NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F016543

Metagenome Family F016543

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016543
Family Type Metagenome
Number of Sequences 246
Average Sequence Length 46 residues
Representative Sequence ITNLPYDANGNVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF
Number of Associated Samples 192
Number of Associated Scaffolds 246

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.92 %
% of genes near scaffold ends (potentially truncated) 92.28 %
% of genes from short scaffolds (< 2000 bps) 93.50 %
Associated GOLD sequencing projects 182
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.618 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.008 % of family members)
Environment Ontology (ENVO) Unclassified
(33.740 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.439 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.56%    β-sheet: 2.78%    Coil/Unstructured: 91.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 246 Family Scaffolds
PF00884Sulfatase 4.88
PF01739CheR 3.25
PF13620CarboxypepD_reg 3.25
PF13442Cytochrome_CBB3 3.25
PF02776TPP_enzyme_N 2.03
PF00171Aldedh 1.63
PF00034Cytochrom_C 1.22
PF00355Rieske 1.22
PF01408GFO_IDH_MocA 1.22
PF12836HHH_3 1.22
PF00753Lactamase_B 1.22
PF09339HTH_IclR 1.22
PF06283ThuA 1.22
PF01063Aminotran_4 0.81
PF03551PadR 0.81
PF00127Copper-bind 0.81
PF01738DLH 0.81
PF13360PQQ_2 0.81
PF08327AHSA1 0.81
PF00406ADK 0.81
PF07676PD40 0.81
PF17186Lipocalin_9 0.41
PF05572Peptidase_M43 0.41
PF00903Glyoxalase 0.41
PF01042Ribonuc_L-PSP 0.41
PF13646HEAT_2 0.41
PF03616Glt_symporter 0.41
PF07978NIPSNAP 0.41
PF05199GMC_oxred_C 0.41
PF02371Transposase_20 0.41
PF14559TPR_19 0.41
PF13377Peripla_BP_3 0.41
PF13517FG-GAP_3 0.41
PF07969Amidohydro_3 0.41
PF00754F5_F8_type_C 0.41
PF03713DUF305 0.41
PF01261AP_endonuc_2 0.41
PF12681Glyoxalase_2 0.41
PF12704MacB_PCD 0.41
PF07690MFS_1 0.41
PF12708Pectate_lyase_3 0.41
PF01545Cation_efflux 0.41
PF04734Ceramidase_alk 0.41
PF00072Response_reg 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 246 Family Scaffolds
COG1352Methylase of chemotaxis methyl-accepting proteinsSignal transduction mechanisms [T] 6.50
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 3.25
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.63
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.63
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.63
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.63
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 1.22
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.81
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.81
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.81
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.81
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.41
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.41
COG0786Na+/glutamate symporterAmino acid transport and metabolism [E] 0.41
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.41
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.41
COG3544Uncharacterized conserved protein, DUF305 familyFunction unknown [S] 0.41
COG3547TransposaseMobilome: prophages, transposons [X] 0.41
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.62 %
UnclassifiedrootN/A11.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886011|MRS1b_contig_2106901All Organisms → cellular organisms → Bacteria1070Open in IMG/M
2170459005|F1BAP7Q01C0CAWAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300000550|F24TB_11406049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus531Open in IMG/M
3300000559|F14TC_106020833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300000956|JGI10216J12902_106859138All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300000956|JGI10216J12902_111754434All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300001213|JGIcombinedJ13530_106577261All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium668Open in IMG/M
3300001213|JGIcombinedJ13530_108431472Not Available720Open in IMG/M
3300001686|C688J18823_10424994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300001976|JGI24752J21851_1053596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300002128|JGI24036J26619_10081048Not Available651Open in IMG/M
3300002128|JGI24036J26619_10104154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8580Open in IMG/M
3300002239|JGI24034J26672_10040966All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300002244|JGI24742J22300_10116399Not Available525Open in IMG/M
3300004114|Ga0062593_101721885All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300004114|Ga0062593_103142153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300004153|Ga0063455_101165890All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300004156|Ga0062589_101091450Not Available754Open in IMG/M
3300004156|Ga0062589_102577266All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300004157|Ga0062590_100403620All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300004643|Ga0062591_100855861All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300004643|Ga0062591_101150933All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300005093|Ga0062594_101401697Not Available709Open in IMG/M
3300005093|Ga0062594_101632602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300005093|Ga0062594_101700925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300005093|Ga0062594_102456252All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300005093|Ga0062594_103083439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300005093|Ga0062594_103175849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300005174|Ga0066680_10282197All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300005328|Ga0070676_10183886All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300005340|Ga0070689_100111687All Organisms → cellular organisms → Bacteria2174Open in IMG/M
3300005344|Ga0070661_101850030All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005355|Ga0070671_100415313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1152Open in IMG/M
3300005356|Ga0070674_101068948All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8711Open in IMG/M
3300005365|Ga0070688_100170366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1502Open in IMG/M
3300005365|Ga0070688_101666568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300005366|Ga0070659_100749094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium847Open in IMG/M
3300005436|Ga0070713_101936396All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005440|Ga0070705_101278747All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300005441|Ga0070700_101911059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300005445|Ga0070708_102272436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300005456|Ga0070678_100436642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae1144Open in IMG/M
3300005457|Ga0070662_101475122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300005458|Ga0070681_10981961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300005459|Ga0068867_102000434All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005466|Ga0070685_10845926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300005467|Ga0070706_101392345All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005471|Ga0070698_101455962All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300005518|Ga0070699_100457626All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300005535|Ga0070684_100382679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1296Open in IMG/M
3300005549|Ga0070704_101443233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300005559|Ga0066700_10327555All Organisms → cellular organisms → Bacteria → Acidobacteria1081Open in IMG/M
3300005564|Ga0070664_101435396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300005617|Ga0068859_101119661All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300005618|Ga0068864_100616436All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300005618|Ga0068864_100710164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8983Open in IMG/M
3300005618|Ga0068864_101768341All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005713|Ga0066905_100140909All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1720Open in IMG/M
3300005764|Ga0066903_108785915All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300005843|Ga0068860_100651208All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300005844|Ga0068862_100519122Not Available1133Open in IMG/M
3300005844|Ga0068862_100727280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium964Open in IMG/M
3300006034|Ga0066656_10263240All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300006051|Ga0075364_10847067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300006058|Ga0075432_10225725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300006195|Ga0075366_11020581All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300006353|Ga0075370_10933520Not Available531Open in IMG/M
3300006797|Ga0066659_11888315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300006846|Ga0075430_101415505All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006852|Ga0075433_11462071All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300006853|Ga0075420_100158674All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300006871|Ga0075434_101222015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300006871|Ga0075434_101235635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300006880|Ga0075429_100363667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1267Open in IMG/M
3300006894|Ga0079215_10870487All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria641Open in IMG/M
3300006894|Ga0079215_11006067All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300006903|Ga0075426_10083203All Organisms → cellular organisms → Bacteria2288Open in IMG/M
3300006904|Ga0075424_101149279All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300006904|Ga0075424_102389079All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300006954|Ga0079219_10680715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium776Open in IMG/M
3300006969|Ga0075419_11052283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300009012|Ga0066710_103110305All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300009012|Ga0066710_104161071All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.541Open in IMG/M
3300009038|Ga0099829_10712962All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009084|Ga0105046_11235514All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300009094|Ga0111539_10682438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata1196Open in IMG/M
3300009100|Ga0075418_12462520All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300009111|Ga0115026_11789431All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300009147|Ga0114129_10303743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2126Open in IMG/M
3300009156|Ga0111538_11642322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300009156|Ga0111538_13438426Not Available550Open in IMG/M
3300009177|Ga0105248_12610834All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300009527|Ga0114942_1188919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300009610|Ga0105340_1243356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300009840|Ga0126313_10492682All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300010041|Ga0126312_10611242All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300010044|Ga0126310_10816070All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300010301|Ga0134070_10221463All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300010375|Ga0105239_11386308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300010399|Ga0134127_11387584All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300010400|Ga0134122_12318450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300010401|Ga0134121_12905595All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300010403|Ga0134123_12277518Not Available605Open in IMG/M
3300011119|Ga0105246_11723451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300011269|Ga0137392_11057021All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300011444|Ga0137463_1135192All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
3300012096|Ga0137389_11200607All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300012096|Ga0137389_11399751Not Available595Open in IMG/M
3300012179|Ga0137334_1141674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300012189|Ga0137388_11962871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300012204|Ga0137374_10017843All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis8111Open in IMG/M
3300012212|Ga0150985_114112019Not Available592Open in IMG/M
3300012212|Ga0150985_114449145All Organisms → cellular organisms → Bacteria → Acidobacteria3296Open in IMG/M
3300012360|Ga0137375_11460538All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.505Open in IMG/M
3300012680|Ga0136612_10062120All Organisms → cellular organisms → Bacteria1878Open in IMG/M
3300012684|Ga0136614_10505788All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300012893|Ga0157284_10167142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300012901|Ga0157288_10198234All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300012909|Ga0157290_10236183All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300012951|Ga0164300_10541763All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300012961|Ga0164302_11199105All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300012971|Ga0126369_12658219All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300012984|Ga0164309_11525617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300012984|Ga0164309_11731237All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300012985|Ga0164308_10397136All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300012985|Ga0164308_12224274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300012986|Ga0164304_11323843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300012987|Ga0164307_11638593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300013296|Ga0157374_10184307All Organisms → cellular organisms → Bacteria → Acidobacteria2040Open in IMG/M
3300013308|Ga0157375_10607712All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300014325|Ga0163163_11407318All Organisms → cellular organisms → Bacteria → Acidobacteria759Open in IMG/M
3300014325|Ga0163163_12904845All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300014326|Ga0157380_11971071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300014326|Ga0157380_13163720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300014745|Ga0157377_10209015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1243Open in IMG/M
3300014880|Ga0180082_1033263Not Available1073Open in IMG/M
3300014880|Ga0180082_1166876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300015196|Ga0167627_1077940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium878Open in IMG/M
3300015371|Ga0132258_10976356All Organisms → cellular organisms → Bacteria → Acidobacteria2140Open in IMG/M
3300015371|Ga0132258_12472246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1300Open in IMG/M
3300015372|Ga0132256_101314815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300015372|Ga0132256_102793133All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300015373|Ga0132257_101145901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium983Open in IMG/M
3300015373|Ga0132257_103849870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300015374|Ga0132255_101024114All Organisms → cellular organisms → Bacteria → Acidobacteria1239Open in IMG/M
3300015374|Ga0132255_101785076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium934Open in IMG/M
3300015374|Ga0132255_102390604All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300015374|Ga0132255_105196517All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300017654|Ga0134069_1274597All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300017965|Ga0190266_10232259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300018073|Ga0184624_10074488All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300018073|Ga0184624_10270856All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300018075|Ga0184632_10271879All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300018075|Ga0184632_10356539All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018082|Ga0184639_10648425All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300018429|Ga0190272_13126128Not Available514Open in IMG/M
3300018431|Ga0066655_10443236All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300018469|Ga0190270_10059402All Organisms → cellular organisms → Bacteria2714Open in IMG/M
3300018469|Ga0190270_10599157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1073Open in IMG/M
3300018476|Ga0190274_10502013All Organisms → cellular organisms → Bacteria → Acidobacteria1213Open in IMG/M
3300018476|Ga0190274_12504140Not Available613Open in IMG/M
3300018476|Ga0190274_13900179Not Available505Open in IMG/M
3300018481|Ga0190271_10191154All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300018481|Ga0190271_11438138Not Available807Open in IMG/M
3300018481|Ga0190271_12207441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300018481|Ga0190271_13278609Not Available543Open in IMG/M
3300018962|Ga0193589_1182008All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300019356|Ga0173481_10831357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300019361|Ga0173482_10248591All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300020020|Ga0193738_1061507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1119Open in IMG/M
3300020198|Ga0194120_10534840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium521Open in IMG/M
3300021078|Ga0210381_10272718All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300022756|Ga0222622_11308936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300022899|Ga0247795_1092164All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300024055|Ga0247794_10036635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata1296Open in IMG/M
3300025903|Ga0207680_11211394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300025910|Ga0207684_11055248All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300025913|Ga0207695_11041697All Organisms → cellular organisms → Bacteria → Proteobacteria698Open in IMG/M
3300025922|Ga0207646_10431990All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300025923|Ga0207681_10090497All Organisms → cellular organisms → Bacteria → Acidobacteria2184Open in IMG/M
3300025923|Ga0207681_10135828All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300025923|Ga0207681_11101500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300025925|Ga0207650_10186542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1655Open in IMG/M
3300025926|Ga0207659_11221575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300025931|Ga0207644_10177620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1667Open in IMG/M
3300025932|Ga0207690_10166951All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300025940|Ga0207691_10190079All Organisms → cellular organisms → Bacteria → Acidobacteria1791Open in IMG/M
3300025940|Ga0207691_10729328All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300025941|Ga0207711_11273207Not Available677Open in IMG/M
3300025945|Ga0207679_11026934All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300025972|Ga0207668_10999976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300025972|Ga0207668_11584006Not Available591Open in IMG/M
3300025972|Ga0207668_12149449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300025981|Ga0207640_10164857All Organisms → cellular organisms → Bacteria → Acidobacteria1644Open in IMG/M
3300026023|Ga0207677_11216536All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8690Open in IMG/M
3300026035|Ga0207703_11286169All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300026041|Ga0207639_11195417All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300026088|Ga0207641_12237633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8547Open in IMG/M
3300026089|Ga0207648_10921415Not Available817Open in IMG/M
3300026116|Ga0207674_10587435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1076Open in IMG/M
3300026142|Ga0207698_10294396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1508Open in IMG/M
3300026306|Ga0209468_1079999All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300027462|Ga0210000_1047668All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300027614|Ga0209970_1053482All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300027639|Ga0209387_1017703All Organisms → cellular organisms → Bacteria → Acidobacteria1347Open in IMG/M
3300027826|Ga0209060_10384857All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300027850|Ga0209591_10730245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300027886|Ga0209486_10786338Not Available621Open in IMG/M
3300028379|Ga0268266_11387716All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8678Open in IMG/M
3300028379|Ga0268266_12160331Not Available529Open in IMG/M
3300028608|Ga0247819_10734159All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300028802|Ga0307503_10948081All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300028819|Ga0307296_10824252All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300030606|Ga0299906_11326533All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031366|Ga0307506_10014552All Organisms → cellular organisms → Bacteria → Acidobacteria1827Open in IMG/M
3300031455|Ga0307505_10131158All Organisms → cellular organisms → Bacteria → Acidobacteria1137Open in IMG/M
3300031538|Ga0310888_10500104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300031547|Ga0310887_10566331All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300031562|Ga0310886_10233866All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300031854|Ga0310904_10479010All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300031858|Ga0310892_10903089All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031892|Ga0310893_10459500All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031901|Ga0307406_10945599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300031908|Ga0310900_10386224All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300031940|Ga0310901_10535501All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031996|Ga0308176_11805060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8653Open in IMG/M
3300032000|Ga0310903_10093253All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300032002|Ga0307416_100879411All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.995Open in IMG/M
3300032002|Ga0307416_101465643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium788Open in IMG/M
3300032003|Ga0310897_10170210All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300032003|Ga0310897_10471076All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300032003|Ga0310897_10713497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300032074|Ga0308173_10735849All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis903Open in IMG/M
3300032122|Ga0310895_10335008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300032179|Ga0310889_10079148All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300033412|Ga0310810_10635187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1014Open in IMG/M
3300033412|Ga0310810_10892464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300033413|Ga0316603_11869761All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300033418|Ga0316625_100769012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300034157|Ga0370506_108512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.06%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.25%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.44%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.03%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.03%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.22%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.22%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.22%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.22%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.63%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.41%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.41%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.41%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.41%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.41%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.41%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.41%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.41%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.41%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.41%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Rice-Straw Enriched CompostEngineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost0.41%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.81%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005286Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1EngineeredOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009084Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300015196Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018962Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 3 min after wetting v1EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027850Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300034157Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MRS1b_0302.000004302162886011Miscanthus RhizosphereVTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF
E41_056879802170459005Grass SoilNLPYDANGNLIASRSLPRGAGFGVANAYQNARTVQVQIRFTF
F24TB_1140604913300000550SoilALNLPFDAAGNLIPSRSLPKNAGFGVANAYQGPRTVQGQIRFSF*
F14TC_10602083313300000559SoilGNVIDARSRPRGAGFGVATAYQDPRTMQLQLRVSF*
JGI10216J12902_10685913813300000956SoilDPVTATNLPYDANGNLIASRSLPRGAGFGVANAYQAPRQVQLQIRFRF*
JGI10216J12902_11175443413300000956SoilDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQAPRQVQLQIRFRF*
JGIcombinedJ13530_10657726113300001213WetlandPFDSSGNLIVSRSQPKNAGFGVANGYQGARTIQAQLRFYF*
JGIcombinedJ13530_10843147213300001213WetlandTTPTTITNLPGVDANGYPIRSTPRTAGFGVATTYQSARSIQLTARFNF*
C688J18823_1042499423300001686SoilPVSATNLPFDANGNVIDSRSRPRGAGFGVANAYQNPRTVQAQIRFSF*
JGI24752J21851_105359613300001976Corn, Switchgrass And Miscanthus RhizosphereSTPNTITNLPYDASGNPIDSRSKPRGAGFGVATAYQTPRAIQLTARFNF*
JGI24036J26619_1008104813300002128Corn, Switchgrass And Miscanthus RhizosphereYDAAGNLIPARAIPSTAGFGVATNAADPRRVQVQIRFQF*
JGI24036J26619_1010415423300002128Corn, Switchgrass And Miscanthus RhizosphereDPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF*
JGI24034J26672_1004096613300002239Corn, Switchgrass And Miscanthus RhizosphereLPFDAAGNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF*
JGI24742J22300_1011639913300002244Corn, Switchgrass And Miscanthus RhizosphereNLPFDAAGNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF*
Ga0062593_10172188513300004114SoilNTTMQLANPNAPGAITNLPYDADGNLITSRSLPRGAGFGVATQYQSPRTVQGQVRFVF*
Ga0062593_10314215313300004114SoilATMSLLSPANPVDIQNLPFDANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF*
Ga0063455_10116589023300004153SoilATNLPYDANGNLVASRSLPRGAGFGVATAYQTPRQVQVQVRFRF*
Ga0062589_10109145023300004156SoilLPYDASGNVIDARSRPRGAGFGVATQYQTPRAIQLTARFNF*
Ga0062589_10257726623300004156SoilSDPVNATNLPFDSSGNVVQSRALPRGAGFGVANAYQNPRTVQLQVRFSF*
Ga0062590_10040362023300004157SoilTVNLSDPTNPVTANNLPFDAAGNLIAARALPRSAGFGVANNYQAPRAMQAQIRFSF*
Ga0062591_10085586123300004643SoilASFSSQADPITLQNSPFDANGNLIASRSLPRGAGFGVANNYQAPRNVQLQVRFSF*
Ga0062591_10115093313300004643SoilPSAPNVITNLPFDAAGNVVETRSRPRGAGFGVATDYQDPRTMQFQLRFSF*
Ga0062594_10140169713300005093SoilSSPTDPTPVNLPYDANGNTVTSRSLPKNAGFGVASGYQSPRTIQAQIRFSF*
Ga0062594_10163260213300005093SoilVTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF*
Ga0062594_10170092523300005093SoilNLPFDANGNLIVARSLPRGAGFGVANAYQAPRSVQVQLRFSF*
Ga0062594_10245625223300005093SoilATNLPFDANGNLIASRSLPRGAGFGVANAYQAPRTIQAQIRFSF*
Ga0062594_10308343923300005093SoilAITNLPVDASGNVIDSRSRPRGAGFGVATDYQNPRAVQMQIRFSF*
Ga0062594_10317584923300005093SoilQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF*
Ga0066680_1028219713300005174SoilLVNPTDPVTATNLPFDADGNLIDARARPRSAGFGVATGYQAARTIQAQLRFSF*
Ga0065721_1040393223300005286Rice-Straw Enriched CompostTMNLSNPLNPTTINNLPSDENGQLIDARSRPRSAGFGVASAYQTPRTVQLQVRFTF*
Ga0070676_1018388613300005328Miscanthus RhizosphereLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF*
Ga0070689_10011168713300005340Switchgrass RhizosphereMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF*
Ga0070689_10096495023300005340Switchgrass RhizosphereTMNLSNPGDPTTITNLPYDAAGNVIAARATPRGNGFGVATGFQSPRNLQAQIRFSF*
Ga0070661_10185003013300005344Corn RhizosphereYDSSGNLIPTLSLPRNAGFGVATAYQNPRSVQVQIRFTF*
Ga0070671_10041531313300005355Switchgrass RhizosphereYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF*
Ga0070674_10106894813300005356Miscanthus RhizosphereNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF*
Ga0070688_10017036623300005365Switchgrass RhizosphereITNLPYDASGNLIPTLSLPRNAGFGVATAYQVPRSVQAQIRFVF*
Ga0070688_10166656823300005365Switchgrass RhizosphereSAPNVITNLPFDAAGNVVETRSRPRGAGFGVATDYQDPRTMQFQLRFSF*
Ga0070659_10074909423300005366Corn RhizosphereVTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRF
Ga0070713_10193639613300005436Corn, Switchgrass And Miscanthus RhizosphereTPAAAATITNLPYDANGNLIPSLTLPRSAGFGVATAYQTPRAVQVQIRFSF*
Ga0070705_10127874723300005440Corn, Switchgrass And Miscanthus RhizosphereNRNSPQNLPYDANGNLIASRSLPRGAGFGVANNYQNARSVQVQVRFSF*
Ga0070700_10191105923300005441Corn, Switchgrass And Miscanthus RhizosphereDPAAITNLPFDAAGNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF*
Ga0070708_10227243623300005445Corn, Switchgrass And Miscanthus RhizosphereTSPNDPVTPQNLPFDANGNLIASRSLPRGAGFGVANNYQNARSVQGQVRFSF*
Ga0070678_10043664223300005456Miscanthus RhizosphereRNTTVNYNNPTDPITATNLPYDASGNVVASRSQPKNAGFGVATTYQTPRQVQLQIRFRF*
Ga0070662_10147512223300005457Corn RhizosphereNPVDIQNLPFDANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF*
Ga0070681_1098196113300005458Corn RhizosphereYDANGNVIDSRSRPRGAGFGVANAYQNPRNLQAQIRFSF*
Ga0068867_10200043413300005459Miscanthus RhizosphereFDANGNLVASRSLPSNAGFGVANAYQAPRTVQAQIRFSF*
Ga0070685_1084592623300005466Switchgrass RhizosphereFANPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF*
Ga0070706_10139234513300005467Corn, Switchgrass And Miscanthus RhizosphereFDADGNLIDSRSRPRGAGFGVATGYQAPRSVQVQARFSF*
Ga0070698_10145596213300005471Corn, Switchgrass And Miscanthus RhizosphereDPLTVVNLPFLADGSLNPARSLPKNAGFGVANVYQNPRTIQAQIRFSF*
Ga0070699_10045762613300005518Corn, Switchgrass And Miscanthus RhizosphereVITNLPFDASGNVIDSRSRPRGAGFGVATGYQDPRTMQLQVRFSF*
Ga0070684_10038267923300005535Corn RhizosphereNTTMTLASPTDPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF*
Ga0070704_10144323323300005549Corn, Switchgrass And Miscanthus RhizosphereTNLPVDASGNVIDSRSRPRGAGFGVATDYQNPRAVQMQIRFSF*
Ga0066700_1032755523300005559SoilVTATNLPFDANGNLSVSRSLPRGAGFGVATAYQPARTMQIQVRFSF*
Ga0070664_10143539613300005564Corn RhizosphereVSLASPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF*
Ga0068859_10111966113300005617Switchgrass RhizosphereVTPQNLPFNGAGDLILSRSLPRGAGFGVANNYQNPRTVQVQVRFSF*
Ga0068864_10061643613300005618Switchgrass RhizosphereNVVDARSRPRGAGFGVASAYQSPRTMQAQIRFAF*
Ga0068864_10071016423300005618Switchgrass RhizosphereITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF*
Ga0068864_10176834113300005618Switchgrass RhizosphereNTSSGAAATITNLPYDANGNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF*
Ga0066905_10014090913300005713Tropical Forest SoilLPYDAAGNVIASRSLPKNAGFGVANAYQNPRTLQAQIRFTF*
Ga0068861_10011597613300005719Switchgrass RhizosphereSVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF*
Ga0066903_10878591513300005764Tropical Forest SoilITPTNLPVDANGRLIDSRSRPRGAGFGVATGFQPPRTVQIQLRLSF*
Ga0068860_10065120823300005843Switchgrass RhizosphereGNPGNATNLPFDPAGNLIPARAIPRGAGFGVANNYQAPRSVQLQIRFSF*
Ga0068860_10218050623300005843Switchgrass RhizosphereASPSDPVTVTNLPFDAAGNVIATRSTPKNPGFGIATGYQPPRTMQLQARFSF*
Ga0068862_10051912223300005844Switchgrass RhizosphereNLKGDFSDPASIQNLPFDAAGNIIEGLSKPRGAGFGVATGYQTPRSLQMQARFSF*
Ga0068862_10072728013300005844Switchgrass RhizospherePLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF*
Ga0066656_1026324013300006034SoilGNIVDARARPRGAGFGVATGYQDPRTMQMQLRISF*
Ga0075364_1084706713300006051Populus EndosphereNGNLIPSLSLPRGAGFGVATGYQDPRTLQLQLRFQF*
Ga0075432_1022572523300006058Populus RhizosphereVITNLPFDAAGNVIDARSRPRGAGFGVATEYQLPRTVQLQVRVAF*
Ga0075366_1102058113300006195Populus EndosphereASQATAGSPTNLPFDAQGNLIDGRSKPRGAGLGVASAYQGPRTVQAQVRFSF*
Ga0075370_1093352013300006353Populus EndosphereASPNDPVTITNLPYDPATGAVVDSRSRPRGAGFGVATGYQAPRSVQALVRFSF*
Ga0066659_1188831523300006797SoilATNLPFDANGNLVVSRSLPRGAGFGVANAYQPARNMQVQVRFSF*
Ga0075430_10141550523300006846Populus RhizospherePFDAAGNLIPARSLPRGAGFGVATNYQAARSVQVQIRFSF*
Ga0075433_1146207113300006852Populus RhizosphereDLATGAVIDARSRPRGAGAGVATAYQNPRTVQAQVRVSF*
Ga0075420_10015867433300006853Populus RhizosphereASGNVIDARARPNGAGFGVATDYQAPRTLQLQARFSF*
Ga0075434_10122201513300006871Populus RhizosphereRNATINLSNPNDPVTATNLPFDANGNLIASRSLPRGAGFGVATGYQPPRNMQVQVRFSF*
Ga0075434_10123563523300006871Populus RhizosphereNTVITNLPFDASGNVIDSRSRPRGAGFGVATVYQDPRTMQLQVRFSF*
Ga0075434_10137181823300006871Populus RhizosphereTMNLSNPNDPSTITNLPFDANGNVIDSRSRPRGAGFGVATGYQNPRTVQMQIRFSF*
Ga0075429_10036366713300006880Populus RhizosphereGLHATNLPYDANGNVVAARSLPRGAGFGVATAYQDPRTVQVQVRFSF*
Ga0079215_1087048723300006894Agricultural SoilPFDTAGNVVDARSRPRGAGFGVATGYQAARTLQLQARFSF*
Ga0079215_1100606723300006894Agricultural SoilPFDAATGAVIDSRSRPRGAGVGVATEYQTPRRIQLQVRFSF*
Ga0075426_1008320313300006903Populus RhizosphereASGNLIANRSQPKNAGFGVANNYQSPRTLQILLRLGF*
Ga0075424_10114927923300006904Populus RhizosphereSPLDQTVTNLPFDANGNLVASRSQPKNAGVGVANGYQGPRTVQAQIRFSF*
Ga0075424_10238907923300006904Populus RhizosphereTITNLPYDANGNALPSLSLPRNAGFGVATAYQTPRAVQVQIRFSF*
Ga0079303_1031793413300006930Deep SubsurfaceADGTLNASRLIPRNAGFGAVTGTVNPLTMQAQIRFSF*
Ga0079219_1068071513300006954Agricultural SoilDAGGNLIPSLSLPRNAGFGVATNYQVPRAVQAQIRVSF*
Ga0075419_1105228323300006969Populus RhizosphereQMASPATNTVITNLPFDASGNVIDSRSRPRGAGFGVATEYQAPRTMQLQVRFSF*
Ga0066710_10311030513300009012Grasslands SoilTVTNLPFDASGNLVASRSQPKNAGVGVANSYQAPRTLQAQIRFSF
Ga0066710_10416107113300009012Grasslands SoilMHDPNDPVTINNLAFDANGALIASRSLPQGAGFGVANNFQSARSIQGQLRLSF
Ga0099829_1071296213300009038Vadose Zone SoilVVLVRAIEGLDEVTARNLPFDASGNLISSLSLPRGAGFGVATAYQDPRTMQLQLRFQF*
Ga0105046_1123551423300009084FreshwaterFDASGVLIPSRSLPKNAGFGLATGYQGPRTLQGQIRFVF*
Ga0111539_1068243823300009094Populus RhizosphereDGSVIPARTVPRGAGFGVATAYQAPRTMQLQIRFMF*
Ga0075418_1246252023300009100Populus RhizosphereLANPNDPVTVTNLPFDAAGNLIESRSRPRGAGFGVANNYQAPRTVQAQFRLSF*
Ga0115026_1178943113300009111WetlandDANGNLIESRSQPKNAGFGVANGYQAPRSVQMQIRFSF*
Ga0114129_1030374343300009147Populus RhizosphereLSSPANPIDIQNLPFDANGNLIDSRSRPRGAGFGVATAYQGPRTLQLQARFAF*
Ga0111538_1164232213300009156Populus RhizosphereANGNLIDSRSRPRGAGFGVATAYQGPRTLQLQARFAF*
Ga0111538_1343842613300009156Populus RhizosphereTAPGTITNLPYDANGNLIPSLSVPRGAGFGVATGYQTPRSTQVQIRFAF*
Ga0105248_1261083423300009177Switchgrass RhizosphereDGTPANLPYDASGATVVSRSLPKNAGFGVANAYQAPRTLQVQIRFSF*
Ga0114942_118891913300009527GroundwaterTATNLPFDANGNLIESRSLPRNAGFGVANAYQTPRAMQLQLRFSF*
Ga0105340_124335623300009610SoilMASPATNSVITNLPFDAAGNVIDARSRPRGAGFGVATNYQDPRSMQLQIRVSF*
Ga0126313_1049268213300009840Serpentine SoilLTLSSPTDPVTPQNLPFDSSGNLIPARSLPRGAGFGVANAYQSPRTVQVQVRFSF*
Ga0126312_1061124223300010041Serpentine SoilDPTALNLPYDANGNVVVSRSLPKNAGFGAASGYQTPRTMQLQFRFSF*
Ga0126310_1081607013300010044Serpentine SoilQPTTIQNLPFDATGNLIDTLSRPRGAGFGVATNYQAPRTMQMQLRLSF*
Ga0134070_1022146313300010301Grasslands SoilATNLPYDADGKPVPSRQAPRTAGFGVANTYQAARTIQAQIRFSF*
Ga0105239_1138630813300010375Corn RhizosphereDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF*
Ga0134127_1138758413300010399Terrestrial SoilTDTTTITNLPYDLATGAVIDARSRPRGAGAGVATTYQNPRTVQAQVRISF*
Ga0134122_1231845013300010400Terrestrial SoilNLPFDASGNVIDTRSRPRGAGFGVATNYQDPRTMQLQVRFAF*
Ga0134121_1290559523300010401Terrestrial SoilVNLPYDASGNIVASRSLPKNAGFGVANAYQAPRTLQAQIRFSF*
Ga0134123_1227751813300010403Terrestrial SoilPVDAAGNVIDARSRPSGAGFGVATDYQSPRAIQLQARFAF*
Ga0105246_1172345123300011119Miscanthus RhizospherePYDANGNVVASRSQPKNAGFGVANAYQTPRQVQLQIRFRF*
Ga0137392_1105702113300011269Vadose Zone SoilLSNPNDPVTITNLPYLADGTLIPSRSRPRGAGVGVATDYQSPRRVQLQARVSF*
Ga0137463_113519213300011444SoilPANLPYDASGATVVSRSLPKNAGFGVASTYQAPRTMQVQIRFSF*
Ga0137389_1120060713300012096Vadose Zone SoilAFDASGNLIASRSLPKNAGFGVANGYQGPRTLQGQIRFSF*
Ga0137389_1139975123300012096Vadose Zone SoilPFDADGNLIATRSLPKNAGFGVANAYQGPRTVQGQIRFSF*
Ga0137334_114167413300012179SoilITGRNSTIAYTSPADPLTPQNLPYDASGNLIASRSIPRGAGFGVASGYQAARTIQFQVRFSF*
Ga0137388_1196287113300012189Vadose Zone SoilDASGNLIPSRSQPKNAGFGVANGYQGPRTLQAQIRFSF*
Ga0137374_1001784363300012204Vadose Zone SoilLSNPTDPVTPTNLPYDLKTGEVVANRSLPRNAGFGVANAYQAPRTIQAQVRFSF*
Ga0150985_11411201923300012212Avena Fatua RhizosphereGNLIESRSRPRGAGFGVATGYQSPRTMQMQVRFSF*
Ga0150985_11444914513300012212Avena Fatua RhizosphereLTNPSDPVTANNLPYDASGNVIDSRTVPRTAGFGVANAYQNQRTLPAQIRFSF*
Ga0137375_1146053823300012360Vadose Zone SoilNDPTTIANLPYDANGNVIDSRSRPRGAGFGVATAYQNPRTVQAQVRFSF*
Ga0136612_1006212023300012680Polar Desert SandVANPSDPKTITNLPFDANGNLIASRSLPRGAGFGVATGYQAPRSIQVQVGFQF*
Ga0136614_1050578823300012684Polar Desert SandDPVTITNLPYLADGTLNPARSRPRGAGVGVATNYQSPRRVQVQARFSF*
Ga0157284_1016714223300012893SoilMNTSIGLVNSPSTPNTITNLPYDASGNPIDSRSKPRGAGFGVATAYQTPRAIQLTARFNF
Ga0157288_1019823413300012901SoilGSVRPTFALPRGAGFGVATAYQAPRTMQFQIRFSF*
Ga0157290_1023618323300012909SoilVSEGANSYCYDANGNMVVTRSLPKNAGFGVANAYQAPRTMQLQLRFAF*
Ga0164300_1054176313300012951SoilATNLPFDASGNVVASRALPRGAGFGVANAYQSPRTIQLQVRFSF*
Ga0164302_1119910523300012961SoilGNLIDARSHPRGAGFGVATDYQAPRTMQLQLRISF*
Ga0126369_1265821913300012971Tropical Forest SoilPANLPYDASGNTVVARSLPKNAGFCVANTYQNPRTLQVQLRFSF*
Ga0164309_1152561723300012984SoilTSPNDPVTITNLPYDANGNLIASRSLPRGAGFGVANAYQNARTVQVQIRFTF*
Ga0164309_1173123713300012984SoilATNLPYNPDGSVNPTRSLPRNAGFGVANAYQSPRTIQMQLRFSF*
Ga0164308_1039713623300012985SoilFDASGAPIDSRSLPKNAGFGVANTYQSPRTIQAQIRFSF*
Ga0164308_1222427413300012985SoilVTAGNLPYDVNGNVVSSRTVPRTAGFGVANAYQNPLTLQAQIRFSF*
Ga0164304_1132384313300012986SoilITPQNLPYDAAGNLIASRSLPRGAGFGVANNYQNPRNIQFQVRYSF*
Ga0164307_1163859323300012987SoilVTAGNLPYDVNGNVVSSRTVPRTAGFGVANAYQNPRTLQAQIRFSF*
Ga0157374_1018430723300013296Miscanthus RhizosphereERVVTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF*
Ga0157375_1060771213300013308Miscanthus RhizosphereATPNDPNTIQNLPYDANGALIPSRSLPRGAGFGVANAYQAPRTVQIQVRFSF*
Ga0163163_1140731823300014325Switchgrass RhizosphereYDANGNLVASRSLPKNGGFGVATGFQSPRTLQAQVRFGF*
Ga0163163_1290484513300014325Switchgrass RhizosphereASGNVIPALSRPRGAGFGVATAYQSPRTMQAQIRFQF*
Ga0157380_1197107113300014326Switchgrass RhizosphereNGNVIDSRSRPRGAGFGVATDYQSPRALQMQIRLSF*
Ga0157380_1316372013300014326Switchgrass RhizosphereNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQAPRQVQLQIRFRF*
Ga0157377_1020901513300014745Miscanthus RhizosphereNLPYDANGNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF*
Ga0180082_103326313300014880SoilLPYDAAGNVIPSLSKPRGAGFGVATNYQTPRALQMQIRFSF*
Ga0180082_116687613300014880SoilTTMNLSNPTDPVTITNLPYDASGNLIPSRLRPRDAGFGVANAYISPRTVQAQIRFQF*
Ga0167627_107794013300015196Glacier Forefield SoilTMNLVSPIDQTVTNLPVDASGTLIASRSQPKNAGVGVANAYQGPRTLQAQIRFVF*
Ga0132258_1097635623300015371Arabidopsis RhizosphereVTITNLPFDANGNLIDTRSRPRGAGFGVATTYQNPRTVQAQIRFSF*
Ga0132258_1247224623300015371Arabidopsis RhizosphereANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF*
Ga0132256_10131481513300015372Arabidopsis RhizosphereIFASPATNTVITNLPYDASGNVVQSFAKPRGAGFGVATAYQSPRTMQAQIRFQF*
Ga0132256_10279313323300015372Arabidopsis RhizosphereTSPLDGTMVNLPYDATGATVASRSLPKNAGFGVATAYQAPRTLQAQIRFSF*
Ga0132257_10114590123300015373Arabidopsis RhizosphereQNLPYDQTTGDLIVSRSLPRGAGFGVANNYQNPRSIQMQVRFSF*
Ga0132257_10384987013300015373Arabidopsis RhizosphereLNNPSDPTTILNLPFDSAGNVVASRSRPRGAGFGVANGYQTPRQTQFTLRFAF*
Ga0132255_10102411423300015374Arabidopsis RhizosphereVAINAPFDASGNLVDSRSRPRGAGAGVATAYQDPRTMQIQLRFAF*
Ga0132255_10178507623300015374Arabidopsis RhizosphereATVSNLPFDAAGNLIASRSQPSNAGFGVANVYQNPRNVQMQIRFVF*
Ga0132255_10239060413300015374Arabidopsis RhizosphereDANGNLIPSLIVPRSAGFGVATSYQVPRSVQVQIRFSF*
Ga0132255_10519651713300015374Arabidopsis RhizosphereNLPYDASGNVVTGRSLPKNAGFGVANTYQNPRTVQAQIRFSF*
Ga0134069_127459713300017654Grasslands SoilNSVITNLPYDASGNVVQSFAKPRGAGFGVATAYQSPRTMQAQVRFAF
Ga0190266_1023225913300017965SoilQTARNLPFDASGNLIPSLSLPRGAGFGVATAYQDPRTLQIQIRFQF
Ga0184624_1007448813300018073Groundwater SedimentTMNLSNPTDPVTITNLPYDASGNLIPSRLRPRDAGFGVANAYISPRTVQAQIRFQF
Ga0184624_1027085613300018073Groundwater SedimentEPRNLVTLQNAPFDASGNLIASRSLPRGAGFGVANNYQAPRNIQLQVRFSF
Ga0184632_1027187923300018075Groundwater SedimentMPVSPASRADIQNLPFDASGNLRDAFSRPRGAGFGVATNYQAPRTMQGQIRFSF
Ga0184632_1035653923300018075Groundwater SedimentLPFDANGNLIDARSRPRGAGFGVATGYQTPRSVQAQVRFSF
Ga0184639_1064842513300018082Groundwater SedimentMQLPSPADPLNIQNLPFDANGNVVVARSLPRGAGFGVATNYQAPRTIQGQIRFSF
Ga0190272_1312612813300018429SoilTITNLPFDAAGNPIPERLRPSGAGFGVATGARALRSFQGQVRFSF
Ga0066655_1044323613300018431Grasslands SoilLPYDANGNLLPNRSLPKNAGFGVANAYQAARSMQAQIRFSF
Ga0190270_1005940213300018469SoilMNLSNPTDPVTITNLPYDASANLIPARLRPRDAGFGVANAYISPRTVQAQIRYQF
Ga0190270_1059915723300018469SoilTNLPFDAPGNLMDALSRPRGAGFGVANNYQAARSVQAQIRFTF
Ga0190274_1050201323300018476SoilLDGTMTNLPYDPVTGATVTSRSQPKNAGFGVATAYQAPRTLQAQIRFSF
Ga0190274_1250414013300018476SoilSMTLSSPSDPATISNLPYDASGNLIPSRSLPRGAGFGVATAYQAPRSVQLQVRFSF
Ga0190274_1390017913300018476SoilNGNLIPSLSVPRGAGFGVATGYQTPRSTQVQIRFAF
Ga0190271_1019115423300018481SoilPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF
Ga0190271_1143813813300018481SoilPVTITNLPFNPDGSLITSRSLPRGAGVGVATDYQNARTIQVQVRFSF
Ga0190271_1220744123300018481SoilTTVNFVNPSDPVTATNLPYDANGNLIVSRSLPRGAGFGVANAYQTPRQIQLQIRFRF
Ga0190271_1327860913300018481SoilTSRNSSITLSSPNDPVTPQNLPYDAAGNLIDARSRPRGAGFGVATNYQAPRSVQAQVRFS
Ga0193589_118200823300018962SoilNLTSPKDPVRATNLPFDADGNLVATRSFPRAAGFGVATNYQAPQSIQGQIRFSF
Ga0173481_1083135713300019356SoilPYDANGNVVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF
Ga0173482_1024859123300019361SoilDPVTITNLPYDANGNLITSRTRPRDAGFGVANAYMAPRTVQVQIRYQF
Ga0193738_106150713300020020SoilDAPGNLIPSRSLPRGAGFGVATGYQAPRSVQLQVRFSF
Ga0194120_1053484013300020198Freshwater LakeVSPVSQAVTNSPFDASGNLIPSRSQPKNAGLGVATAYQGPRNLQAQIRFVF
Ga0210381_1027271823300021078Groundwater SedimentITNLPYDASGNLIPSRLRPRDAGFGVANAYISPRTVQAQIRFQF
Ga0222622_1130893613300022756Groundwater SedimentFNPDGTVIDSRSRPRGAGFGVATGYQAPRTVQAQIRFSF
Ga0247795_109216423300022899SoilGNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF
Ga0247794_1003663523300024055SoilFNPDGSVIAARAVPRGAGFGVATAYQAPRTMQLQIRFMF
Ga0207680_1121139413300025903Switchgrass RhizosphereSPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLKAQIRFSF
Ga0207684_1105524813300025910Corn, Switchgrass And Miscanthus RhizosphereFDADGNLIDSRSRPRGAGFGVATGYQAPRSVQVQARFSF
Ga0207695_1104169713300025913Corn RhizosphereVSPVDPTAANLPYDASGAVVTSRSLPKNAGFGVANAYQPPRTVQAQIRFSF
Ga0207646_1043199013300025922Corn, Switchgrass And Miscanthus RhizosphereNGNLIPSRSRPRNAGFGVADNYQSPRSVQLQIRFRF
Ga0207681_1009049713300025923Switchgrass RhizosphereLASPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF
Ga0207681_1013582833300025923Switchgrass RhizospherePYDAAGNVIAARATPRGNGFGVATGFQSPRNLQAQIRFSF
Ga0207681_1110150013300025923Switchgrass RhizosphereQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF
Ga0207650_1018654223300025925Switchgrass RhizosphereGNVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF
Ga0207659_1122157523300025926Miscanthus RhizosphereSGNVIDARSRPRGAGFGVATDYQNPRTVQLQLRLAF
Ga0207644_1017762013300025931Switchgrass RhizosphereTLASPTDPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF
Ga0207690_1016695133300025932Corn RhizosphereNPVDIQNLPFDANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF
Ga0207691_1019007933300025940Miscanthus RhizosphereGNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF
Ga0207691_1072932813300025940Miscanthus RhizosphereADGSVIESRSLPRGAGFGVATAYQAPRSMQLQLRFMF
Ga0207711_1127320713300025941Switchgrass RhizosphereYDASGNTIDARSKPRGAGFGVATAYQTPRAIQLTARFNF
Ga0207679_1102693423300025945Corn RhizosphereNLPYDAAGNVIAARATPRGNGFGVATGFQSPRNLQAQIRFSF
Ga0207668_1099997613300025972Switchgrass RhizosphereTTITNLPYDANGNLIDSRSRPRGAGFGVANAYQPPRSIQLQLRYSF
Ga0207668_1158400623300025972Switchgrass RhizosphereLPYDANGNLIDSRSRPRDAGFGVATGYLNPRTVQLQIRFQF
Ga0207668_1214944913300025972Switchgrass RhizosphereNYNNPNDPVTATNLPYDANGNVVASRSQPKNAGFGVANAYQTPRQVQLQIRFRF
Ga0207640_1016485713300025981Corn RhizosphereSPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF
Ga0207677_1121653623300026023Miscanthus RhizosphereLASPTDPVTITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF
Ga0207703_1128616913300026035Switchgrass RhizosphereAATTITNLPYDASGTLIPSLAVPRSAGFGVATNYQVPRTVQAQIRFSF
Ga0207639_1119541723300026041Corn RhizosphereNGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF
Ga0207641_1223763323300026088Switchgrass RhizosphereMTLASPTDPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF
Ga0207648_1092141513300026089Miscanthus RhizosphereETPTVAINAPFDASGNLVDSRSRPRGAGAGVATAYQDPRTMQIQLRFAF
Ga0207674_1058743513300026116Corn RhizosphereITNLPYDANGNVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF
Ga0207698_1029439613300026142Corn RhizosphereNPFDPVTAGNLPYDVHGNVVSSRTVPRTAGFGVANAYQNPRTLQAQIRFSF
Ga0209468_107999923300026306SoilNGNTVVSRSLPKNAGFGVANAYQAPRTLQAQIRFSF
Ga0210000_104766823300027462Arabidopsis Thaliana RhizosphereLPYDSNGNTVVARSLPKNAGFGVANAYQAPRTMQLQLRFAF
Ga0209970_105348223300027614Arabidopsis Thaliana RhizosphereMNLTNPNDPVTITNLPYDASGNLIPSRLRPRDAGFGVANAYIAPRTVQAQIRFQF
Ga0209387_101770313300027639Agricultural SoilNPADPTTITNLPFDANGNVIDSRSRPRGAGFGVATGYQAPRNVQVQVRFSF
Ga0209060_1038485723300027826Surface SoilNLPYDATGNPIPALSTPRGNGFGVATGFQSPRSVQAQIRFSF
Ga0209591_1073024513300027850FreshwaterTNLPFDASGVLIPSRSLPKNAGFGLATGYQGPRTLQGQIRFVF
Ga0209486_1078633813300027886Agricultural SoilTNLPFDASGNLIDSRSRPRDAGFGVATGYLNPRTVQAQIRFQF
Ga0268266_1138771623300028379Switchgrass RhizospherePYDANGNVIPARAIPSGAGFGVATVYQNPRTVQALVRFSF
Ga0268266_1216033123300028379Switchgrass RhizosphereFDSSGAVVASRSLPKNAGFGVANTYQAPRTVQAQIRFSF
Ga0247819_1073415913300028608SoilITNLPYDAKGNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF
Ga0307503_1094808123300028802SoilAAAATTITNLPYDANGNLIPTLSLPRNAGFGVATNYQVPRSVQFQIRFSF
Ga0307296_1082425213300028819SoilSGNVIAARATPAGAGFGVATDYQPPRTIQLQARFSF
Ga0299906_1132653323300030606SoilPSAITNLPFDADGNLIESRSRPRGAGFGVADGFQAPRTLQLQARFQF
Ga0307506_1001455213300031366SoilDAGGNLIANRSLPRNAGFGVANAYQAPRQVQLQLRFRF
Ga0307505_1013115813300031455SoilDAQGNVIESRSRPRGAGFGVATGYQAPRTVQLQARFSF
Ga0310888_1050010423300031538SoilQTTANFNNPGDPVTVTNLPYDAEGNLIAARSLPRGAGFGVANAYQAARNIQIQVRFSF
Ga0310887_1056633113300031547SoilTNLPFDANGNVVDARARPRGAGFGVATGYQDPRTMQMQLRIAF
Ga0310886_1023386623300031562SoilDGSVIESRSLPRGAGFGVATAYQAPRSMQLQLRFMF
Ga0310904_1047901033300031854SoilNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF
Ga0310892_1090308923300031858SoilLPYDAAGNLIPTLSLPRNAGFGVATAYQNPRSVQVQIRFAF
Ga0310893_1045950023300031892SoilNTTISFVNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF
Ga0307406_1094559913300031901RhizospherePATGAVVDSRSRPRGAGVGVATTYQAPRSVQALVRFSF
Ga0310900_1038622423300031908SoilSPSTITNLPFDAQGNLIDALSKPRGAGFGVANNYQAARSVQVQIRFTF
Ga0310901_1053550113300031940SoilDANGNVVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF
Ga0308176_1180506023300031996SoilASPTDPVTITNLPYDANGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF
Ga0310903_1009325333300032000SoilMNMASPSTPNTITNLPYDASGNPIDSRSKPRGAGFGVATAYQTPRAIQLTARFNF
Ga0307416_10087941113300032002RhizosphereNMNLASPDNPSVTNLPFDANGNLIAARSLPRGAGFGVATDYQAPRSVQLQIRFSF
Ga0307416_10146564313300032002RhizosphereVDIQNLPYDSNGNIIESRSRPRGAGFGVATGYQAPRTLQLQARFAF
Ga0310897_1017021023300032003SoilTTATNLPFDANGNVVDARARPRGAGFGVATDYQDPRTMQMQLRISF
Ga0310897_1047107613300032003SoilTTATNLPFDANGNVVDARARPRGAGFGVATGYQDPRTMQMQLRIAF
Ga0310897_1071349713300032003SoilFVNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF
Ga0308173_1073584913300032074SoilPTDPVTATNLPYDASGNVVASRSQPKNAGFGVATAYQTPRQVQLQIRFRF
Ga0310895_1033500813300032122SoilDPVTVTNLPYDAEGNLIAARSLPRGAGFGVANAYQAARNIQIQVRFSF
Ga0310889_1007914813300032179SoilVNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF
Ga0310810_1063518713300033412SoilLPYDSSGNLIPTLSLPRNAGFGVATAYQNPRSVQVQIRFTF
Ga0310810_1089246423300033412SoilAASTITNLPYDANGNLIPTLSLPRNAGFGVATNYQVPRTVQAQIRFSF
Ga0316603_1186976123300033413SoilNLPFNADGTVNPNRNLPKNAGFGVASAYQLPRRVQVQVRFSF
Ga0316625_10076901213300033418SoilSTITNLPYDANGNVIESRSKPRGAGFGVATAYQTPRSIQLTARFSF
Ga0370506_108512_1_1413300034157Untreated Peat SoilATITNLPFDAAGNLIDSRSRPRGAGFGVATGYQTARSLQLQARLSF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.