAFLQENDIPYLVKPFEVAELIAQARRLLQKAKASAAGAN
Ga0222749_1022451223300029636SoilLFTFANGLGDERAFLQENSIPYLVKPFEVAELIAQARKLLQKAHAAAASAS
Ga0311328_1055885023300029939BogTFSNGVEQGDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASA
Ga0311346_1077241213300029952BogGVEQGDERAFLEKNDVPYLVKPFEVADLISHARRLLQKAHAAAASAS
Ga0311332_1056797733300029984FenRAFLNHHNIACLVKPFEVADLISQARRLLVKTQAAGAS
Ga0302282_122274733300030045FenRAFLEKNDVPYLVKPFEVADLISHARRLLQKAHAAAASAS
Ga0302176_1021098233300030057PalsaRENNVPYLVKPFEVAELISQARRLLQKAHAAAGAG
Ga0302275_1037100213300030518BogRSFLQENNVPYLVKPFEVAELIAQARRLLQKAQAAAAGAG
Ga0302310_1058144413300030737PalsaLQENNVPFLVKPFEVAELISQARRLLQKAHAAAAAAG
Ga0265760_1028476113300031090SoilRAFLQENNVPCLVKPFEVAELIAQARRLLQQAQAAAASAS
Ga0170824_12779298813300031231Forest SoilNGVETGNGRAYLQENNVPCLVKPFEVAELISQARRLLQQAQAAAAGTD
Ga0302325_1142282233300031234PalsaGDTRAFLQENNIPYLVKPFEVGELISHARSLLRKELASAASAD
Ga0302324_10016233113300031236PalsaFLRENNVPYLVKPFEVAELISQARRLLQKAHAAAGAG
Ga0302326_1147382813300031525PalsaRAFLQENNIPYLVKPFEVGELISHARSLLRKELASAASAD
Ga0302326_1150198213300031525PalsaLQENNVPYLVKPFEVADLISHARRLLQKALAVAASSGS
Ga0302326_1170038513300031525PalsaRAFLQENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS
Ga0310915_1123962513300031573SoilEIRTFLQENNIPCLLKPFEVGDFISQARRLLQKTQAVGAS
Ga0265314_1052578313300031711RhizosphereSNGPSDEKAFLQENNIHYLVKPFEVAELIAQARRLLQKAQAAGAGAD
Ga0307476_1001484613300031715Hardwood Forest SoilVEQGDERAFLQENNIPYLVKPFEVADLISQARRLLQKAHAATASA
Ga0307476_1084240533300031715Hardwood Forest SoilGDERAFLQENNLPYLVKPFEVAELISQARRLLQKSKGTASGAN
Ga0307476_1122759613300031715Hardwood Forest SoilRSFLHDNNVPYLVKPFEVSDLISQARRLLQKTQAAVAGSI
Ga0307474_1110523633300031718Hardwood Forest SoilHERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS
Ga0307474_1125383923300031718Hardwood Forest SoilNGIEQGDERVFLQEHNVPYLVKPFEVAELISQARRLLQKAHAATASAD
Ga0307468_10090007613300031740Hardwood Forest SoilADGRTFLQENRIPYLVKPFEVAELISQARKLLQKAQAAGAD
Ga0318576_1024725213300031796SoilRNYLQGNGIPSLVKPFEVVDLIAQARKILQKTQAAIAR
Ga0306919_1081868613300031879SoilYTFSNSVEPGDGRSFLQENRVPYLVKPFEVAELISQARKLMQKAQAAGAGAD
Ga0306921_1088354913300031912SoilVEPGEGRTFLQENSIPYLVKPFEVAELISQARKLLLKAQAASAGSD
Ga0310912_1000641813300031941SoilVAEKDVRAYLQQAHIPSLVKPFEVAELIAHARRLLQKTQAATAK
Ga0310912_1008669353300031941SoilDVRNYLQGNGIPSLVKPFEVVDLIAQARKILQKTQAAIAR
Ga0310909_1090111613300031947SoilAEPETRTFLQANHVSYLVKPFEVIDLISHARKLLQKSNAAAAG
Ga0306924_1256009023300032076SoilFLQANHVSYLVKPFEVIDLISHARKLLQKSNAAAAG
Ga0307470_1022765633300032174Hardwood Forest SoilDTDIRNYLQANGVPSLVKPFEVVDLISQARRMLQKTQAAVAQ
Ga0307471_10111099513300032180Hardwood Forest SoilVEEGDERAFLQQNNVPYLVKPFEVAELISQARRLLQKAQAAAASAS
Ga0307471_10359692313300032180Hardwood Forest SoilGDGRTFLQENSIPYLVKPFEVAELISQARKLLQKAQAVGAGAD
Ga0307471_10360070113300032180Hardwood Forest SoilLHQNNLPYLVKPFEVADLISQARRLLQKTRAASAG
Ga0307472_10076972013300032205Hardwood Forest SoilFTFSNAVEPEIRSFLHDNNIPYLVKPFEVGDLISQARRLLQRTLAATAG
Ga0348332_1301412443300032515Plant LitterEQGDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHATAASAS
Ga0335078_1009908143300032805SoilRDYLQENSVPYLVKPFEVAELISQARKLLQKTQAAGAGAD
Ga0335078_1031280713300032805SoilLQDHNVPFLVKPFEVAELITQVRQLLPKAQAAGAG
Ga0335080_1070076023300032828SoilERSFLQENRVPYLVKPFEVAELISQARKLLQKAQSAAAGAAE
Ga0335081_1017174453300032892SoilSAAELEMRNFLQENNVPSLLKPFEVADLIMQTRLLLQKAQAVGAS
Ga0335081_1085517333300032892SoilRTFLQERNVPFLVKPFEVSDVIAHARRLLQKTHAAGAS
Ga0335069_1007420613300032893SoilSTMADAETKAFLQEHTVTCLVKPFGVADLIAQARRLLQKTMAAGA
Ga0335069_1010566813300032893SoilENGVPYLVKPFEVAELISQARKLLQKSLAAGAGTD
Ga0335069_1082914923300032893SoilGVELGEGRSFLQENNVPYLVKPFEVAELISQARKLLQKSLAASAGTD
Ga0335069_1206889723300032893SoilGVELGEGRSFLQENNVPYLVKPFEVAELISQARKLLQKSLAAGAGTD
Ga0335071_1003795543300032897SoilNGVEPGEGRSFLQENGVPYLVKPFEVAELISQARKLLQKSLAAGAGTD
Ga0335083_1001982413300032954SoilTFSNGVEPGEGRAFLQENNVPYLVKPFEVAELISQARKLLQKTQAAGAGAD
Ga0335083_1061692323300032954SoilFLQQNSVPYLVKPFEVADLIAQTRKLLQGTKAAAAGAS
Ga0335073_1107578013300033134SoilDARAFLQENKVPYLVKPFEVAELIAQTRKLLPKAHAAGAGAS
Ga0335077_1009143023300033158SoilPGDGRAFLQENNVPYLVKPFEVAELISQARKLLQKALAAGAGTD
Ga0314867_142931_431_5593300033808PeatlandDGRAFLQENGIPYLVKPFEVAELIAQTRKLLQKAQAAGAGAS
Ga0334792_115755_569_7183300033888SoilAADGDERAFLQENNLPYLVKPFEVAELISQARRLLQKAQAAAASAGAMG
Ga0371488_0068885_1966_20793300033983Peat SoilLQENKIPFLVKPFEVADLISQARRLLQKAQAAAASAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.