Metagenome / Metatranscriptome Family F015657

Basic Information
Family ID	F015657
Family Type	Metagenome / Metatranscriptome
Number of Sequences	253
Average Sequence Length	48 residues
Representative Sequence	MEEGQEILDKRYKIIKKLGSGAFGEIYKVEKKKTGDFLAAKVEKAVKN
Number of Associated Samples	157
Number of Associated Scaffolds	253

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	10.40 %
% of genes near scaffold ends (potentially truncated)	54.55 %
% of genes from short scaffolds (< 2000 bps)	96.44 %
Associated GOLD sequencing projects	146
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.62

Most Common Taxonomy
Group	Eukaryota (98.024 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (23.715 % of family members)
Environment Ontology (ENVO)	Unclassified (69.565 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline) (72.332 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 34.21% Coil/Unstructured: 65.79%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 253 Family Scaffolds
PF00069	Pkinase	56.13
PF01041	DegT_DnrJ_EryC1	0.40
PF00567	TUDOR	0.40

COG ID	Name	Functional Category	% Frequency in 253 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	224.51
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.40
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.40
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.40
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.40
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.40
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.40

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.81 %
Unclassified	root	N/A	1.19 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.81 %
Unclassified	root	N/A	1.19 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	98.02 %
Unclassified	root	N/A	1.19 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	81.42 %
Unclassified	root	N/A	1.19 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1.98 %
Amoebozoa	clade	All Organisms → cellular organisms → Eukaryota → Amoebozoa	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	81.03 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Discosea	phylum	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Ciliophora	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora	81.03 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Flabellinia	class	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Intramacronucleata	subphylum	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata	81.03 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Dactylopodida	order	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Spirotrichea	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	80.24 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Oligohymenophorea	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea	0.79 %
Paramoebidae	family	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Stichotrichia	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia	37.55 %
Oligotrichia	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia	2.37 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Paramoeba	genus	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae → Paramoeba	0.40 %
Peniculida	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida	0.40 %
Hymenostomatida	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Sporadotrichida	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida	37.55 %
Strombidiidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae	2.37 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Parameciidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae	0.40 %
Paramoeba aestuarina	species	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae → Paramoeba → Paramoeba aestuarina	0.40 %
Tetrahymenina	suborder	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	37.55 %
Strombidium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium	2.37 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Tetrahymenidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae	0.40 %
Paramecium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium	0.40 %
Paramoeba aestuarina	species	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae → Paramoeba → Paramoeba aestuarina	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	37.55 %
Strombidium inclinatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	2.37 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Tetrahymena	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena	0.40 %
Paramecium tetraurelia	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia	0.40 %
Paramoeba aestuarina	species	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae → Paramoeba → Paramoeba aestuarina	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Name	Rank	Taxonomy	Distribution
Oxytrichidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	37.55 %
Strombidium inclinatum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	2.37 %
Unclassified	root	N/A	1.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.98 %
Tetrahymena thermophila	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	0.40 %
Paramecium tetraurelia	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia	0.40 %
Paramoeba aestuarina	species	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae → Paramoeba → Paramoeba aestuarina	0.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004794\|Ga0007751_11093800	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	792	Open in IMG/M
3300005516\|Ga0066831_10030319	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1467	Open in IMG/M
3300005516\|Ga0066831_10092651	All Organisms → cellular organisms → Bacteria → Proteobacteria	817	Open in IMG/M
3300005516\|Ga0066831_10175644	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300006165\|Ga0075443_10117740	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	923	Open in IMG/M
3300006355\|Ga0075501_1308449	All Organisms → cellular organisms → Eukaryota	616	Open in IMG/M
3300006375\|Ga0075490_1242905	All Organisms → cellular organisms → Eukaryota	740	Open in IMG/M
3300006383\|Ga0075504_1331220	All Organisms → cellular organisms → Eukaryota	691	Open in IMG/M
3300006403\|Ga0075514_1894751	All Organisms → cellular organisms → Eukaryota	877	Open in IMG/M
3300006404\|Ga0075515_10708851	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia	550	Open in IMG/M
3300006415\|Ga0099654_10284278	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1790	Open in IMG/M
3300006419\|Ga0075496_1258422	All Organisms → cellular organisms → Eukaryota	566	Open in IMG/M
3300006803\|Ga0075467_10180701	All Organisms → cellular organisms → Eukaryota	1188	Open in IMG/M
3300006874\|Ga0075475_10402598	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila	550	Open in IMG/M
3300007513\|Ga0105019_1121088	All Organisms → cellular organisms → Eukaryota	1395	Open in IMG/M
3300007513\|Ga0105019_1124076	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1373	Open in IMG/M
3300007513\|Ga0105019_1141144	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1261	Open in IMG/M
3300007552\|Ga0102818_1093608	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	595	Open in IMG/M
3300007718\|Ga0102852_1134057	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	504	Open in IMG/M
3300007760\|Ga0105018_1121906	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	893	Open in IMG/M
3300008952\|Ga0115651_1218507	All Organisms → cellular organisms → Eukaryota	1261	Open in IMG/M
3300008952\|Ga0115651_1277385	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1058	Open in IMG/M
3300008958\|Ga0104259_1025259	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	606	Open in IMG/M
3300009003\|Ga0102813_1064389	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1214	Open in IMG/M
3300009003\|Ga0102813_1119606	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	833	Open in IMG/M
3300009003\|Ga0102813_1211954	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	598	Open in IMG/M
3300009003\|Ga0102813_1281265	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	515	Open in IMG/M
3300009071\|Ga0115566_10191554	All Organisms → cellular organisms → Eukaryota	1254	Open in IMG/M
3300009071\|Ga0115566_10203156	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1208	Open in IMG/M
3300009172\|Ga0114995_10328647	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	841	Open in IMG/M
3300009172\|Ga0114995_10792125	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	519	Open in IMG/M
3300009265\|Ga0103873_1020616	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1083	Open in IMG/M
3300009265\|Ga0103873_1023500	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1042	Open in IMG/M
3300009432\|Ga0115005_10329280	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1204	Open in IMG/M
3300009432\|Ga0115005_10423473	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1057	Open in IMG/M
3300009432\|Ga0115005_10455985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1017	Open in IMG/M
3300009432\|Ga0115005_10906065	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	712	Open in IMG/M
3300009432\|Ga0115005_11036406	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	665	Open in IMG/M
3300009434\|Ga0115562_1093679	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1204	Open in IMG/M
3300009434\|Ga0115562_1179053	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	771	Open in IMG/M
3300009434\|Ga0115562_1269119	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	590	Open in IMG/M
3300009436\|Ga0115008_10220097	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1356	Open in IMG/M
3300009436\|Ga0115008_10257777	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1241	Open in IMG/M
3300009436\|Ga0115008_10267194	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1216	Open in IMG/M
3300009436\|Ga0115008_10283179	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1177	Open in IMG/M
3300009436\|Ga0115008_10343331	All Organisms → cellular organisms → Eukaryota	1059	Open in IMG/M
3300009436\|Ga0115008_10550210	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	827	Open in IMG/M
3300009441\|Ga0115007_10375800	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	928	Open in IMG/M
3300009497\|Ga0115569_10130229	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1228	Open in IMG/M
3300009497\|Ga0115569_10137502	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1184	Open in IMG/M
3300009497\|Ga0115569_10293186	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	720	Open in IMG/M
3300009543\|Ga0115099_10297387	All Organisms → cellular organisms → Eukaryota	1054	Open in IMG/M
3300009592\|Ga0115101_1251609	All Organisms → cellular organisms → Eukaryota	1064	Open in IMG/M
3300009592\|Ga0115101_1760010	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1097	Open in IMG/M
3300009599\|Ga0115103_1000475	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	902	Open in IMG/M
3300009599\|Ga0115103_1068864	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1699	Open in IMG/M
3300009599\|Ga0115103_1163512	All Organisms → cellular organisms → Eukaryota	976	Open in IMG/M
3300009599\|Ga0115103_1411846	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1141	Open in IMG/M
3300009599\|Ga0115103_1431841	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	983	Open in IMG/M
3300009599\|Ga0115103_1432647	All Organisms → cellular organisms → Eukaryota	1057	Open in IMG/M
3300009599\|Ga0115103_1861756	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1141	Open in IMG/M
3300009606\|Ga0115102_10157567	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1417	Open in IMG/M
3300009606\|Ga0115102_10801157	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	633	Open in IMG/M
3300009606\|Ga0115102_10828650	All Organisms → cellular organisms → Eukaryota → Sar	637	Open in IMG/M
3300009608\|Ga0115100_10950544	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1159	Open in IMG/M
3300009608\|Ga0115100_11224969	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	844	Open in IMG/M
3300009677\|Ga0115104_10406684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1002	Open in IMG/M
3300009677\|Ga0115104_10719912	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	506	Open in IMG/M
3300009785\|Ga0115001_10525459	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	728	Open in IMG/M
3300010392\|Ga0118731_108015407	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1077	Open in IMG/M
3300010883\|Ga0133547_11816024	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1126	Open in IMG/M
3300012408\|Ga0138265_1011814	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1057	Open in IMG/M
3300012408\|Ga0138265_1128031	All Organisms → cellular organisms → Eukaryota	1088	Open in IMG/M
3300012408\|Ga0138265_1327216	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1641	Open in IMG/M
3300012408\|Ga0138265_1343944	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	736	Open in IMG/M
3300012408\|Ga0138265_1423699	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1241	Open in IMG/M
3300012412\|Ga0138266_1082683	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	751	Open in IMG/M
3300012412\|Ga0138266_1230218	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1618	Open in IMG/M
3300012412\|Ga0138266_1303401	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1125	Open in IMG/M
3300012414\|Ga0138264_1639210	All Organisms → cellular organisms → Eukaryota	1031	Open in IMG/M
3300012522\|Ga0129326_1235466	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1057	Open in IMG/M
3300012524\|Ga0129331_1463412	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1001	Open in IMG/M
3300012782\|Ga0138268_1010974	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	740	Open in IMG/M
3300012782\|Ga0138268_1566500	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1063	Open in IMG/M
3300012935\|Ga0138257_1250952	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	763	Open in IMG/M
3300012953\|Ga0163179_11167481	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	679	Open in IMG/M
3300013295\|Ga0170791_10105654	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	953	Open in IMG/M
3300016766\|Ga0182091_1093121	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	753	Open in IMG/M
3300017107\|Ga0186524_107790	All Organisms → cellular organisms → Eukaryota	1269	Open in IMG/M
3300017166\|Ga0186523_101750	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	2222	Open in IMG/M
3300017238\|Ga0186197_106709	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1273	Open in IMG/M
3300017299\|Ga0186338_1010101	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1424	Open in IMG/M
3300018684\|Ga0192983_1008327	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1205	Open in IMG/M
3300018684\|Ga0192983_1012236	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1062	Open in IMG/M
3300018706\|Ga0193539_1012466	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1433	Open in IMG/M
3300018739\|Ga0192974_1015720	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1260	Open in IMG/M
3300018741\|Ga0193534_1008850	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1448	Open in IMG/M
3300018813\|Ga0192872_1027058	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1035	Open in IMG/M
3300018846\|Ga0193253_1047863	All Organisms → cellular organisms → Eukaryota	1057	Open in IMG/M
3300018871\|Ga0192978_1028001	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1048	Open in IMG/M
3300018874\|Ga0192977_1022837	All Organisms → cellular organisms → Eukaryota	1199	Open in IMG/M
3300018874\|Ga0192977_1032461	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1038	Open in IMG/M
3300018874\|Ga0192977_1105236	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	558	Open in IMG/M
3300018926\|Ga0192989_10141392	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	587	Open in IMG/M
3300018980\|Ga0192961_10070586	All Organisms → cellular organisms → Eukaryota	1035	Open in IMG/M
3300018982\|Ga0192947_10073740	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1106	Open in IMG/M
3300018989\|Ga0193030_10019274	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1420	Open in IMG/M
3300018996\|Ga0192916_10020263	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1579	Open in IMG/M
3300019007\|Ga0193196_10022283	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1914	Open in IMG/M
3300019017\|Ga0193569_10281880	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	697	Open in IMG/M
3300019021\|Ga0192982_10068601	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1113	Open in IMG/M
3300019032\|Ga0192869_10108927	All Organisms → cellular organisms → Eukaryota	1084	Open in IMG/M
3300019036\|Ga0192945_10062720	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1103	Open in IMG/M
3300019036\|Ga0192945_10065188	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1087	Open in IMG/M
3300019048\|Ga0192981_10075222	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1284	Open in IMG/M
3300019048\|Ga0192981_10086090	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1212	Open in IMG/M
3300019048\|Ga0192981_10093687	All Organisms → cellular organisms → Eukaryota	1168	Open in IMG/M
3300019048\|Ga0192981_10095361	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1158	Open in IMG/M
3300019048\|Ga0192981_10097677	All Organisms → cellular organisms → Eukaryota	1145	Open in IMG/M
3300019048\|Ga0192981_10100793	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1128	Open in IMG/M
3300019048\|Ga0192981_10100908	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1127	Open in IMG/M
3300019048\|Ga0192981_10101516	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1124	Open in IMG/M
3300019048\|Ga0192981_10110998	All Organisms → cellular organisms → Eukaryota	1077	Open in IMG/M
3300019048\|Ga0192981_10113393	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1066	Open in IMG/M
3300019048\|Ga0192981_10125231	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1014	Open in IMG/M
3300019048\|Ga0192981_10243679	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	690	Open in IMG/M
3300019048\|Ga0192981_10305375	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	592	Open in IMG/M
3300019108\|Ga0192972_1021238	All Organisms → cellular organisms → Eukaryota	1237	Open in IMG/M
3300019123\|Ga0192980_1027790	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1074	Open in IMG/M
3300019123\|Ga0192980_1030216	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1033	Open in IMG/M
3300019149\|Ga0188870_10048184	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1030	Open in IMG/M
3300019153\|Ga0192975_10058847	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1339	Open in IMG/M
3300019153\|Ga0192975_10067931	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1262	Open in IMG/M
3300020372\|Ga0211683_10187726	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	660	Open in IMG/M
3300021169\|Ga0206687_1110291	All Organisms → cellular organisms → Eukaryota	1016	Open in IMG/M
3300021169\|Ga0206687_1305024	All Organisms → cellular organisms → Eukaryota	929	Open in IMG/M
3300021169\|Ga0206687_1508528	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	678	Open in IMG/M
3300021169\|Ga0206687_1962216	All Organisms → cellular organisms → Eukaryota	1145	Open in IMG/M
3300021291\|Ga0206694_1041266	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	604	Open in IMG/M
3300021348\|Ga0206695_1010586	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1170	Open in IMG/M
3300021348\|Ga0206695_1373484	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	1187	Open in IMG/M
3300021350\|Ga0206692_1313001	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1110	Open in IMG/M
3300021350\|Ga0206692_1804524	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	705	Open in IMG/M
3300021353\|Ga0206693_1326087	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	654	Open in IMG/M
3300021359\|Ga0206689_10513084	All Organisms → cellular organisms → Eukaryota	604	Open in IMG/M
3300021359\|Ga0206689_11151510	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	832	Open in IMG/M
3300021887\|Ga0063105_1008170	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1278	Open in IMG/M
3300021887\|Ga0063105_1059246	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1015	Open in IMG/M
3300021889\|Ga0063089_1043655	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1047	Open in IMG/M
3300021890\|Ga0063090_1039542	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1072	Open in IMG/M
3300021890\|Ga0063090_1056792	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1732	Open in IMG/M
3300021910\|Ga0063100_1025828	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1055	Open in IMG/M
3300021913\|Ga0063104_1005808	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1234	Open in IMG/M
3300021925\|Ga0063096_1065002	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1083	Open in IMG/M
3300021927\|Ga0063103_1037163	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1085	Open in IMG/M
3300021927\|Ga0063103_1107713	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	534	Open in IMG/M
3300021927\|Ga0063103_1142018	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	608	Open in IMG/M
3300021941\|Ga0063102_1022002	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1014	Open in IMG/M
3300021941\|Ga0063102_1029657	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	983	Open in IMG/M
3300021950\|Ga0063101_1075192	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1177	Open in IMG/M
(restricted) 3300023276\|Ga0233410_10089059	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	950	Open in IMG/M
(restricted) 3300024261\|Ga0233439_10226909	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	839	Open in IMG/M
3300025680\|Ga0209306_1150707	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	659	Open in IMG/M
3300025869\|Ga0209308_10392653	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	555	Open in IMG/M
3300025874\|Ga0209533_1190600	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	874	Open in IMG/M
3300025887\|Ga0208544_10295891	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	632	Open in IMG/M
3300025890\|Ga0209631_10151624	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1249	Open in IMG/M
3300025890\|Ga0209631_10152625	All Organisms → cellular organisms → Eukaryota	1243	Open in IMG/M
3300025890\|Ga0209631_10156605	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1220	Open in IMG/M
3300026182\|Ga0208275_1018960	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1467	Open in IMG/M
3300026182\|Ga0208275_1023140	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1311	Open in IMG/M
3300026420\|Ga0247581_1016476	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1081	Open in IMG/M
3300026448\|Ga0247594_1022245	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1041	Open in IMG/M
3300026448\|Ga0247594_1022265	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1040	Open in IMG/M
3300026448\|Ga0247594_1022938	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1028	Open in IMG/M
3300027159\|Ga0208020_1023113	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1216	Open in IMG/M
3300027308\|Ga0208796_1038718	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1101	Open in IMG/M
3300027752\|Ga0209192_10184258	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	804	Open in IMG/M
3300027771\|Ga0209279_10208069	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	585	Open in IMG/M
3300027810\|Ga0209302_10252773	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	828	Open in IMG/M
3300027810\|Ga0209302_10323631	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	709	Open in IMG/M
3300027820\|Ga0209578_10366450	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	661	Open in IMG/M
3300027849\|Ga0209712_10197509	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1146	Open in IMG/M
3300027849\|Ga0209712_10801368	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	514	Open in IMG/M
3300027976\|Ga0209702_10380539	All Organisms → cellular organisms → Eukaryota	560	Open in IMG/M
3300028137\|Ga0256412_1101518	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1045	Open in IMG/M
3300028137\|Ga0256412_1101569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1045	Open in IMG/M
3300028137\|Ga0256412_1112284	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	995	Open in IMG/M
3300028290\|Ga0247572_1167792	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	550	Open in IMG/M
3300028595\|Ga0272440_1078530	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1246	Open in IMG/M
3300028595\|Ga0272440_1090621	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1119	Open in IMG/M
3300029908\|Ga0311341_10417387	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	775	Open in IMG/M
3300030671\|Ga0307403_10209958	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1018	Open in IMG/M
3300030699\|Ga0307398_10128700	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1282	Open in IMG/M
3300030699\|Ga0307398_10273026	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	913	Open in IMG/M
3300030740\|Ga0265460_11456266	All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Dactylopodida → Paramoebidae → Paramoeba → Paramoeba aestuarina	679	Open in IMG/M
3300030741\|Ga0265459_10117534	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1463	Open in IMG/M
3300030741\|Ga0265459_12483248	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	637	Open in IMG/M
3300030788\|Ga0073964_11730317	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1319	Open in IMG/M
3300030859\|Ga0073963_11425208	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1111	Open in IMG/M
3300031231\|Ga0170824_127342675	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	956	Open in IMG/M
3300031569\|Ga0307489_10203525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1229	Open in IMG/M
3300031602\|Ga0307993_1176701	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	535	Open in IMG/M
3300031674\|Ga0307393_1163001	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	506	Open in IMG/M
3300031710\|Ga0307386_10645960	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	563	Open in IMG/M
3300031717\|Ga0307396_10062811	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1580	Open in IMG/M
3300031734\|Ga0307397_10071158	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1359	Open in IMG/M
3300031734\|Ga0307397_10556824	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	538	Open in IMG/M
3300031735\|Ga0307394_10205235	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	774	Open in IMG/M
3300031738\|Ga0307384_10274808	All Organisms → cellular organisms → Eukaryota	763	Open in IMG/M
3300031739\|Ga0307383_10684810	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	522	Open in IMG/M
3300031742\|Ga0307395_10108119	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1126	Open in IMG/M
3300031752\|Ga0307404_10114831	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1072	Open in IMG/M
3300031752\|Ga0307404_10286017	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	684	Open in IMG/M
3300031752\|Ga0307404_10422381	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum	558	Open in IMG/M
3300032360\|Ga0315334_11875423	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	508	Open in IMG/M
3300032470\|Ga0314670_10177609	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1052	Open in IMG/M
3300032481\|Ga0314668_10052882	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1693	Open in IMG/M
3300032491\|Ga0314675_10018119	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	2192	Open in IMG/M
3300032491\|Ga0314675_10040902	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1747	Open in IMG/M
3300032492\|Ga0314679_10042785	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1723	Open in IMG/M
3300032492\|Ga0314679_10057308	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1557	Open in IMG/M
3300032517\|Ga0314688_10037685	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1751	Open in IMG/M
3300032521\|Ga0314680_10049921	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1783	Open in IMG/M
3300032540\|Ga0314682_10204194	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1051	Open in IMG/M
3300032616\|Ga0314671_10236591	All Organisms → cellular organisms → Eukaryota	982	Open in IMG/M
3300032617\|Ga0314683_10242181	All Organisms → cellular organisms → Eukaryota	1110	Open in IMG/M
3300032617\|Ga0314683_10352154	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	919	Open in IMG/M
3300032650\|Ga0314673_10010280	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	2224	Open in IMG/M
3300032650\|Ga0314673_10031725	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1722	Open in IMG/M
3300032651\|Ga0314685_10024393	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	2218	Open in IMG/M
3300032651\|Ga0314685_10217778	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1038	Open in IMG/M
3300032666\|Ga0314678_10024510	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1700	Open in IMG/M
3300032708\|Ga0314669_10561169	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	629	Open in IMG/M
3300032709\|Ga0314672_1010429	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	2222	Open in IMG/M
3300032709\|Ga0314672_1049552	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1389	Open in IMG/M
3300032711\|Ga0314681_10018679	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	2208	Open in IMG/M
3300032711\|Ga0314681_10205260	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1049	Open in IMG/M
3300032725\|Ga0314702_1223234	All Organisms → cellular organisms → Eukaryota	719	Open in IMG/M
3300032727\|Ga0314693_10209582	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1008	Open in IMG/M
3300032728\|Ga0314696_10313653	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	809	Open in IMG/M
3300032739\|Ga0315741_10146290	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1449	Open in IMG/M
3300032742\|Ga0314710_10303941	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	662	Open in IMG/M
3300032745\|Ga0314704_10443198	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	718	Open in IMG/M
3300032747\|Ga0314712_10281229	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	793	Open in IMG/M
3300032751\|Ga0314694_10120729	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1062	Open in IMG/M
3300032752\|Ga0314700_10339803	All Organisms → cellular organisms → Eukaryota	795	Open in IMG/M
3300032755\|Ga0314709_10138222	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae	1390	Open in IMG/M
3300033572\|Ga0307390_10514704	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	741	Open in IMG/M
3300033572\|Ga0307390_10883495	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	565	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.42%
Host-Associated	Host-Associated	1.58%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	96.05%
Terrestrial	Environmental → Terrestrial	2.37%
Human	Host-Associated → Human	1.58%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine	94.07%
Freshwater	Environmental → Aquatic → Freshwater	1.98%
Soil	Environmental → Terrestrial → Soil	1.98%
Digestive System	Host-Associated → Human → Digestive System	1.58%
Peat	Environmental → Terrestrial → Peat	0.40%

Habitat	Taxonomy	Distribution
Oceanic	Environmental → Aquatic → Marine → Oceanic	42.29%
Unclassified	Environmental → Aquatic → Marine → Unclassified	28.85%
Coastal	Environmental → Aquatic → Marine → Coastal	11.46%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.95%
Pelagic	Environmental → Aquatic → Marine → Pelagic	3.95%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.98%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.19%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	1.58%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	1.58%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.79%
Lake	Environmental → Aquatic → Freshwater → Lake	0.79%
Inlet	Environmental → Aquatic → Marine → Inlet	0.79%
Ice	Environmental → Aquatic → Freshwater → Ice	0.40%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.40%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	41.90%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	28.85%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	10.67%
Unclassified	Environmental → Aquatic → Marine → Pelagic → Unclassified	3.95%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	3.16%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.98%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	1.19%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	1.58%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	1.58%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.79%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.79%
Unclassified	Environmental → Aquatic → Marine → Inlet → Unclassified	0.79%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.79%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.40%
Photic Zone	Environmental → Aquatic → Marine → Oceanic → Photic Zone	0.40%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.40%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.40%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.40%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	23.72%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	23.32%
Seawater	Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater	12.25%
Seawater	Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater	5.14%
Polar Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine	4.74%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	4.35%
Pelagic Marine	Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine	3.95%
Seawater	Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater	3.16%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.16%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	2.77%
Marine Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment	1.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.19%
Pelagic Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine	1.58%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	1.58%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.79%
Seawater	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater	0.79%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.79%
Surface Ocean Water	Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water	0.79%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.40%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.40%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.40%
Surface Seawater	Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater	0.40%
Marine	Environmental → Aquatic → Marine → Coastal → Sediment → Marine	0.40%
Marine Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment	0.40%
Sackhole Brine	Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine	0.40%
Seawater	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater	0.40%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.40%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	0.40%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.40%
Ocean Water	Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water	0.40%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004794	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005516	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B	Environmental	Open in IMG/M
3300006165	Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA	Environmental	Open in IMG/M
3300006355	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006375	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006383	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006403	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006404	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006415	Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community	Environmental	Open in IMG/M
3300006419	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006803	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA	Environmental	Open in IMG/M
3300006874	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA	Environmental	Open in IMG/M
3300007513	Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b	Environmental	Open in IMG/M
3300007552	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571	Environmental	Open in IMG/M
3300007718	Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3	Environmental	Open in IMG/M
3300007760	Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate a	Environmental	Open in IMG/M
3300008952	Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um	Environmental	Open in IMG/M
3300008958	Marine microbial communities from eastern North Pacific Ocean - P1 particle-associated	Environmental	Open in IMG/M
3300009003	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725	Environmental	Open in IMG/M
3300009071	Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405	Environmental	Open in IMG/M
3300009172	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154	Environmental	Open in IMG/M
3300009265	Eukaryotic communities of water from the North Atlantic ocean - ACM8	Environmental	Open in IMG/M
3300009432	Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome	Environmental	Open in IMG/M
3300009434	Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516	Environmental	Open in IMG/M
3300009436	Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome	Environmental	Open in IMG/M
3300009441	Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome	Environmental	Open in IMG/M
3300009497	Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503	Environmental	Open in IMG/M
3300009543	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009592	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009599	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009606	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009608	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009677	Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009785	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130	Environmental	Open in IMG/M
3300010392	Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385	Environmental	Open in IMG/M
3300010883	western Arctic Ocean co-assembly	Environmental	Open in IMG/M
3300012408	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012412	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012414	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012522	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012524	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012782	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012935	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012953	Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome	Environmental	Open in IMG/M
3300012954	Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300016766	Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300017107	Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium, no silicate, 19 C, 30 psu salinity and 446 ?mol photons light - Strombidinopsis sp. SopsisLIS2011 (MMETSP0463)	Host-Associated	Open in IMG/M
3300017166	Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)	Host-Associated	Open in IMG/M
3300017238	Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396)	Host-Associated	Open in IMG/M
3300017299	Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 405 ?mol photons light - Strombidinopsis acuminata SPMC142 (MMETSP0126)	Host-Associated	Open in IMG/M
3300018684	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)	Environmental	Open in IMG/M
3300018706	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)	Environmental	Open in IMG/M
3300018739	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)	Environmental	Open in IMG/M
3300018741	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)	Environmental	Open in IMG/M
3300018813	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)	Environmental	Open in IMG/M
3300018846	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)	Environmental	Open in IMG/M
3300018871	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)	Environmental	Open in IMG/M
3300018874	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)	Environmental	Open in IMG/M
3300018926	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)	Environmental	Open in IMG/M
3300018980	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)	Environmental	Open in IMG/M
3300018982	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)	Environmental	Open in IMG/M
3300018989	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)	Environmental	Open in IMG/M
3300018996	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)	Environmental	Open in IMG/M
3300019007	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)	Environmental	Open in IMG/M
3300019017	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781	Environmental	Open in IMG/M
3300019021	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)	Environmental	Open in IMG/M
3300019032	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)	Environmental	Open in IMG/M
3300019036	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)	Environmental	Open in IMG/M
3300019048	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)	Environmental	Open in IMG/M
3300019108	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)	Environmental	Open in IMG/M
3300019123	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)	Environmental	Open in IMG/M
3300019149	Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dT	Environmental	Open in IMG/M
3300019153	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)	Environmental	Open in IMG/M
3300020372	Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090)	Environmental	Open in IMG/M
3300021169	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021291	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021348	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021350	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021353	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021359	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021887	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021889	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021890	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021910	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021913	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021925	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021927	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021941	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300021950	Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300023276 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG	Environmental	Open in IMG/M
3300024261 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG	Environmental	Open in IMG/M
3300025680	Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)	Environmental	Open in IMG/M
3300025869	Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)	Environmental	Open in IMG/M
3300025874	Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)	Environmental	Open in IMG/M
3300025887	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025890	Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)	Environmental	Open in IMG/M
3300026182	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)	Environmental	Open in IMG/M
3300026420	Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300026448	Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027159	Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)	Environmental	Open in IMG/M
3300027308	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)	Environmental	Open in IMG/M
3300027752	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)	Environmental	Open in IMG/M
3300027771	Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)	Environmental	Open in IMG/M
3300027810	Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027820	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)	Environmental	Open in IMG/M
3300027849	Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027976	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)	Environmental	Open in IMG/M
3300028137	Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028290	Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028595	Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17	Environmental	Open in IMG/M
3300029908	II_Bog_E1 coassembly	Environmental	Open in IMG/M
3300030671	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030699	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030740	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly	Environmental	Open in IMG/M
3300030741	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly	Environmental	Open in IMG/M
3300030788	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030859	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031569	Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2	Environmental	Open in IMG/M
3300031602	Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260	Environmental	Open in IMG/M
3300031674	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031710	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031717	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031734	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031735	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031738	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031739	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031742	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031752	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032360	Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915	Environmental	Open in IMG/M
3300032470	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032481	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032491	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032492	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032517	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032521	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032540	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032616	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032617	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032650	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032651	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032666	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032708	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032709	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032711	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032725	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032727	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032728	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032739	Forest Soil Metatranscriptomics Site 2 LB Combined Assembly	Environmental	Open in IMG/M
3300032742	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032745	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032747	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032751	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032752	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300032755	Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300033572	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.62
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.62
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F015657

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign