NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016299

Metagenome / Metatranscriptome Family F016299

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016299
Family Type Metagenome / Metatranscriptome
Number of Sequences 248
Average Sequence Length 46 residues
Representative Sequence PLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQQAGA
Number of Associated Samples 204
Number of Associated Scaffolds 248

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.02 %
% of genes near scaffold ends (potentially truncated) 98.39 %
% of genes from short scaffolds (< 2000 bps) 93.55 %
Associated GOLD sequencing projects 195
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.581 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.887 % of family members)
Environment Ontology (ENVO) Unclassified
(32.258 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.984 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.89%    β-sheet: 0.00%    Coil/Unstructured: 61.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 248 Family Scaffolds
PF07040DUF1326 49.19
PF13231PMT_2 4.03
PF01315Ald_Xan_dh_C 3.23
PF02543Carbam_trans_N 2.82
PF13654AAA_32 2.42
PF02738MoCoBD_1 2.42
PF00076RRM_1 1.61
PF01266DAO 1.21
PF01478Peptidase_A24 0.81
PF00753Lactamase_B 0.81
PF09948DUF2182 0.81
PF07811TadE 0.40
PF01522Polysacc_deac_1 0.40
PF02771Acyl-CoA_dh_N 0.40
PF00043GST_C 0.40
PF08803ydhR 0.40
PF01717Meth_synt_2 0.40
PF02668TauD 0.40
PF13400Tad 0.40
PF00239Resolvase 0.40
PF00296Bac_luciferase 0.40
PF13649Methyltransf_25 0.40
PF11306DUF3108 0.40
PF07883Cupin_2 0.40
PF00881Nitroreductase 0.40
PF13366PDDEXK_3 0.40
PF1699817kDa_Anti_2 0.40
PF02515CoA_transf_3 0.40
PF00924MS_channel 0.40

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 248 Family Scaffolds
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 49.19
COG2192Predicted carbamoyl transferase, NodU familyGeneral function prediction only [R] 2.82
COG0435Glutathionyl-hydroquinone reductaseEnergy production and conversion [C] 0.40
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.40
COG0625Glutathione S-transferasePosttranslational modification, protein turnover, chaperones [O] 0.40
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.40
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.40
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.40
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.40
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.40
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.40
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.40
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.40
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.40


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.58 %
UnclassifiedrootN/A2.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_104948919All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300002568|C688J35102_118038043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300004082|Ga0062384_100644908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300004091|Ga0062387_100504807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria845Open in IMG/M
3300004152|Ga0062386_101550337Not Available552Open in IMG/M
3300004633|Ga0066395_10383622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria788Open in IMG/M
3300005093|Ga0062594_102266809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300005171|Ga0066677_10745241All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300005175|Ga0066673_10098632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1565Open in IMG/M
3300005176|Ga0066679_10472888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria819Open in IMG/M
3300005176|Ga0066679_10551743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium751Open in IMG/M
3300005178|Ga0066688_10134677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1537Open in IMG/M
3300005179|Ga0066684_10355986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria980Open in IMG/M
3300005184|Ga0066671_10975658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300005187|Ga0066675_10096932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1938Open in IMG/M
3300005332|Ga0066388_101735413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1106Open in IMG/M
3300005332|Ga0066388_102007979All Organisms → cellular organisms → Bacteria → Proteobacteria1037Open in IMG/M
3300005332|Ga0066388_102112055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1014Open in IMG/M
3300005337|Ga0070682_101801665All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005436|Ga0070713_100117073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2331Open in IMG/M
3300005458|Ga0070681_10174054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2074Open in IMG/M
3300005458|Ga0070681_11132051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae704Open in IMG/M
3300005458|Ga0070681_11717976Not Available554Open in IMG/M
3300005547|Ga0070693_100987280All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005548|Ga0070665_102216693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300005559|Ga0066700_11070768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300005562|Ga0058697_10234787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria847Open in IMG/M
3300005568|Ga0066703_10230508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1126Open in IMG/M
3300005576|Ga0066708_10294421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1038Open in IMG/M
3300005577|Ga0068857_100434775All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300005591|Ga0070761_10615004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300005764|Ga0066903_101399832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1314Open in IMG/M
3300005764|Ga0066903_108822696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300005764|Ga0066903_109055735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300005842|Ga0068858_100397454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1324Open in IMG/M
3300005842|Ga0068858_101858909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300005903|Ga0075279_10019034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium977Open in IMG/M
3300006028|Ga0070717_11766742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300006034|Ga0066656_10588606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300006175|Ga0070712_101236677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria650Open in IMG/M
3300006237|Ga0097621_101719530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300006755|Ga0079222_11167537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300006797|Ga0066659_10648965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium859Open in IMG/M
3300006797|Ga0066659_11419871All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300006804|Ga0079221_10447060All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300006893|Ga0073928_10870070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300006914|Ga0075436_100908092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300006954|Ga0079219_10049379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1802Open in IMG/M
3300007788|Ga0099795_10332235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300007821|Ga0104323_131873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales6153Open in IMG/M
3300009012|Ga0066710_103121265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300009012|Ga0066710_104794036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300009038|Ga0099829_11174062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300009143|Ga0099792_10214906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1101Open in IMG/M
3300009525|Ga0116220_10097020All Organisms → cellular organisms → Bacteria → Proteobacteria1247Open in IMG/M
3300009545|Ga0105237_12041729All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300009792|Ga0126374_10525313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria858Open in IMG/M
3300010043|Ga0126380_12229635All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010048|Ga0126373_11585558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300010049|Ga0123356_11478989All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. AW1837Open in IMG/M
3300010152|Ga0126318_10805518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1097Open in IMG/M
3300010320|Ga0134109_10452021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300010358|Ga0126370_10899819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria799Open in IMG/M
3300010360|Ga0126372_10873634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria899Open in IMG/M
3300010360|Ga0126372_11704931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300010361|Ga0126378_10635726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1181Open in IMG/M
3300010369|Ga0136643_10646099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium653Open in IMG/M
3300010376|Ga0126381_101525437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria966Open in IMG/M
3300010376|Ga0126381_104113396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300010376|Ga0126381_104147585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300010376|Ga0126381_104274947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300010391|Ga0136847_13427067All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300010396|Ga0134126_12886950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300010398|Ga0126383_13451743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300011120|Ga0150983_15057169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium683Open in IMG/M
3300011269|Ga0137392_10376212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1178Open in IMG/M
3300011270|Ga0137391_11443598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria534Open in IMG/M
3300011444|Ga0137463_1149737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria878Open in IMG/M
3300012202|Ga0137363_11757809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300012202|Ga0137363_11775265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300012205|Ga0137362_10373230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1236Open in IMG/M
3300012209|Ga0137379_10190244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1965Open in IMG/M
3300012212|Ga0150985_115849004All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300012285|Ga0137370_10220809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1116Open in IMG/M
3300012357|Ga0137384_11314283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300012359|Ga0137385_10508380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1019Open in IMG/M
3300012361|Ga0137360_11172222All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300012362|Ga0137361_10259969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1583Open in IMG/M
3300012362|Ga0137361_10496902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1120Open in IMG/M
3300012469|Ga0150984_118721597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300012923|Ga0137359_10042994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3916Open in IMG/M
3300012923|Ga0137359_10552138All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300012923|Ga0137359_11372857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium595Open in IMG/M
3300012927|Ga0137416_11566092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300012960|Ga0164301_10514797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium866Open in IMG/M
3300012971|Ga0126369_11525388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300012971|Ga0126369_12557356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300014497|Ga0182008_10039146All Organisms → cellular organisms → Bacteria2370Open in IMG/M
3300014501|Ga0182024_11857916All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300015371|Ga0132258_12731151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1231Open in IMG/M
3300016294|Ga0182041_10029619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3484Open in IMG/M
3300016294|Ga0182041_11284405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300016319|Ga0182033_10396506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1165Open in IMG/M
3300016341|Ga0182035_10789190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria833Open in IMG/M
3300016341|Ga0182035_11631504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300016371|Ga0182034_10144060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1780Open in IMG/M
3300016371|Ga0182034_10878964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria770Open in IMG/M
3300016404|Ga0182037_10196066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1563Open in IMG/M
3300016422|Ga0182039_10513790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1036Open in IMG/M
3300016422|Ga0182039_11768952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300016445|Ga0182038_12171011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300017944|Ga0187786_10649923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium501Open in IMG/M
3300017961|Ga0187778_10210342All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300018001|Ga0187815_10295319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1687Open in IMG/M
3300018433|Ga0066667_10958659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium737Open in IMG/M
3300018468|Ga0066662_12557595All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300018468|Ga0066662_12744048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300020580|Ga0210403_10177456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1746Open in IMG/M
3300020580|Ga0210403_10424124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1085Open in IMG/M
3300020581|Ga0210399_10125797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2109Open in IMG/M
3300020583|Ga0210401_10551338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1015Open in IMG/M
3300020583|Ga0210401_10572997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria990Open in IMG/M
3300020583|Ga0210401_10620466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales943Open in IMG/M
3300021088|Ga0210404_10090375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1526Open in IMG/M
3300021168|Ga0210406_10612672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria848Open in IMG/M
3300021170|Ga0210400_10359910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1198Open in IMG/M
3300021178|Ga0210408_11034798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300021178|Ga0210408_11224082All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium572Open in IMG/M
3300021180|Ga0210396_11217962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300021372|Ga0213877_10170385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria696Open in IMG/M
3300021374|Ga0213881_10010478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3792Open in IMG/M
3300021401|Ga0210393_10200255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1614Open in IMG/M
3300021402|Ga0210385_11306176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300021403|Ga0210397_10356732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1085Open in IMG/M
3300021403|Ga0210397_11071137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300021407|Ga0210383_10344578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1284Open in IMG/M
3300021432|Ga0210384_11770895Not Available523Open in IMG/M
3300021559|Ga0210409_10106116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2589Open in IMG/M
3300021560|Ga0126371_11572401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria784Open in IMG/M
3300022522|Ga0242659_1079025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300022532|Ga0242655_10092916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium817Open in IMG/M
3300022557|Ga0212123_10484894Not Available806Open in IMG/M
3300022714|Ga0242671_1058627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria657Open in IMG/M
3300022717|Ga0242661_1022999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1021Open in IMG/M
3300022718|Ga0242675_1064877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria641Open in IMG/M
3300025906|Ga0207699_10672684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria757Open in IMG/M
3300025915|Ga0207693_10202047All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300025915|Ga0207693_10713512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300025921|Ga0207652_11726570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300025929|Ga0207664_10469959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1124Open in IMG/M
3300026035|Ga0207703_12147417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300026322|Ga0209687_1274332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300026356|Ga0257150_1016425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1025Open in IMG/M
3300026359|Ga0257163_1079577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300026547|Ga0209156_10063941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1905Open in IMG/M
3300026551|Ga0209648_10349673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1017Open in IMG/M
3300026552|Ga0209577_10104945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2284Open in IMG/M
3300027035|Ga0207776_1041711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300027174|Ga0207948_1019309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria802Open in IMG/M
3300027313|Ga0207780_1048997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria724Open in IMG/M
3300027698|Ga0209446_1004173All Organisms → cellular organisms → Bacteria → Proteobacteria3544Open in IMG/M
3300027829|Ga0209773_10045267All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300027869|Ga0209579_10129645All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300027875|Ga0209283_10375127All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300027875|Ga0209283_10708117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300027898|Ga0209067_10541683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300028379|Ga0268266_11944562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300028906|Ga0308309_10330949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1295Open in IMG/M
3300029636|Ga0222749_10739328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300030740|Ga0265460_12659748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300031544|Ga0318534_10328593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria881Open in IMG/M
3300031545|Ga0318541_10508427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300031546|Ga0318538_10220458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1015Open in IMG/M
3300031561|Ga0318528_10281025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria893Open in IMG/M
3300031573|Ga0310915_10109844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1873Open in IMG/M
3300031573|Ga0310915_10210803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1360Open in IMG/M
3300031640|Ga0318555_10104579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1494Open in IMG/M
3300031679|Ga0318561_10115902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1420Open in IMG/M
3300031680|Ga0318574_10795234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300031681|Ga0318572_10967412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria506Open in IMG/M
3300031682|Ga0318560_10027994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2642Open in IMG/M
3300031718|Ga0307474_11090329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300031724|Ga0318500_10490926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300031736|Ga0318501_10734786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300031744|Ga0306918_10038579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3088Open in IMG/M
3300031744|Ga0306918_10165930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1643Open in IMG/M
3300031744|Ga0306918_10937192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300031747|Ga0318502_10442512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria776Open in IMG/M
3300031748|Ga0318492_10589987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300031753|Ga0307477_10286590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1138Open in IMG/M
3300031764|Ga0318535_10225448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria839Open in IMG/M
3300031765|Ga0318554_10349474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria840Open in IMG/M
3300031770|Ga0318521_10487537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300031771|Ga0318546_10560340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria803Open in IMG/M
3300031777|Ga0318543_10303780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium714Open in IMG/M
3300031778|Ga0318498_10232138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria834Open in IMG/M
3300031781|Ga0318547_10517015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria738Open in IMG/M
3300031782|Ga0318552_10734594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300031792|Ga0318529_10333096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria707Open in IMG/M
3300031794|Ga0318503_10089368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria972Open in IMG/M
3300031796|Ga0318576_10212855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria910Open in IMG/M
3300031799|Ga0318565_10585325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300031819|Ga0318568_10831833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300031819|Ga0318568_11058877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300031820|Ga0307473_11312800All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300031821|Ga0318567_10182981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1167Open in IMG/M
3300031821|Ga0318567_10413424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria765Open in IMG/M
3300031823|Ga0307478_10320873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1272Open in IMG/M
3300031833|Ga0310917_10600456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria747Open in IMG/M
3300031835|Ga0318517_10574973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300031845|Ga0318511_10121448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1125Open in IMG/M
3300031880|Ga0318544_10258709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300031880|Ga0318544_10362308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300031910|Ga0306923_10238110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2082Open in IMG/M
3300031910|Ga0306923_11555341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300031941|Ga0310912_10743012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300031941|Ga0310912_10977302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria650Open in IMG/M
3300031942|Ga0310916_10224953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1575Open in IMG/M
3300031942|Ga0310916_11362142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300031946|Ga0310910_10400905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1087Open in IMG/M
3300031946|Ga0310910_11284253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300031947|Ga0310909_10321175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1299Open in IMG/M
3300031947|Ga0310909_11237822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria602Open in IMG/M
3300031959|Ga0318530_10202737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria814Open in IMG/M
3300032035|Ga0310911_10895826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300032039|Ga0318559_10159878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1026Open in IMG/M
3300032042|Ga0318545_10333109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300032043|Ga0318556_10236078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria953Open in IMG/M
3300032043|Ga0318556_10528286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300032051|Ga0318532_10222418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria670Open in IMG/M
3300032054|Ga0318570_10174235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria967Open in IMG/M
3300032055|Ga0318575_10379412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300032059|Ga0318533_10681322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria755Open in IMG/M
3300032060|Ga0318505_10031422Not Available2168Open in IMG/M
3300032063|Ga0318504_10471614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300032068|Ga0318553_10061838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1860Open in IMG/M
3300032076|Ga0306924_10410707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1549Open in IMG/M
3300032089|Ga0318525_10304062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria819Open in IMG/M
3300032090|Ga0318518_10016559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3172Open in IMG/M
3300032205|Ga0307472_101172453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300032261|Ga0306920_100815228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1369Open in IMG/M
3300032261|Ga0306920_104402031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales505Open in IMG/M
3300032515|Ga0348332_12063536All Organisms → cellular organisms → Bacteria1978Open in IMG/M
3300032829|Ga0335070_10379189All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300032895|Ga0335074_10321306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1749Open in IMG/M
3300033134|Ga0335073_11002897Not Available864Open in IMG/M
3300033289|Ga0310914_11800465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria517Open in IMG/M
3300033290|Ga0318519_10610663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.02%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.02%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.02%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.21%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.21%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.81%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.40%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.40%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.40%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.40%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.40%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.40%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.40%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.40%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.40%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.40%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.40%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.40%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.40%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.40%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.40%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.40%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.40%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.40%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.40%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.40%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300007821Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010369Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3)Host-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10494891923300000955SoilVGPDEILKEPVPVTKQDPYPIGQRLFMHDVRLTGLIVNNLHKRLLDRKQGAGAGAG*
C688J35102_11803804313300002568SoilTKQDPYPIGQRLFMHDERLTGLIVHNLHKRIIDKKQAAGTRAG*
Ga0062384_10064490813300004082Bog Forest SoilEVTKQDPYPIGQRLFMLDERLTDMTVRNLHKRISEKKQGAPAS*
Ga0062387_10050480713300004091Bog Forest SoilKEPIEVTKQDPYPIGQRLFSLDQRLTGMIVHNLHQRILEKKQQPAA*
Ga0062386_10155033713300004152Bog Forest SoilVGPDEILKGPIEVTKQDPYPIGQRLFMLNARLTDMIVRNLHKRISDKKQAATV*
Ga0066395_1038362223300004633Tropical Forest SoilFVERGLSPEEILQQPLEVTRQDPYPIGQRLFMHNERLTGMIVHNLHKRILEKKQQAGAE*
Ga0062594_10226680913300005093SoilLKEPIEVTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA*
Ga0066677_1074524113300005171SoilLKEPIEVTKQDPYPIGQRLFMHDERLTGLIVNNLHKRLLDKRQGASR*
Ga0066673_1009863213300005175SoilRGIGPEEILKEPVPVTRQDPYPIGQRLFMHDERLTGMIVNNLHTRILAKKQDAGAG*
Ga0066679_1047288813300005176SoilPLEVAKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQHAA*
Ga0066679_1055174323300005176SoilPVTRQDPYPIGQRLFMHDERLTGLIVRNLHKRILERKQAAAARPG*
Ga0066688_1013467713300005178SoilSPEEILKEGVPVTKQDPYPIGQRLFMHDERLTGLIVHNLHKRILDKKQAAGTRAG*
Ga0066684_1035598633300005179SoilGLGPDEILKEPLEVTKQDPYPIGQRLFIHDQRLTGMIVHNLHQRILEKKQQAGGL*
Ga0066671_1097565813300005184SoilVPVTQQDPYPIGQRLFIHDERLTGLIVRNLHARILARKQASS
Ga0066675_1009693243300005187SoilRGIGPEEILKEPVPVTRQDPYPIGQRLFMHDERLTGMIVNNLHTRILAKKQDAGAGQA*
Ga0066388_10173541313300005332Tropical Forest SoilLQQPLEVTRQDPYPIGQRLFMHDERLTGMIVHNLHKRILEKKQQAGAE*
Ga0066388_10200797933300005332Tropical Forest SoilTRQDPYPIGQRLFMHNERLTEMIVRNLHQRVLDKNQQAGAA*
Ga0066388_10211205523300005332Tropical Forest SoilLEVTKQDPYPIGQRLFVHNERLTGMIVRNLHQRILENRQQAA*
Ga0070682_10180166513300005337Corn RhizosphereILKAPIPVTSQDPYPIGQRLFIHDERLTGLIVRNLHRRIRERKEAGGSG*
Ga0070713_10011707343300005436Corn, Switchgrass And Miscanthus RhizosphereLTPDEILGEPLEVTKQDPYPIGQRLFIHDARLTGMIVHNLHQRILDKKQQAG*
Ga0070681_1017405413300005458Corn RhizosphereDRGTGTDEILGKGVPVTRQDPYPIGQRLFIHDERLTGMIIRNLHQRLLNRKSGNAAK*
Ga0070681_1113205123300005458Corn RhizosphereLKQGVPVTRQDPYPIGQRLFMHDERLTGIIVNNLHRRILERKAAPAG*
Ga0070681_1171797623300005458Corn RhizosphereGVEPDEILKEPIPVTRQDPYPIGQRLFIHDERLTGLIVHNLHRRIRERKEARSSA*
Ga0070693_10098728023300005547Corn, Switchgrass And Miscanthus RhizosphereQDPYPIGQRLFMLDERLTGLIVRNLHRRIRERKEAGGTG*
Ga0070665_10221669313300005548Switchgrass RhizosphereEDALKEPIEVTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA*
Ga0066700_1107076813300005559SoilRGLTPDEILKEPLEVAKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQHAA*
Ga0058697_1023478723300005562AgaveGQRLFIHDERLTGLIVHNLHRRIFERKQAATAAAPSA*
Ga0066703_1023050813300005568SoilRGLTPDEILKEPIEVTKQDPYPIGQRLFMHDQRLTGLIVHNLHKRIIDKKQAAGTRAG*
Ga0066708_1029442123300005576SoilPEEILKEGVPVTKQDPYPIGQRLFIHDERLTGLIVHNLHRRILERKQAPTAVAPSA*
Ga0068857_10043477523300005577Corn RhizosphereLSPEDALKEPIEVTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA*
Ga0070761_1061500413300005591SoilLKEPLPVTQQDPYPIGQRLFMHDERLTGMIVRNLHRRILERKGAAAPAPPA*
Ga0066903_10139983213300005764Tropical Forest SoilTRQDPYPIGQRLFMHNERLTEMIVRNLHHRILDKQQRPVVS*
Ga0066903_10882269623300005764Tropical Forest SoilVTKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILDKKQQPSA*
Ga0066903_10905573523300005764Tropical Forest SoilDEILKEPLEVTKQDPYPIGQRLFVHNERLTGMIVRNLHQRILEKRQQSA*
Ga0068858_10039745423300005842Switchgrass RhizosphereVDRGVGPEEILKEGVPVTRQDPYPIGQRLFMHDERLTGLTVNNLHRRILERKQAAK*
Ga0068858_10185890923300005842Switchgrass RhizosphereQPIEVTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA*
Ga0075279_1001903413300005903Rice Paddy SoilVPVTRQDPYPIGQRLFMHDERLTGLIVNNLHRRILDRKAAAPAK*
Ga0070717_1176674213300006028Corn, Switchgrass And Miscanthus RhizospherePEEILKQGVPVTKQDPYPIGQRLFMHDERLTGLIVNNLHRRILERKQAGTGSPAA*
Ga0066656_1058860613300006034SoilKQDPYPIGQRLFMHDERLTGLIVHNLHKRILDKKQAAGTRAG*
Ga0070712_10123667713300006175Corn, Switchgrass And Miscanthus RhizosphereTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA*
Ga0097621_10171953013300006237Miscanthus RhizosphereQDPYPIGQRLFMHDERLTGLIVHNLHKRLLGKKEAAGTRAG*
Ga0079222_1116753723300006755Agricultural SoilLGPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQVA*
Ga0066659_1064896523300006797SoilEILKAPVPVTRQDPYPIGQRLFIHDERLTGMIVHNLHSRILARKAA*
Ga0066659_1141987113300006797SoilFVDRGLSPDEILRAPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRVLERKQQGT*
Ga0079221_1044706023300006804Agricultural SoilFVDRGLSAEDALKEPIEVKKQDPYPMGQNLFMHDERLTGLIVRNLHKRILGKKQARA*
Ga0073928_1087007023300006893Iron-Sulfur Acid SpringVGPEEILREKIAVTEQDPYPIGQRLFMHDERLTGMIVNNLHRRISEKKAGVPAV*
Ga0075436_10090809223300006914Populus RhizosphereQDPYPIGQRLFIHDERLTGMIVHNLHRRILARKAA*
Ga0079219_1004937943300006954Agricultural SoilYPIGQRLFMHDERLTGLIVHNLHKRLLGKKEAAGTRAG*
Ga0099795_1033223513300007788Vadose Zone SoilTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQ*
Ga0104323_13187353300007821SoilVPGHILKGPIPVTKQDPYPIGQRLFIHDERLTGLIVHNLHRRIVARKAAARA*
Ga0066710_10312126523300009012Grasslands SoilYPSGQRLFIHDQRLTGMIVRNLHHRIMDKKQQAGA
Ga0066710_10479403613300009012Grasslands SoilYPIGQRLFIHDERLTGLIVNNLHRRILERKTAAPTG
Ga0099829_1117406213300009038Vadose Zone SoilPIGQRLFIHDERLTGMIVRNLHQRILEKKQRAGPG*
Ga0099792_1021490633300009143Vadose Zone SoilEVTKQDPYPIGQRLFVHDERLTGMIVRNLHQRIFDKKQHASAA*
Ga0116220_1009702023300009525Peatlands SoilKGPIEVTKQDPYPIGQRLFMLNERLTDMTVRNLHKRILDKKQQVGA*
Ga0105237_1204172913300009545Corn RhizosphereIGQRLFMLDERLTGLIVRNLHRRIRERKEAGASA*
Ga0126374_1052531323300009792Tropical Forest SoilYPIGQRLFMHDERLTGMIVHNLHKRILEKKQQAGAE*
Ga0126380_1222963513300010043Tropical Forest SoilTKQDPYPIGQRLFMHNERLTDMIVRNLHQRILDKKQQPSA*
Ga0126373_1158555813300010048Tropical Forest SoilEVTKQDPYPIGQRLFIHNERLTGMIVHNLHQRVLERKQKAGAPARGSKRE*
Ga0123356_1147898913300010049Termite GutEDALKEPIEVAKQDPYPIGQRLFMHDERLTGLIISNLHKRISDRKAIRS*
Ga0126318_1080551833300010152SoilDRGIGPDEILRGPIEVTKQDPYPIGQRLFIHNERLTEMIVRNLHKRILDKKQQAAV*
Ga0134109_1045202123300010320Grasslands SoilEEILKEPVPVTEQDPYPIGQRLFMHDERLTGLIVNNLHKRLLERKQGAGAGVG*
Ga0126370_1089981923300010358Tropical Forest SoilEPLEVTKQDPYPIGQRLFIHDQRLTGMIVHNIHQRILERKQQQNA*
Ga0126372_1087363413300010360Tropical Forest SoilVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILEKNSNQPRDE*
Ga0126372_1170493123300010360Tropical Forest SoilPYPIGQRLFMHNERLTGLTVHNLHRRIVEKKQQPAAV*
Ga0126378_1063572613300010361Tropical Forest SoilEEILREPLEVTRQDPYPIGQRLFIHDERLTSMIVHNLHQRIRDKKQEQPPA*
Ga0136643_1064609913300010369Termite GutGLSPEEILQQALEVTQQDPYPIGQRLFMHNERLTGMIVHNLHRRILERKQTRAA*
Ga0126381_10152543713300010376Tropical Forest SoilKEPIEVTNQDPYPIGQRLFMHNERLTEMIVRNLHHRIRDKQQRPAVS*
Ga0126381_10411339623300010376Tropical Forest SoilGLSPEEILQQPLEVTRQDPYPIGQRLFMHNERLTGLTVHNLHRRIVEKKQQPAAV*
Ga0126381_10414758513300010376Tropical Forest SoilSAEEMLQQPIPVTEQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKREKAA*
Ga0126381_10427494713300010376Tropical Forest SoilLTPDEILKEPLEVAKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQPRSVA*
Ga0136847_1342706713300010391Freshwater SedimentPEEVLREPIPVTRQDPYPIGQRLFIHDERLTGLIVHNLHRRILERKAAARAG*
Ga0134126_1288695013300010396Terrestrial SoilEGVPVTHQDPYPIGQRLFMHDERLTGLIVHNLHKRVLGKKEAAGTRPS*
Ga0126383_1345174313300010398Tropical Forest SoilTPEEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVHNLHRRLLEKKHQSTIT*
Ga0150983_1505716913300011120Forest SoilIGQRLFMHDERLTGMIVRNLHRRILDRKQAQNAP*
Ga0137392_1037621233300011269Vadose Zone SoilILKAPVSVTRQDPYPIGQRLFMHDERLTGLIVHNLHKRILERKQAAGGASA*
Ga0137391_1144359813300011270Vadose Zone SoilDRGLTADEVLKEPLEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKRQAGTV*
Ga0137463_114973713300011444SoilGPEEILKEGVPVTAQDPYPIGQRLFIHDERLTGLIVHNLHRRILERKTAARAG*
Ga0137363_1175780913300012202Vadose Zone SoilPIEVTKQDPYPIGQRLFMHNERLTGMIVRNLHQRILEKKQQQPTA*
Ga0137363_1177526523300012202Vadose Zone SoilDRGATADEVLKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLRQRILDKKQQAH*
Ga0137362_1037323013300012205Vadose Zone SoilQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQ*
Ga0137379_1019024443300012209Vadose Zone SoilRQDPYPIGQRLFIHDERLTGMIVHNLHSRIRAKKAA*
Ga0150985_11584900413300012212Avena Fatua RhizosphereKQDPYPIGQRLFVHDERLTGMIVRNLHQRLVEREQSIGSRERAPN*
Ga0137370_1022080933300012285Vadose Zone SoilVPVTEQDPYPICQRLFMHDQRLTGLIVNNLHKRLLERKQGAGAGAG*
Ga0137384_1131428323300012357Vadose Zone SoilPVARQDPYPIGQRLFIHDERLTGMIVHNLHSRILARKGA*
Ga0137385_1050838023300012359Vadose Zone SoilDRGVEPEAILKEGVPVTKQDPYPIGQRLFIHDERLTGLIVRNLHARILARKTAARAG*
Ga0137360_1117222223300012361Vadose Zone SoilEVTRQDPYPIGQRLFMHNERLTDMIVRNLHQRILDKKQQPGA*
Ga0137361_1025996913300012362Vadose Zone SoilQDPYPIGQRLFMHDERLTGLIVRNLHGRILERKQAAAKPG*
Ga0137361_1049690233300012362Vadose Zone SoilTPDEVLKEPLEVTKQDPYPIGQRLFIHDQRLTGMIVRNLHQRIMDKKQQAGA*
Ga0150984_11872159713300012469Avena Fatua RhizosphereQRLFMHDERLTGLIVNNLHKRLLERKQGAGAGAG*
Ga0137359_1004299413300012923Vadose Zone SoilDALKEPIEVTKQDPYPIGQRLFMHNERLTDMIVRNLHQRVLDKKQQPGA*
Ga0137359_1055213813300012923Vadose Zone SoilIEVTKQDPYPIGQRLFMHNERLTDMIVRNLHQRILDKKQQLNA*
Ga0137359_1137285713300012923Vadose Zone SoilIGQRLFMHDERLTGLIVHNLHKRILDKKQAAGTRAG*
Ga0137416_1156609213300012927Vadose Zone SoilPVTRQDPYPIGQRLFMHDERLSGLIVNNLHKRILGKKQAAGAGAG*
Ga0164301_1051479733300012960SoilGASPEEILKEGVPVTKQDPYPIGQRLFMHDERLTGLIVHNLHKRILEKKQPAGAGAT*
Ga0126369_1152538823300012971Tropical Forest SoilRGLTPDEILKEPLEVAKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQPRSVA*
Ga0126369_1255735623300012971Tropical Forest SoilRFVDRGMTPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRISERRQQPGA*
Ga0182008_1003914623300014497RhizosphereGLSAEDALKEPIEVTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQRARA*
Ga0182024_1185791623300014501PermafrostLREKVAVTDQDPYPIGQRLFMHDERLTGLIVNNLHHRIREKKEGRA*
Ga0132258_1273115113300015371Arabidopsis RhizosphereDPYPIGQRLFMLDERLTGLIVNNLHRRIVERKQAAK*
Ga0182041_1002961913300016294SoilEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVHNLYQRILERKQHPTA
Ga0182041_1128440513300016294SoilILKEPIEVTKQDPYPIGQRLFIHDERLTGLIVRNLHQRILEKKQQPAA
Ga0182033_1039650633300016319SoilTPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRISEKRQQPGA
Ga0182035_1078919023300016341SoilEEVLKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQAGAV
Ga0182035_1163150423300016341SoilSSDEILREPLEVTKQDPYPIGQRLFIHDGRLTGMIVRNLHQRILDKKQQPSGV
Ga0182034_1014406033300016371SoilVTKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILERKQQQTA
Ga0182034_1087896423300016371SoilDEILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPSA
Ga0182037_1019606613300016404SoilEPIEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPTA
Ga0182039_1051379033300016422SoilKEPIEVTRQDPYPIGQRLFMHNERLTEMIVRNLHQRLLDKKQQAGAT
Ga0182039_1176895223300016422SoilLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQQPTAG
Ga0182038_1217101113300016445SoilEVTKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0187786_1064992323300017944Tropical PeatlandVSPDEALKEPIAVTKQDPYPIGQRLFPHDERLTGLIIRNLHKRILEKKEARA
Ga0187778_1021034213300017961Tropical PeatlandDEALKEPLDVKRQDPYPMGQNLFEHEERLNGMIMRNLHKRILEKKQARAS
Ga0187815_1029531913300018001Freshwater SedimentEVTKQDPYPIGQRLFPLNERLTDMIVRNLHQRISDKKARAGAA
Ga0066667_1095865923300018433Grasslands SoilVGPEEILKGAVPVTRQDPYPIGQRLFVHDERLTGMIVHNLHSRILARKAA
Ga0066662_1255759513300018468Grasslands SoilPYPIGQRLFIHDERLTGLIVRNLHRRIRERKEGAASA
Ga0066662_1274404813300018468Grasslands SoilEGVPVTKQDPYPIGQRLFMHDERLTGLIVHNLHKRILDKKQAAGTRAG
Ga0210403_1017745633300020580SoilQDPYPIGQRLFIHDERLTGMIVRNLHQRILDRKQQAHS
Ga0210403_1042412413300020580SoilLGDKVAVTDQDPYPIGQRLFMHDERLTGMIVNNLHRRIREKKEGAAG
Ga0210399_1012579713300020581SoilTDEDALQQPIEVTKQDPYPIGQRLFMHNERLTDMIVRNLHQRILDKKQQPSA
Ga0210401_1055133833300020583SoilTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKRQVA
Ga0210401_1057299713300020583SoilTPDDILKEPLKVTEQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQQATRL
Ga0210401_1062046613300020583SoilPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQQAGA
Ga0210404_1009037513300021088SoilDRGLSPDEILKEPLEVTRQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKNRQVA
Ga0210406_1061267223300021168SoilPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKRQVA
Ga0210400_1035991033300021170SoilEILREPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKRQVA
Ga0210408_1103479823300021178SoilEPLEVTKQDPYPIGQRLFVHNERLTGMIVRNLHQRILEKKQQAGTA
Ga0210408_1122408213300021178SoilEVTKQDPYPIGQRLFMHNERLTDMIVRNLHQRILDKKQQPSA
Ga0210396_1121796233300021180SoilVEVAKQDPYPIGQRLFMHNERLTDMIVRNLHQRILDKKQPPRA
Ga0213877_1017038513300021372Bulk SoilTAEDALKEPIEVTKQDPYPIGQRLFMHNERLTGMIVRNLHQRILDKKQQAGAA
Ga0213881_1001047813300021374Exposed RockVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKRQHLSVA
Ga0210393_1020025513300021401SoilDQDPYPIGQRLFMHDERLTGMIVNNLHRRLREKKEGSAAP
Ga0210385_1130617623300021402SoilGVSPDEILREKVAVTDQDPYPIGQRLFPHDERLTGMIVNNLHHRIREKKEGAKP
Ga0210397_1035673233300021403SoilEILRDTVAVTAQDPYPIGQRLFMHDERLTGMIVNNLHTRIRAKKEDAATA
Ga0210397_1107113723300021403SoilRQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQARS
Ga0210383_1034457833300021407SoilVGPDEILKGPVEVAKQDPYPIGQRLFMHNERLTDMIVRNLHQRILDKNQQPGA
Ga0210384_1177089513300021432SoilYPIGQRLFIHDERLTGMIVRNLHQRILDKKQPTAAV
Ga0210409_1010611643300021559SoilPLEVTRQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQARS
Ga0126371_1157240123300021560Tropical Forest SoilYPIGQRLFMHNERLTGMIVHNLHKRILEKKAAGVGRMSEA
Ga0242659_107902513300022522SoilPIGQRLFMHDERLTGMIVNNLHTRTRAKKEGAATA
Ga0242655_1009291613300022532SoilVSPEEILRDTVAVTAQDPYPIGQRLFMHDERLTGMIVNNLHTRIRAKKEDPATA
Ga0212123_1048489413300022557Iron-Sulfur Acid SpringILGQPIAVTAQDPYPIGQRLFVHDERLTGLIVHNLHERILTRQAQEPVAS
Ga0242671_105862713300022714SoilPLEVTKQDPYPIGQRLFIHDERLTGMIVHNIHQRILERKQQQNA
Ga0242661_102299933300022717SoilLKEPLEVTRQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKRQVA
Ga0242675_106487713300022718SoilYPIGQRLFIHDERLTGMIVRNLHQRILEKKQKARS
Ga0207699_1067268413300025906Corn, Switchgrass And Miscanthus RhizosphereTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQQVA
Ga0207693_1020204723300025915Corn, Switchgrass And Miscanthus RhizosphereTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA
Ga0207693_1071351223300025915Corn, Switchgrass And Miscanthus RhizosphereIGQRLFMHDERLTGLIVNNLHKRLLEKKQGAGAGVG
Ga0207652_1172657023300025921Corn RhizosphereDEILKEGVPVTRQDPYPIGQRLFMHDERLTGMIVNNLHRRILEKKQASK
Ga0207664_1046995913300025929Agricultural SoilPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDRKQQARS
Ga0207703_1214741723300026035Switchgrass RhizosphereALKQPIEVTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA
Ga0209687_127433213300026322SoilKHDPYPIGQRLFMHDERLTGLIVHNLHKRILDKKQAAGTRAG
Ga0257150_101642513300026356SoilLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKRQVA
Ga0257163_107957713300026359SoilEEILKEPVPVTRQDPYPIGQRLFMHDERLTGLIVNNLHKRITEKKQAAGAGAG
Ga0209156_1006394113300026547SoilGASPEEILKEGVPVTKQDPYPIGQRLFMHDERLTGLIVHNLHKRILDKKQAAGTRAG
Ga0209648_1034967313300026551Grasslands SoilEPEEILKQPIPVTRQDPYPIGQRLFVHDERLTGLIVNNLHRRIVERKAAAPAR
Ga0209577_1010494543300026552SoilVTKQDPYPIGQRLFMHDERLTGLIVHNLHKRILDKKQAAGTRAG
Ga0207776_104171113300027035Tropical Forest SoilDRGLTPDEVLMEPLEVTKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQAHAK
Ga0207948_101930913300027174Forest SoilEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQQATRL
Ga0207780_104899713300027313Tropical Forest SoilPDEVLMEPLEVTKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQAHAK
Ga0209446_100417363300027698Bog Forest SoilAEEALREPIEVTRQDPYPIGQRLFMHNERLTDMIVRNLHQRILEKKQQPTA
Ga0209773_1004526713300027829Bog Forest SoilADEALKGPIEVVKQDPYPIGQRLFMLDERLTDMTVRNLHKRISEKKQGAPTS
Ga0209579_1012964523300027869Surface SoilEPIAVTKQDPYPIGQRLFPHDERLTGLIVRNLHKRILEKKGARA
Ga0209283_1037512723300027875Vadose Zone SoilVPVTRQDPYPIGQRLFIHDERLTGLIVNNLHTRIQERKAGAAAR
Ga0209283_1070811713300027875Vadose Zone SoilVPVTRQDPYPIGQRLFVHDERLTGMIVHNLHSRILARKAA
Ga0209067_1054168313300027898WatershedsIQVTQQDPYPIGQRLFMLDDRLTDMTVRNLHKRIFEKKQAAPAS
Ga0268266_1194456223300028379Switchgrass RhizosphereEDALKEPIEVTKQDPYPIGQNLFPHDQRLTGLIINNLHKRILEKKQQARA
Ga0308309_1033094933300028906SoilKEGVPVTQQDPYPIGQRLFIHDQRLTGLIINNLHHRIRERKQGPATA
Ga0222749_1073932813300029636SoilSPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVHNIHQRILERKQQQNA
Ga0265460_1265974813300030740SoilPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILERKRRPTAS
Ga0318534_1032859323300031544SoilLVERGIGPDEALKGPIEVKKQDPYPIGQRLFMHDERLTGMIVRNLHQRILDKRRQGV
Ga0318541_1050842713300031545SoilPYPIGQRLFIHDERLTSMIVHNLHQRILDKRQQPTA
Ga0318538_1022045813300031546SoilQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQPTA
Ga0318528_1028102513300031561SoilLAPEEILKEPLEVTKQDPYPIGQRLFIHDQRLTGMIVHNLHQRILERKQQQTA
Ga0310915_1010984433300031573SoilDEILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQPTA
Ga0310915_1021080313300031573SoilILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPTA
Ga0318555_1010457933300031640SoilPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPTA
Ga0318561_1011590213300031679SoilEILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQPTA
Ga0318574_1079523413300031680SoilLKEPLEVTKQDPYPIGQRLFIHDQRLTGMIVHNLHQRILEGRQQQTV
Ga0318572_1096741213300031681SoilGLTPDEILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPTA
Ga0318560_1002799413300031682SoilDRGLTPDEILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQPTA
Ga0307474_1109032923300031718Hardwood Forest SoilPYPIGQRLFMHDERLTGMIVNNLHRRIREKTEGAPAA
Ga0318500_1049092613300031724SoilLKEPIEVTKQDPYPIGQRLFIHDQRLTGMIVHNLHQRIRDKKQQPAA
Ga0318501_1073478623300031736SoilDPYPIGQRLFIHDQRLTSMIVHNLHQRILDKKQQPSA
Ga0306918_1003857913300031744SoilKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0306918_1016593033300031744SoilEILEQPLEVTKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILDKKQQPSA
Ga0306918_1093719213300031744SoilVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRISEKRQQPGA
Ga0318502_1044251223300031747SoilKQDPYPIGQRLFIHDQRLTGMIVHNLHQRILDKRQQAG
Ga0318492_1058998713300031748SoilTKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILDKKQQPSA
Ga0307477_1028659013300031753Hardwood Forest SoilDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDRKQQARS
Ga0318535_1022544823300031764SoilPDEILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILERKQHPTA
Ga0318554_1034947413300031765SoilTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILERKQHPTA
Ga0318521_1048753723300031770SoilSPDEIITEPLEVTKQDPYPIGQRLFIHHERLTSMIVHNLHQRIRDKKQQPSA
Ga0318546_1056034023300031771SoilKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILDKKQQPSA
Ga0318543_1030378033300031777SoilIEVTKQDPYPIGQRLFMLDERLTDMTVRNLHKRILEKKQAAPAS
Ga0318498_1023213823300031778SoilKQPLEVTKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILDKKQQPSA
Ga0318547_1051701523300031781SoilRGLTPEEILKEPIEVTKQDPYPIGQRLFIHDQRLTGMIVHNLHQRIRDKKQQPAA
Ga0318552_1073459423300031782SoilTKQDPYPIGQRLFIHDERLTSMIVHNLHQRIRDKKQQPSA
Ga0318529_1033309623300031792SoilPLEVTKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0318503_1008936813300031794SoilEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPTAG
Ga0318576_1021285523300031796SoilPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0318565_1058532523300031799SoilGVSADEALKGPIEVTKQDPYPIGQRLFMLDERLTDMTVRNLHKRILEKKQAAPAS
Ga0318568_1083183323300031819SoilVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILERKQHPTA
Ga0318568_1105887713300031819SoilVIKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0307473_1131280013300031820Hardwood Forest SoilTKQDPYPIGQRLFMHNERLTDMIVHNLHQRILDKKQQPGA
Ga0318567_1018298133300031821SoilLTPDEILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQPTA
Ga0318567_1041342423300031821SoilPEEIIKEPLEVTKQDPYPIGQRLFIHDERLTSMIVHNLHQRIRDKKQQPSA
Ga0307478_1032087313300031823Hardwood Forest SoilQQDPYPIGQRLFMHDERLTGMIVRNLHRRILDRKQAQNAP
Ga0310917_1060045613300031833SoilVTKQDPYPIGQRLFIHDQRLTSLIVHNLHQRILERKQQQTA
Ga0318517_1057497313300031835SoilTPDEVLTESLEVTKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0318511_1012144833300031845SoilEILKDPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILGKKEQPTAG
Ga0318544_1025870913300031880SoilEPLEVTKQDPYPIGQRLFIHDERLTSMIVHNLHQRIRDKKQQPSA
Ga0318544_1036230823300031880SoilTKQDPYPIGQRLFIHDQRLTSLIVHNLHQRILERKQQQTA
Ga0306923_1023811013300031910SoilDRGLTPEETLKEPIEVTRQDPYPIGQRLFMHNERLTEMIVRNLHQRILDKKQQAGAH
Ga0306923_1155534123300031910SoilVTKQDPYPIGQRLFIHDERLTGLIVRNLHQRILEKKQQPAA
Ga0310912_1074301213300031941SoilPIGQRLFIHDGRLTGMIVRNLHQRILDKKQQPSGV
Ga0310912_1097730213300031941SoilVLTESLEVTKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0310916_1022495343300031942SoilYPIGQRLFMHDERLTGMIVRNLHQRILDKKLQPGTASSGGSNA
Ga0310916_1136214213300031942SoilRGLTPDEILKEPLEITKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPTA
Ga0310910_1040090513300031946SoilPLDVTKQDPYPIGQRLFIHDGRLTGMIVRNLHQRILDKKQQPSGV
Ga0310910_1128425323300031946SoilIEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQPTA
Ga0310909_1032117513300031947SoilILREPLEVTKQDPYPIGQRLFIHDGRLTGMIVRNLHQRILDKKQQPSGV
Ga0310909_1123782223300031947SoilDPYPIGQRLFIHDERLTGLIVRNLHQRILEKKQQPAA
Ga0318530_1020273723300031959SoilLEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILERKQHPTA
Ga0310911_1089582623300032035SoilTPDEILKEPLEVTKQDPYPIGQRLFIHDQRLTGMIVHNLHQRILEGRQQQTV
Ga0318559_1015987813300032039SoilMEPLEVAKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0318545_1033310913300032042SoilPYPIGQRLFIHDERLTGMIVHNLHQRILERKQHPTA
Ga0318556_1023607833300032043SoilLEVTKQDPYPIGQRLFIHDERLTSMIVHNLHQRIRDKKQQSSA
Ga0318556_1052828623300032043SoilPYPIGQRLFIHDQRLTDMIVHNLHQRILERKQQQTA
Ga0318532_1022241823300032051SoilRGLTPEEILEQPLEVTKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILDKKQQPSA
Ga0318570_1017423513300032054SoilILKEPLEVTKQDPYPIGQRLFIHDERLTGMIVHNLHQRILDKKQQPTA
Ga0318575_1037941213300032055SoilFVDCGLTPDEILKEPIEVTKQDPYPIGQRLFIHDQRLTSMIVHNLHQRILERKQQQTA
Ga0318533_1068132213300032059SoilLTESLEVTKQDPYPIGQRLFIHNERLTGMIVRNLHQRILEKKQQADAK
Ga0318505_1003142253300032060SoilYPIGQRLFMLDERLTDMTVRNLHKRILEKKQAAPAS
Ga0318504_1047161413300032063SoilILKEPIEVTKQDPDPIGQRLFIHDQRLTSLIVHNLHQRILERKQQQTA
Ga0318553_1006183833300032068SoilDEILKDPLEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILDKKQQPTAG
Ga0306924_1041070713300032076SoilEILKEPIEVTKQDPYPIGQRLFIHDQRLTGMIVHNLHQRIRDKKQQPAA
Ga0318525_1030406213300032089SoilFVDRGLTPDEILKEPIEVTKQDPYPIGQRLFIHDERLTGMIVRNLHQRILEKKQQPTA
Ga0318518_1001655943300032090SoilDPYPIGQRLFIHDERLTGMIVHNLHQRILERKQHPTA
Ga0307472_10117245313300032205Hardwood Forest SoilKQDPYPIGQRLFMHNERLTDMIVRNLHHRILEKKQQPTA
Ga0306920_10081522813300032261SoilLKEPIEVTKQDPYPIGQRLFIHDERLTGLIVRNLHQRILEKKQQPAA
Ga0306920_10440203113300032261SoilSQDPYPIGQRLFMHNARLTDMIVRNLHQRILDKRAQAGAP
Ga0348332_1206353623300032515Plant LitterLKGPIEVEKQDPYPIGQRLFMLNERLTDMTVRNLHQRISEKKQQTGTAG
Ga0335070_1037918923300032829SoilLKEPIAVTKQDPYPIGQRLFPHDERLTGLIVRNLHKRILDKKQARA
Ga0335074_1032130613300032895SoilLREKVAVTAQDPYPIGQRLFMHDERLTGMIVNNLHRRILEKREGAGA
Ga0335073_1100289713300033134SoilPIEVAKQDPYPIGQRLFMHNERLTDMTVRNLHKRILDKKQQARA
Ga0310914_1180046513300033289SoilPLEVTKQDPYPIGQRLFIHDERLTSMIVHNLHQRILDKRQQPTA
Ga0318519_1061066313300033290SoilLKGPIEVTKQDPYPIGQRLFMLDERLTDMTVRNLHKRILEKKQAAPAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.