Basic Information | |
---|---|
Family ID | F015448 |
Family Type | Metagenome |
Number of Sequences | 254 |
Average Sequence Length | 42 residues |
Representative Sequence | LCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKESK |
Number of Associated Samples | 145 |
Number of Associated Scaffolds | 254 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 50.39 % |
% of genes near scaffold ends (potentially truncated) | 46.06 % |
% of genes from short scaffolds (< 2000 bps) | 76.38 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (64.961 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (32.677 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.110 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.346 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 254 Family Scaffolds |
---|---|---|
PF11351 | GTA_holin_3TM | 14.17 |
PF08291 | Peptidase_M15_3 | 12.20 |
PF00959 | Phage_lysozyme | 5.12 |
PF13392 | HNH_3 | 2.76 |
PF13884 | Peptidase_S74 | 1.97 |
PF00182 | Glyco_hydro_19 | 1.57 |
PF01957 | NfeD | 0.79 |
PF13640 | 2OG-FeII_Oxy_3 | 0.79 |
PF09636 | XkdW | 0.79 |
PF13539 | Peptidase_M15_4 | 0.79 |
PF13481 | AAA_25 | 0.39 |
PF00149 | Metallophos | 0.39 |
PF07728 | AAA_5 | 0.39 |
PF00622 | SPRY | 0.39 |
PF13385 | Laminin_G_3 | 0.39 |
PF00271 | Helicase_C | 0.39 |
PF05680 | ATP-synt_E | 0.39 |
PF16778 | Phage_tail_APC | 0.39 |
PF13673 | Acetyltransf_10 | 0.39 |
PF03837 | RecT | 0.39 |
PF15943 | YdaS_antitoxin | 0.39 |
PF10263 | SprT-like | 0.39 |
PF03245 | Phage_lysis | 0.39 |
PF09588 | YqaJ | 0.39 |
COG ID | Name | Functional Category | % Frequency in 254 Family Scaffolds |
---|---|---|---|
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 1.57 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 1.57 |
COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.34 % |
Unclassified | root | N/A | 8.66 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001842|RCM30_1085686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300002301|JGI24891J29808_1010470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
3300002307|JGI24890J29729_1016650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1863 | Open in IMG/M |
3300002930|Water_100785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6283 | Open in IMG/M |
3300002930|Water_103577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2516 | Open in IMG/M |
3300003277|JGI25908J49247_10007202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3520 | Open in IMG/M |
3300003277|JGI25908J49247_10138573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300003412|JGI25912J50252_10031199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
3300003412|JGI25912J50252_10165587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300003431|JGI25913J50563_1063606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300004240|Ga0007787_10597096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300004771|Ga0007797_1192745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300004805|Ga0007792_10055021 | Not Available | 1205 | Open in IMG/M |
3300004805|Ga0007792_10198027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300004805|Ga0007792_10201020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300004805|Ga0007792_10211209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300005069|Ga0071350_1017369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2865 | Open in IMG/M |
3300005525|Ga0068877_10279921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300005581|Ga0049081_10007886 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
3300005581|Ga0049081_10033138 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
3300005581|Ga0049081_10125794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
3300005581|Ga0049081_10229953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300005581|Ga0049081_10272067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300005581|Ga0049081_10332989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300005584|Ga0049082_10204706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300005585|Ga0049084_10299382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300005943|Ga0073926_10069642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300006805|Ga0075464_10413381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300006875|Ga0075473_10393754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300006920|Ga0070748_1258543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300007548|Ga0102877_1120081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300007708|Ga0102859_1103548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300007735|Ga0104988_10674 | Not Available | 21829 | Open in IMG/M |
3300007974|Ga0105747_1012738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2215 | Open in IMG/M |
3300007974|Ga0105747_1026289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1623 | Open in IMG/M |
3300007974|Ga0105747_1228612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300008055|Ga0108970_10312529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
3300008107|Ga0114340_1000814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24111 | Open in IMG/M |
3300008107|Ga0114340_1061275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1613 | Open in IMG/M |
3300008107|Ga0114340_1111448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
3300008107|Ga0114340_1140557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300008259|Ga0114841_1005010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7218 | Open in IMG/M |
3300008259|Ga0114841_1047072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2117 | Open in IMG/M |
3300008266|Ga0114363_1015244 | All Organisms → Viruses → Predicted Viral | 3503 | Open in IMG/M |
3300008266|Ga0114363_1037079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3781 | Open in IMG/M |
3300008266|Ga0114363_1146212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300008267|Ga0114364_1007196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8241 | Open in IMG/M |
3300008267|Ga0114364_1026381 | All Organisms → Viruses → Predicted Viral | 2330 | Open in IMG/M |
3300008267|Ga0114364_1114348 | Not Available | 815 | Open in IMG/M |
3300008267|Ga0114364_1188146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300008448|Ga0114876_1132604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300008448|Ga0114876_1204704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300008448|Ga0114876_1257022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300008450|Ga0114880_1181856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300009026|Ga0102829_1066893 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
3300009068|Ga0114973_10126820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
3300009068|Ga0114973_10412373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300009151|Ga0114962_10043919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2980 | Open in IMG/M |
3300009151|Ga0114962_10050176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2750 | Open in IMG/M |
3300009151|Ga0114962_10179940 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
3300009151|Ga0114962_10331358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
3300009151|Ga0114962_10469921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300009151|Ga0114962_10491251 | Not Available | 650 | Open in IMG/M |
3300009152|Ga0114980_10032522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3219 | Open in IMG/M |
3300009152|Ga0114980_10074968 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
3300009152|Ga0114980_10264843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
3300009152|Ga0114980_10351382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300009152|Ga0114980_10636999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300009154|Ga0114963_10306794 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300009154|Ga0114963_10512485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300009155|Ga0114968_10158010 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
3300009155|Ga0114968_10208761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
3300009155|Ga0114968_10275007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 949 | Open in IMG/M |
3300009158|Ga0114977_10000287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34098 | Open in IMG/M |
3300009158|Ga0114977_10156830 | Not Available | 1353 | Open in IMG/M |
3300009158|Ga0114977_10443053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300009159|Ga0114978_10108334 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
3300009159|Ga0114978_10774454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300009159|Ga0114978_10777077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300009161|Ga0114966_10069950 | All Organisms → Viruses → Predicted Viral | 2428 | Open in IMG/M |
3300009161|Ga0114966_10243835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300009161|Ga0114966_10252097 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
3300009161|Ga0114966_10537942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300009163|Ga0114970_10001605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16917 | Open in IMG/M |
3300009163|Ga0114970_10362534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300009163|Ga0114970_10545054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300009163|Ga0114970_10561036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300009164|Ga0114975_10124874 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
3300009181|Ga0114969_10399100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300009183|Ga0114974_10309484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300009183|Ga0114974_10324501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
3300009183|Ga0114974_10536901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300009183|Ga0114974_10576535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300009184|Ga0114976_10041858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2726 | Open in IMG/M |
3300009184|Ga0114976_10071431 | All Organisms → Viruses → Predicted Viral | 2012 | Open in IMG/M |
3300009184|Ga0114976_10214791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
3300009184|Ga0114976_10239627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
3300009419|Ga0114982_1035564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
3300009684|Ga0114958_10208208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300009684|Ga0114958_10359797 | Not Available | 707 | Open in IMG/M |
3300009684|Ga0114958_10366013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300009684|Ga0114958_10623564 | Not Available | 515 | Open in IMG/M |
3300010157|Ga0114964_10063713 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
3300010158|Ga0114960_10006364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8548 | Open in IMG/M |
3300010160|Ga0114967_10441047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300010160|Ga0114967_10590596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300010334|Ga0136644_10081822 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
3300010334|Ga0136644_10449573 | Not Available | 725 | Open in IMG/M |
3300010334|Ga0136644_10684006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300010374|Ga0114986_1036336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300010885|Ga0133913_11442025 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
3300010885|Ga0133913_11447034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1744 | Open in IMG/M |
3300010885|Ga0133913_13216584 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1079 | Open in IMG/M |
3300011010|Ga0139557_1020504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1213 | Open in IMG/M |
3300011011|Ga0139556_1078266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300011116|Ga0151516_10278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28505 | Open in IMG/M |
3300011116|Ga0151516_10478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19697 | Open in IMG/M |
3300011116|Ga0151516_10815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14225 | Open in IMG/M |
3300011268|Ga0151620_1183524 | Not Available | 636 | Open in IMG/M |
3300011334|Ga0153697_1525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11207 | Open in IMG/M |
3300011995|Ga0153800_1027109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300012012|Ga0153799_1000218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20142 | Open in IMG/M |
3300012013|Ga0153805_1041247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300013014|Ga0164295_11267314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300013285|Ga0136642_1009159 | All Organisms → Viruses → Predicted Viral | 3138 | Open in IMG/M |
3300013286|Ga0136641_1001002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11846 | Open in IMG/M |
3300013286|Ga0136641_1054423 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
3300013286|Ga0136641_1170291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300013372|Ga0177922_10381240 | Not Available | 731 | Open in IMG/M |
3300014050|Ga0119952_1049443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300014502|Ga0182021_12508632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300015050|Ga0181338_1018070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1114 | Open in IMG/M |
3300015050|Ga0181338_1026577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300015050|Ga0181338_1036886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300017707|Ga0181363_1018316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1387 | Open in IMG/M |
3300017716|Ga0181350_1003119 | All Organisms → Viruses → Predicted Viral | 4809 | Open in IMG/M |
3300017716|Ga0181350_1054165 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
3300017723|Ga0181362_1106561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300017736|Ga0181365_1022879 | Not Available | 1573 | Open in IMG/M |
3300017747|Ga0181352_1154106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300017754|Ga0181344_1005319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4324 | Open in IMG/M |
3300017754|Ga0181344_1092630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300017754|Ga0181344_1108807 | Not Available | 802 | Open in IMG/M |
3300017761|Ga0181356_1102154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
3300017761|Ga0181356_1197696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300017766|Ga0181343_1121275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300017766|Ga0181343_1145654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 661 | Open in IMG/M |
3300017766|Ga0181343_1164771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300017774|Ga0181358_1018638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2791 | Open in IMG/M |
3300017774|Ga0181358_1113236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
3300017777|Ga0181357_1135514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
3300017777|Ga0181357_1250168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300017778|Ga0181349_1128281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300017778|Ga0181349_1167232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300017780|Ga0181346_1164433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300017780|Ga0181346_1225177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300017780|Ga0181346_1330590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300017784|Ga0181348_1136254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 931 | Open in IMG/M |
3300017784|Ga0181348_1173521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300017785|Ga0181355_1208740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300018416|Ga0181553_10346316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300019784|Ga0181359_1045902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1688 | Open in IMG/M |
3300019784|Ga0181359_1092829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
3300019784|Ga0181359_1128661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
3300020048|Ga0207193_1261509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1292 | Open in IMG/M |
3300020158|Ga0194038_1064345 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300020159|Ga0211734_10161888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300020159|Ga0211734_10964352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300020167|Ga0194035_1215086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300020172|Ga0211729_11141479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300021131|Ga0214206_1018632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300021438|Ga0213920_1082700 | Not Available | 624 | Open in IMG/M |
3300021519|Ga0194048_10368721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300021952|Ga0213921_1034166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300021956|Ga0213922_1074418 | Not Available | 714 | Open in IMG/M |
3300021961|Ga0222714_10518840 | Not Available | 608 | Open in IMG/M |
3300021962|Ga0222713_10021984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 5330 | Open in IMG/M |
3300021962|Ga0222713_10142473 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
3300021962|Ga0222713_10171305 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
3300021963|Ga0222712_10004380 | Not Available | 14793 | Open in IMG/M |
3300021963|Ga0222712_10177961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
3300021963|Ga0222712_10368464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300021963|Ga0222712_10588179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300022179|Ga0181353_1095204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300022190|Ga0181354_1040498 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
3300022407|Ga0181351_1180628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300022407|Ga0181351_1268814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300022746|Ga0228701_1126044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300022752|Ga0214917_10064278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2360 | Open in IMG/M |
3300024289|Ga0255147_1000476 | Not Available | 11446 | Open in IMG/M |
3300025455|Ga0208376_1073954 | Not Available | 657 | Open in IMG/M |
3300025606|Ga0207954_1047344 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
3300027125|Ga0255106_1033548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300027146|Ga0255104_1006251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2563 | Open in IMG/M |
3300027468|Ga0209247_1036900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300027621|Ga0208951_1148528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300027659|Ga0208975_1007074 | All Organisms → cellular organisms → Bacteria | 4023 | Open in IMG/M |
3300027659|Ga0208975_1099998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300027708|Ga0209188_1031721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2518 | Open in IMG/M |
3300027710|Ga0209599_10067125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
3300027733|Ga0209297_1036883 | All Organisms → Viruses → Predicted Viral | 2258 | Open in IMG/M |
3300027733|Ga0209297_1197123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300027734|Ga0209087_1000280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33742 | Open in IMG/M |
3300027734|Ga0209087_1013104 | All Organisms → Viruses → Predicted Viral | 4191 | Open in IMG/M |
3300027734|Ga0209087_1025921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2843 | Open in IMG/M |
3300027734|Ga0209087_1124639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
3300027736|Ga0209190_1019625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3816 | Open in IMG/M |
3300027736|Ga0209190_1062377 | All Organisms → Viruses → Predicted Viral | 1831 | Open in IMG/M |
3300027736|Ga0209190_1254364 | Not Available | 693 | Open in IMG/M |
3300027747|Ga0209189_1130483 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
3300027749|Ga0209084_1004681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9525 | Open in IMG/M |
3300027749|Ga0209084_1066771 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
3300027754|Ga0209596_1251973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300027763|Ga0209088_10047750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2089 | Open in IMG/M |
3300027770|Ga0209086_10065203 | All Organisms → Viruses → Predicted Viral | 1976 | Open in IMG/M |
3300027777|Ga0209829_10082452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1602 | Open in IMG/M |
3300027782|Ga0209500_10329944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300027808|Ga0209354_10010656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3674 | Open in IMG/M |
3300027963|Ga0209400_1129610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300027963|Ga0209400_1316832 | Not Available | 591 | Open in IMG/M |
3300027969|Ga0209191_1101151 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
3300027971|Ga0209401_1030158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2632 | Open in IMG/M |
3300028025|Ga0247723_1007160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4768 | Open in IMG/M |
3300028025|Ga0247723_1011717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3343 | Open in IMG/M |
3300028025|Ga0247723_1151658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
3300028392|Ga0304729_1087775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1080 | Open in IMG/M |
3300028392|Ga0304729_1095246 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
3300028392|Ga0304729_1156937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300028393|Ga0304728_1180041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 746 | Open in IMG/M |
3300028394|Ga0304730_1315369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300030294|Ga0311349_11496101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300031669|Ga0307375_10859040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300031673|Ga0307377_10667332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 735 | Open in IMG/M |
3300031707|Ga0315291_10899344 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300031707|Ga0315291_11200642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300031784|Ga0315899_10006212 | Not Available | 12857 | Open in IMG/M |
3300031787|Ga0315900_10001906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32851 | Open in IMG/M |
3300031787|Ga0315900_10029829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6097 | Open in IMG/M |
3300031787|Ga0315900_10031017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5953 | Open in IMG/M |
3300031787|Ga0315900_10087646 | All Organisms → Viruses → Predicted Viral | 3082 | Open in IMG/M |
3300031951|Ga0315904_10078678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3539 | Open in IMG/M |
3300031951|Ga0315904_10632948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300031952|Ga0315294_10642897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300031999|Ga0315274_10628875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
3300031999|Ga0315274_11661625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300032053|Ga0315284_11268769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300032053|Ga0315284_11360088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300032093|Ga0315902_10924256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300032118|Ga0315277_10859646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 848 | Open in IMG/M |
3300032275|Ga0315270_10823423 | Not Available | 611 | Open in IMG/M |
3300032401|Ga0315275_10959427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
3300033233|Ga0334722_10500313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300033233|Ga0334722_10790753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300034105|Ga0335035_0073776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2223 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 32.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.30% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.12% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.72% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.33% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.15% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.15% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.15% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.57% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.18% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.18% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.18% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.18% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.18% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.18% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.18% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.18% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.79% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.79% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.39% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.39% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.39% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.39% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.39% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.39% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.39% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.39% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300002301 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI co-culture FSW-F8 | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300025455 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes) | Environmental | Open in IMG/M |
3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM30_10856862 | 3300001842 | Marine Plankton | MGVMLSVIVGTTTMAYIETLYMKAQLKKEIAELRELKKELQNVQSN* |
JGI24891J29808_10104701 | 3300002301 | Lentic | IGWILTAVALCLIVGVTSMAYIETLYMKAQLKREIKELRRLKQELKEK* |
JGI24890J29729_10166503 | 3300002307 | Lentic | VALCIIVATTSIAYIETLYMKAQLKKEIKELRKLKQELKK* |
Water_1007852 | 3300002930 | Estuary Water | VALCLIVATTSIAYIETLYMKSQLKQEIRELRKLKRELKESK* |
Water_1035773 | 3300002930 | Estuary Water | LCVIVATTSIAYIETMYMKAQLKREIKELRRLKQELKESK* |
JGI25908J49247_100072026 | 3300003277 | Freshwater Lake | LIGVAVCIIVAVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK* |
JGI25908J49247_101385731 | 3300003277 | Freshwater Lake | MAVMLCVVVGTTSMAYIETLYMKAQLKKEMKELRKLKQELKESK* |
JGI25912J50252_100311995 | 3300003412 | Freshwater Lake | LIGVAVCITVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK* |
JGI25912J50252_101655872 | 3300003412 | Freshwater Lake | AVCIIVGVTSMAYVETLYMRAQLKQEMKELRKLKQELKESK* |
JGI25913J50563_10636062 | 3300003431 | Freshwater Lake | MLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKESK* |
Ga0007787_105970961 | 3300004240 | Freshwater Lake | MLCVVVGATSMAYVETLYMKAQLKREMKELRKLKQELKETK* |
Ga0007797_11927452 | 3300004771 | Freshwater | LCIIVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK* |
Ga0007792_100550211 | 3300004805 | Freshwater | LTGVALCLIVATTSIAYIETLYMKAQLKREIKELRKLKQELKK* |
Ga0007792_101980272 | 3300004805 | Freshwater | LSAVALCIIVATTSLAYIETLYMKAQLKKEIKELRKLKQELKK* |
Ga0007792_102010201 | 3300004805 | Freshwater | LTGVALCLIVATTSIAYIETLYMKAQLKREIKELRKLKQELKENK* |
Ga0007792_102112092 | 3300004805 | Freshwater | LCIIVATTSIAYIETMYMKAQLKREIKELRRLKQELKESK* |
Ga0071350_10173693 | 3300005069 | Freshwater | MLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKETK* |
Ga0068877_102799211 | 3300005525 | Freshwater Lake | LIGVAICIIVAATSMAYVETLYMRAQLKQEIKELRKLKRELKEQK* |
Ga0049081_100078866 | 3300005581 | Freshwater Lentic | MGVMLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKETK* |
Ga0049081_100331383 | 3300005581 | Freshwater Lentic | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK* |
Ga0049081_101257941 | 3300005581 | Freshwater Lentic | MGVMLCVVVGATSMAYLETLYMKAQLKKEMKELRKLKQELKESK |
Ga0049081_102299531 | 3300005581 | Freshwater Lentic | GVAICLIVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK* |
Ga0049081_102720672 | 3300005581 | Freshwater Lentic | LIGVAVCIIVAVTSIAYVETLYMRAQLKQEIKELRKLKRELKESK* |
Ga0049081_103329892 | 3300005581 | Freshwater Lentic | CVVVGTTSMAYIETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0049082_102047063 | 3300005584 | Freshwater Lentic | VTSMAYVETLYMRAQLKQEIKELRKLKRELKESK* |
Ga0049084_102993822 | 3300005585 | Freshwater Lentic | MAVMLCVVVGATSVAYIETLYMKAQLKKEIKELRKLKQELKESK* |
Ga0073926_100696422 | 3300005943 | Sand | MAVMLCVVVGATSMAYIETLYMKAQLKREMKELRKLKQELKESK* |
Ga0075464_104133813 | 3300006805 | Aqueous | ATTSIAYIETMYMKAQLKQEIKELRKLKRELKESK* |
Ga0075473_103937542 | 3300006875 | Aqueous | LCIIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKESK* |
Ga0070748_12585431 | 3300006920 | Aqueous | VATTSIAYIETLYMKNQLKQEIKELRKLKRELKKNE* |
Ga0102877_11200812 | 3300007548 | Estuarine | MLCVVVGATSMAYVETLYMKAQLKKEIKELRKLKQELKESK* |
Ga0102859_11035482 | 3300007708 | Estuarine | LIGVALCLVVATTSIAYIETMYMKAQLKQEMKELRKLKRELKESK* |
Ga0104988_1067428 | 3300007735 | Freshwater | LALCIIVATTSLAYIETLYMKAQLKREMKELRKLKQELKEK* |
Ga0105747_10127384 | 3300007974 | Estuary Water | LIGVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK* |
Ga0105747_10262895 | 3300007974 | Estuary Water | ICIIVGVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK* |
Ga0105747_12286122 | 3300007974 | Estuary Water | MLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKEK* |
Ga0108970_103125293 | 3300008055 | Estuary | LIVAVTSIAYVETLYMRAQLKQEMKELRKLKRELKEQK* |
Ga0114340_100081430 | 3300008107 | Freshwater, Plankton | MLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELRETK* |
Ga0114340_10612753 | 3300008107 | Freshwater, Plankton | MAVMLCVVVGATSVAYIETLYMKAQLKREIKELRKLKQELKESK* |
Ga0114340_11114482 | 3300008107 | Freshwater, Plankton | LIGVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKKELKEK* |
Ga0114340_11405572 | 3300008107 | Freshwater, Plankton | MAVMLCVVVGATSMAYIETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0114841_10050103 | 3300008259 | Freshwater, Plankton | MAVMLCVVVGTTSMAYIETLYMKAQLKKEIKELRKLKQELKESK* |
Ga0114841_10470722 | 3300008259 | Freshwater, Plankton | MLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKETK* |
Ga0114363_10152446 | 3300008266 | Freshwater, Plankton | MGVMLCVVVGATSMAYVETLYMKAQLKKEIKELRKLKQELKESK* |
Ga0114363_10370792 | 3300008266 | Freshwater, Plankton | MSVMLCVVVGATSIAYVETLYMKAQLKKEIKELRKLKQELKESK* |
Ga0114363_11462121 | 3300008266 | Freshwater, Plankton | MAVMLCVVVGATSVEYIETLYMKAQLKREIKELRKLKQELKESK* |
Ga0114364_100719612 | 3300008267 | Freshwater, Plankton | MLCIVVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK* |
Ga0114364_10263811 | 3300008267 | Freshwater, Plankton | MLCIVVGATSMAYVETLYMKAQLKREMKELRKLKQELKESK* |
Ga0114364_11143481 | 3300008267 | Freshwater, Plankton | VGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK* |
Ga0114364_11881461 | 3300008267 | Freshwater, Plankton | VGATSMAYVETLYMKAQLKREMKELRKLKQELKETK* |
Ga0114876_11326042 | 3300008448 | Freshwater Lake | LIGVAICVVVGVTSMAYVETLYMKAQLKQEMKELRKLKRELKESK* |
Ga0114876_12047042 | 3300008448 | Freshwater Lake | MLCVVVGATSMAYVETLYMKAQLKREMKELRKLKQELKESK* |
Ga0114876_12570221 | 3300008448 | Freshwater Lake | MLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0114880_11818561 | 3300008450 | Freshwater Lake | VLIGVMLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKETK* |
Ga0102829_10668932 | 3300009026 | Estuarine | LIGVAICIVVGVTSMAYVETIYMRAQLKQEMKELRKLKRELKEQK* |
Ga0114973_101268204 | 3300009068 | Freshwater Lake | LSAVALCIIVATTSIAYIETLYMKAQLKREIKELRKLKQELKK* |
Ga0114973_104123732 | 3300009068 | Freshwater Lake | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKEAK* |
Ga0114962_100439198 | 3300009151 | Freshwater Lake | MCLIVATTSIAYIETLYMKAQLKQEMKELRKLKREIKESK* |
Ga0114962_100501765 | 3300009151 | Freshwater Lake | VALCIIVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK* |
Ga0114962_101799402 | 3300009151 | Freshwater Lake | MCLIVATTSIAYIETLYMKAQLKQEIKELRKLKREIKESK* |
Ga0114962_103313583 | 3300009151 | Freshwater Lake | CVIVGVTSMAYIETLYMKAQLRQEIKELRKLKREIKEAK* |
Ga0114962_104699211 | 3300009151 | Freshwater Lake | GVAICVIVGVTSMAYVETLYMKAQLRQEMKELRKLKRELKEQK* |
Ga0114962_104912513 | 3300009151 | Freshwater Lake | VVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK* |
Ga0114980_100325223 | 3300009152 | Freshwater Lake | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKESK* |
Ga0114980_100749682 | 3300009152 | Freshwater Lake | VALCIIVATTSIAYIETLYMKAQLKKEIKELRKLKQELKENK* |
Ga0114980_102648433 | 3300009152 | Freshwater Lake | MSVTLCVVVGATSVAYIETLYMKAQLKKEIKELRKLKQELKENK* |
Ga0114980_103513822 | 3300009152 | Freshwater Lake | LTGVALCIIVATTSIAYVETLYMKAQLKKEIKELRKLKQELKK* |
Ga0114980_106369992 | 3300009152 | Freshwater Lake | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKKELKESK* |
Ga0114963_103067943 | 3300009154 | Freshwater Lake | VGWVLIAVAMCLIVATTSIAYIETLYMKAQLKQEIKELRKLKREIKESK* |
Ga0114963_105124851 | 3300009154 | Freshwater Lake | IVATTSIAYIETLYMKAQLKREIKELRKLKQELKK* |
Ga0114968_101580102 | 3300009155 | Freshwater Lake | VALCIIVATTSIAYIETLYMKAQLKKEIKELRRLKQELKENK* |
Ga0114968_102087611 | 3300009155 | Freshwater Lake | LIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK* |
Ga0114968_102750071 | 3300009155 | Freshwater Lake | VGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK* |
Ga0114977_100002877 | 3300009158 | Freshwater Lake | MSVTLCIVVGATSIAYVETLYMKAQLKKEIKELRKLKQELKESK* |
Ga0114977_101568304 | 3300009158 | Freshwater Lake | ICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK* |
Ga0114977_104430533 | 3300009158 | Freshwater Lake | IVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK* |
Ga0114978_101083345 | 3300009159 | Freshwater Lake | VALCLIVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK* |
Ga0114978_107744542 | 3300009159 | Freshwater Lake | IWWVLIGVMLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0114978_107770771 | 3300009159 | Freshwater Lake | LCLVVATTSIAYIETLYMKAQLKQEMKELRKLKREIKESK* |
Ga0114966_100699505 | 3300009161 | Freshwater Lake | LIGVAVCLIVAVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK* |
Ga0114966_102438354 | 3300009161 | Freshwater Lake | GWVLSAVALCLIVATTSIAYIETLYMKSQLKQEIRELRKLKRELKESK* |
Ga0114966_102520971 | 3300009161 | Freshwater Lake | VAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK* |
Ga0114966_105379423 | 3300009161 | Freshwater Lake | VATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK* |
Ga0114970_1000160513 | 3300009163 | Freshwater Lake | LIGVAICLVVGVTSMAYVETLYMKAQIKKEIKELRKLKQELKESK* |
Ga0114970_103625342 | 3300009163 | Freshwater Lake | MAVMLCVVVGATSMAYIETLYMKAQLKKEIKELRKLKQELKESK* |
Ga0114970_105450543 | 3300009163 | Freshwater Lake | CLIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK* |
Ga0114970_105610361 | 3300009163 | Freshwater Lake | GWVLSAVALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKESK* |
Ga0114975_101248743 | 3300009164 | Freshwater Lake | MCLIVATTSIAYIETLYMKAQLKQEIKELRKLKREIKENK* |
Ga0114969_103991001 | 3300009181 | Freshwater Lake | IVATTSIAYIETMYMKAQLKREIKELRRLKQELKESK* |
Ga0114974_103094842 | 3300009183 | Freshwater Lake | MSVTLCVVVGATSVAYIETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0114974_103245011 | 3300009183 | Freshwater Lake | GVTSMAYVETLYMKAQLKQEIKELRKLKRELKEK* |
Ga0114974_105369012 | 3300009183 | Freshwater Lake | VALCIIVATTSIAYIETMYMKAQLKREIKELRRLKQELKESK* |
Ga0114974_105765352 | 3300009183 | Freshwater Lake | LIGVAVCLVVAVTSMAYVETLYMKAQLKQEMKELRKLKRELKESK* |
Ga0114976_100418582 | 3300009184 | Freshwater Lake | LIGVAICVIVGVTSMAYIETLYMKAQLRQEMKELRKLKREIKEAK* |
Ga0114976_100714316 | 3300009184 | Freshwater Lake | IGVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK* |
Ga0114976_102147913 | 3300009184 | Freshwater Lake | LSAVALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKESK* |
Ga0114976_102396273 | 3300009184 | Freshwater Lake | MCLIVATTSIAYIETLYMKAQLKQEIKELRKLKRELKESK* |
Ga0114982_10355644 | 3300009419 | Deep Subsurface | WWVLIGVMLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKETK* |
Ga0114958_102082083 | 3300009684 | Freshwater Lake | VALCIIVATTSIAYIETMYMKAQLKREIKELRKLKQ |
Ga0114958_103597973 | 3300009684 | Freshwater Lake | GVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK* |
Ga0114958_103660132 | 3300009684 | Freshwater Lake | VAICVIVGVTSMAYIETLYMKAQLRQEMKELRKLKQEIKEAK* |
Ga0114958_106235642 | 3300009684 | Freshwater Lake | GVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK* |
Ga0114964_100637135 | 3300010157 | Freshwater Lake | VALCIIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKESK* |
Ga0114960_100063642 | 3300010158 | Freshwater Lake | LTAVALCIIVGTTSMAYIETLYMKAQLKREIKELRKLKQELKEQK* |
Ga0114967_104410472 | 3300010160 | Freshwater Lake | VALCIIIATTSIAYIETMYMKAQLKREIKELRRLKQELKESK* |
Ga0114967_105905961 | 3300010160 | Freshwater Lake | VGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK* |
Ga0136644_100818225 | 3300010334 | Freshwater Lake | VALCLIVATTSIAYIETLYMKAQLKREIKELRKLKQELKK* |
Ga0136644_104495731 | 3300010334 | Freshwater Lake | IVGVTSMAYVETLYMKAQLKREIKELRKLKLELTKEK* |
Ga0136644_106840062 | 3300010334 | Freshwater Lake | WVLSAVALCIIVATTSIAYIETLYMKAQLKKEIKELRKLKQELKENK* |
Ga0114986_10363361 | 3300010374 | Deep Subsurface | VVVGATSMAYVETLYMKAQLKREIKELRKLKQELKETK* |
Ga0133913_114420253 | 3300010885 | Freshwater Lake | LIGVAICVIVGVTSMAYIETLYMKAQLRQEMKELRKLKQEIKEAK* |
Ga0133913_114470344 | 3300010885 | Freshwater Lake | VVLTSLAYIETLYIRSQLKQEIKELRQLKRQLKEKADE* |
Ga0133913_132165841 | 3300010885 | Freshwater Lake | GVAICVIVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK* |
Ga0139557_10205042 | 3300011010 | Freshwater | MGVMLCVVVGATSMAYLETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0139556_10782661 | 3300011011 | Freshwater | VAVCIIVAVTSIAYVETLYMRAQLKQEIKELRKLKRELKESK* |
Ga0151516_1027843 | 3300011116 | Freshwater | LSGVALCIIVATTSLAYIETLYMKAQLKKEIKELRKLKQELKK* |
Ga0151516_1047810 | 3300011116 | Freshwater | LSAVALCVIVATTSLAYIETLYMKAQLKKEIKELRRLKQELKESK* |
Ga0151516_1081526 | 3300011116 | Freshwater | LSALALCIIVATTSIAYIETLYMKAQLKREIKELQKLKQELKEK* |
Ga0151620_11835242 | 3300011268 | Freshwater | LIGVMLCVVVGATSMAYVETLYMRAQLKQEIKELRKLKRELKESK* |
Ga0153697_15253 | 3300011334 | Freshwater | VALCVIVATTSIAYIETLYMKAQLKQEIRELRKLKKELKESK* |
Ga0153800_10271092 | 3300011995 | Freshwater | MGVMLCVVVGATSMAYIETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0153799_100021835 | 3300012012 | Freshwater | MLCIVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0153805_10412472 | 3300012013 | Surface Ice | ATSMAYVETLYMKAQLKREIKELRKLKQELKETK* |
Ga0164295_112673142 | 3300013014 | Freshwater | LIGVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLK |
Ga0136642_10091599 | 3300013285 | Freshwater | VGVTSMAYIETLYMKAQLKREIRELRKLKQELKK* |
Ga0136641_10010028 | 3300013286 | Freshwater | LIGVAICIIVGVTTMAYVETLYMRAQLKQEIKELRKLKRELKESK* |
Ga0136641_10544231 | 3300013286 | Freshwater | VLAGVALCIIVATTSIAYIETLYMKAQLKKEIKELRKLKQELKEQK* |
Ga0136641_11702911 | 3300013286 | Freshwater | VLAGVALCIIVATTSIAYIETLYMKAQLKKEIKELRKLKQELKK* |
Ga0177922_103812403 | 3300013372 | Freshwater | ICIVVGVTGMAYIETLYMKSQLKQEMKELRKLKRELKESK* |
Ga0119952_10494432 | 3300014050 | Freshwater | LSAVALCVIVATTSLAYIETLYMKAQLKREIKELRRLKEELKESK* |
Ga0182021_125086322 | 3300014502 | Fen | LTAVALCIVVGTTSMSYVETLYMKAQLKREIKELRRLKQELKESK* |
Ga0181338_10180703 | 3300015050 | Freshwater Lake | MLCIIVGATSMAYVETLYMKAQLKKEMKELRKLKQELKESK* |
Ga0181338_10265772 | 3300015050 | Freshwater Lake | VALCLIVATTSIAYIETLYMKTQLKQEIKELRKLKKELKESK* |
Ga0181338_10368863 | 3300015050 | Freshwater Lake | LCIIVATTSIAYIETLYMKAQLKREIKELRKLKQELKENK* |
Ga0181363_10183165 | 3300017707 | Freshwater Lake | AICVIVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKEQK |
Ga0181350_10031196 | 3300017716 | Freshwater Lake | MGVMLCVVVGATSMAYIETLYMKAQLKKEIKELRKLKQELKESK |
Ga0181350_10541651 | 3300017716 | Freshwater Lake | MLCIVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKESK |
Ga0181362_11065612 | 3300017723 | Freshwater Lake | LIGVAVCIIVAVTSIAYVETLYMRAQLKQEIKELRKLKRELKESK |
Ga0181365_10228791 | 3300017736 | Freshwater Lake | LIGWVLAGAALCIIVATTSIAYIETLYMKAQLKKEIKELRKLKQELKENK |
Ga0181352_11541062 | 3300017747 | Freshwater Lake | VAICVIVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK |
Ga0181344_10053196 | 3300017754 | Freshwater Lake | VAICIVVGVTSMAYIETLYMKAQLKQEIKELRRLKRELKEQK |
Ga0181344_10926302 | 3300017754 | Freshwater Lake | LIGVAICIIVGVTSMAYVETLYMKAQLRQEIKELRKLKKELKEK |
Ga0181344_11088071 | 3300017754 | Freshwater Lake | AICVIVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK |
Ga0181356_11021541 | 3300017761 | Freshwater Lake | IVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0181356_11976962 | 3300017761 | Freshwater Lake | MGVMLCVVVGATSMAYVETLYMKAQLKKEIKELRKLKQELKETK |
Ga0181343_11212751 | 3300017766 | Freshwater Lake | CLIVGVTSMAYVETLYMKAQIKKEIKELRKLKQELKESK |
Ga0181343_11456541 | 3300017766 | Freshwater Lake | LIWWVLIGVMLCVVVGATSMAYVETLYMKAQLKREMKELRKLKQELKETK |
Ga0181343_11647711 | 3300017766 | Freshwater Lake | TSIAYIETLFMKAQLKREIKELRKLKQELKENKXFQ |
Ga0181358_10186382 | 3300017774 | Freshwater Lake | MSVTLCIVVGATSIAYVETLYMKAQLKKEMKELRKLKQELKESK |
Ga0181358_11132361 | 3300017774 | Freshwater Lake | GVAICIIVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0181357_11355142 | 3300017777 | Freshwater Lake | MLCIVVGATSMAYVETLYMKAQLKREIKELRKLKQEIKDSK |
Ga0181357_12501681 | 3300017777 | Freshwater Lake | GVAICIIVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK |
Ga0181349_11282812 | 3300017778 | Freshwater Lake | VVALCIIVATTSIAYIETLYMKAQLKKEIKELRKLKQELKEQK |
Ga0181349_11672322 | 3300017778 | Freshwater Lake | MGVMLCVVVGATSMAYLETLYMKAQLKKEMKELRKLKQELKETK |
Ga0181346_11644332 | 3300017780 | Freshwater Lake | VALCLIVATTSIAYIETLYMKTQLKQEIKELRKLKRELKEAK |
Ga0181346_12251773 | 3300017780 | Freshwater Lake | IGVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0181346_13305902 | 3300017780 | Freshwater Lake | MLCIVVGATSMAYVETLYMKAQLKREIKELRKLKQELKESK |
Ga0181348_11362543 | 3300017784 | Freshwater Lake | IGVAVCIIVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK |
Ga0181348_11735212 | 3300017784 | Freshwater Lake | VALCLIVATPSIAYIETLYMKTQLKQEIKELRKLKKELKESK |
Ga0181355_12087402 | 3300017785 | Freshwater Lake | LCVIVATTSIAYIETMYMKAQLKREIKELRKLKQELKENK |
Ga0181553_103463162 | 3300018416 | Salt Marsh | LSAVALCVIVATTSLAYIETLYMKAQLKKEIKELRRLKQELKESK |
Ga0181359_10459021 | 3300019784 | Freshwater Lake | VAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0181359_10928291 | 3300019784 | Freshwater Lake | MAVMLCVVVGTTSMAYIETLYMKAQLKKEMKELRKLKQELKESK |
Ga0181359_11286612 | 3300019784 | Freshwater Lake | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKKELKESK |
Ga0207193_12615094 | 3300020048 | Freshwater Lake Sediment | LIGVAICLVVGVTSMAYVETLYMKAQIKKEIKELRKLKQELKESK |
Ga0194038_10643453 | 3300020158 | Anoxic Zone Freshwater | MCLIVATTSIAYIETLYMKAQLKQEIKELRKLKREIKESK |
Ga0211734_101618881 | 3300020159 | Freshwater | MAVMLCVVVGATSIAYVETLYMRAQLKREIKELRKLKQELKESK |
Ga0211734_109643522 | 3300020159 | Freshwater | MLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKESK |
Ga0194035_12150862 | 3300020167 | Anoxic Zone Freshwater | LCLIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK |
Ga0211729_111414792 | 3300020172 | Freshwater | MGVMLCVVVGATSMAYVETLYMKAQLKKEIKELRKLKQELKESK |
Ga0214206_10186321 | 3300021131 | Freshwater | LIGVAICIVVGVTSMAYVETLYMRAQLKQEIKELRKLKQEIKNAKSD |
Ga0213920_10827001 | 3300021438 | Freshwater | ICIVVGVTSMAYVETLYMKAQLRQEIKELRKLKRELKEK |
Ga0194048_103687212 | 3300021519 | Anoxic Zone Freshwater | LIGVAICVIVGVTSMAYIETLYMKAQLRQEMKELRKLKREIKEAK |
Ga0213921_10341662 | 3300021952 | Freshwater | MGVMLCVVVGATSMAYVETLYMKAQLKKEIKELRKLKQELKEK |
Ga0213922_10744181 | 3300021956 | Freshwater | CIVVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKEK |
Ga0222714_105188402 | 3300021961 | Estuarine Water | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK |
Ga0222713_100219843 | 3300021962 | Estuarine Water | LSAVALCVIVATTSLAYIETLYMKAQLKREIKELRRLKQELKESK |
Ga0222713_101424731 | 3300021962 | Estuarine Water | IGWVLSAVALCVIVATTSLAYIETLYMKAQLKREIKELRRLKQELKESK |
Ga0222713_101713052 | 3300021962 | Estuarine Water | MLCVVVGATSMAYVETLYMKAQLKREMKELRKLKQELKESK |
Ga0222712_1000438012 | 3300021963 | Estuarine Water | GWVLSAVALCVIVATTSLAYIETLYMKAQLKREIKELRRLKQELKESK |
Ga0222712_101779612 | 3300021963 | Estuarine Water | LIGVMLCVVVGATSMAYVETLYMRAQLKQEIKELRKLKRELKESK |
Ga0222712_103684643 | 3300021963 | Estuarine Water | VLIGVMLCVVVGATSMAYVETLYMKAQLKREMKELRKLKQELKETK |
Ga0222712_105881791 | 3300021963 | Estuarine Water | LIGVMLCVVVGATSMAYVETLYMKAQLKREMKELRKLKQELKEK |
Ga0181353_10952041 | 3300022179 | Freshwater Lake | VGATSMAYVETLYMKAQLKREIKELRKLKQELKETK |
Ga0181354_10404981 | 3300022190 | Freshwater Lake | VALCLIVATTSIAYIETLYMKTQLKQEIKELRKLKKELKESK |
Ga0181351_11806282 | 3300022407 | Freshwater Lake | GTTSMAYIETLYMKAQLKKEMKELRKLKQELKESK |
Ga0181351_12688142 | 3300022407 | Freshwater Lake | ECIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0228701_11260442 | 3300022746 | Freshwater | MGVMLCVVVGTTSMAYVETLYMKAQLKKEIKELRKLKQELKEK |
Ga0214917_100642785 | 3300022752 | Freshwater | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKEAK |
Ga0255147_10004763 | 3300024289 | Freshwater | MGVMLCVVVGATSMAYVETLYMKAQLKREMKELRKLKEELREKK |
Ga0208376_10739541 | 3300025455 | Freshwater | CIIVATTSLAYIETLYMKAQLKKEIKELRKLKQELKK |
Ga0207954_10473442 | 3300025606 | Freshwater | VALCIIVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK |
Ga0255106_10335481 | 3300027125 | Freshwater | VVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKETK |
Ga0255104_10062513 | 3300027146 | Freshwater | MLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKETK |
Ga0209247_10369003 | 3300027468 | Freshwater Lake | ITVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK |
Ga0208951_11485281 | 3300027621 | Freshwater Lentic | GVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0208975_10070743 | 3300027659 | Freshwater Lentic | MGVMLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKETK |
Ga0208975_10999981 | 3300027659 | Freshwater Lentic | LCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKESK |
Ga0209188_10317215 | 3300027708 | Freshwater Lake | CIVVGVTSMAYVETLYMKAQLKQEIKELRKLKRELKEK |
Ga0209599_100671251 | 3300027710 | Deep Subsurface | WWVLIGVMLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKETK |
Ga0209297_10368833 | 3300027733 | Freshwater Lake | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKRELKESK |
Ga0209297_11971231 | 3300027733 | Freshwater Lake | IVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK |
Ga0209087_100028044 | 3300027734 | Freshwater Lake | LTGVALCIIVATTSIAYVETLYMKAQLKKEIKELRKLKQELKK |
Ga0209087_10131047 | 3300027734 | Freshwater Lake | VIVGVTSMAYVETLYMKAQLKQEMKELRKLKRELKESK |
Ga0209087_10259217 | 3300027734 | Freshwater Lake | VALCLIVATTSIAYIETLYMKSQLKQEIRELRKLKRELKESK |
Ga0209087_11246394 | 3300027734 | Freshwater Lake | VALCIIVATTSIAYIETMYMKAQLKREIKELRRLKQELKESK |
Ga0209190_10196253 | 3300027736 | Freshwater Lake | VALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKEAK |
Ga0209190_10623772 | 3300027736 | Freshwater Lake | LSAVALCIIVATTSIAYIETLYMKAQLKREIKELRKLKQELKK |
Ga0209190_12543641 | 3300027736 | Freshwater Lake | GVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK |
Ga0209189_11304833 | 3300027747 | Freshwater Lake | LIGVAICLIVGVTSMAYVETLYMKAQLKQEIKELRKLKRELKEDK |
Ga0209084_100468111 | 3300027749 | Freshwater Lake | VALCLIVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK |
Ga0209084_10667712 | 3300027749 | Freshwater Lake | LIGVAICVIVGVTSMAYIETLYMKAQLRQEMKELRKLKQEIKEAK |
Ga0209596_12519731 | 3300027754 | Freshwater Lake | GCVALCIIVATTSIAYIETMYMKAQLKREIKELRRLKQELKESK |
Ga0209088_100477504 | 3300027763 | Freshwater Lake | LIGVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0209086_100652035 | 3300027770 | Freshwater Lake | IGVAVCLIVAVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK |
Ga0209829_100824526 | 3300027777 | Freshwater Lake | MCLIVATTSIAYIETLYMKAQLKQEMKELRKLKREIKESK |
Ga0209500_103299442 | 3300027782 | Freshwater Lake | MSVTLCVVVGATSVAYIETLYMKAQLKKEMKELRKLKQELKESK |
Ga0209354_100106565 | 3300027808 | Freshwater Lake | VALCVIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK |
Ga0209400_11296101 | 3300027963 | Freshwater Lake | IVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK |
Ga0209400_13168321 | 3300027963 | Freshwater Lake | GVAICIVVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKESK |
Ga0209191_11011511 | 3300027969 | Freshwater Lake | GVTSMAYVETLYMRAQLKQEIKELRKLKRELKEQK |
Ga0209401_10301581 | 3300027971 | Freshwater Lake | SAVALCLIVATTSIAYIETLYMKAQLKQEIRELRKLKQELKESK |
Ga0247723_10071602 | 3300028025 | Deep Subsurface Sediment | MGVMLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKESK |
Ga0247723_10117171 | 3300028025 | Deep Subsurface Sediment | GVAICVIVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKESK |
Ga0247723_11516582 | 3300028025 | Deep Subsurface Sediment | VLIGVMLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKESK |
Ga0304729_10877753 | 3300028392 | Freshwater Lake | GVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0304729_10952461 | 3300028392 | Freshwater Lake | RLIGWVLSAVALCLIVATTSIAYIETMYMKAQLKREIKELRKLKQELKESK |
Ga0304729_11569372 | 3300028392 | Freshwater Lake | LTAVALCIIVGTTSMAYIETLYMKAQLKREIKELRKLKQELKEQK |
Ga0304728_11800411 | 3300028393 | Freshwater Lake | LCIIVATTSIAYIETLYMKAQLKREIKELRKLKQELKENK |
Ga0304730_13153692 | 3300028394 | Freshwater Lake | CVVVGATSMAYVETLYMKAQLKREMKELRKLKQELKESK |
Ga0311349_114961013 | 3300030294 | Fen | IIVATTSIAYIETLYMKAQLKREIKELRKLKQELKENK |
Ga0307375_108590401 | 3300031669 | Soil | VVGVTSMAYVETLYMRAQLKQEMKELRKLKRELKEQK |
Ga0307377_106673323 | 3300031673 | Soil | ICVIVGVTSMAYVETLYMKAQLKQEMKELRKLKRELKESK |
Ga0315291_108993441 | 3300031707 | Sediment | IIVGVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK |
Ga0315291_112006422 | 3300031707 | Sediment | LIGVAVCIIVAVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK |
Ga0315899_100062121 | 3300031784 | Freshwater | MLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELRETK |
Ga0315900_1000190620 | 3300031787 | Freshwater | MLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKETK |
Ga0315900_100298295 | 3300031787 | Freshwater | MAVMLCVVVGATSVAYIETLYMKAQLKREIKELRKLKQELKESK |
Ga0315900_100310177 | 3300031787 | Freshwater | MSVMLCVVVGATSIAYVETLYMKAQLKKEIKELRKLKQELKESK |
Ga0315900_100876464 | 3300031787 | Freshwater | LIGVAICVVVGVTSMAYVETLYMKAQLKQEMKELRKLKRELKESK |
Ga0315904_100786781 | 3300031951 | Freshwater | MSVTLCIVVGATSIAYVETLYMKAQLKKEIKEFRKLKAEIKK |
Ga0315904_106329481 | 3300031951 | Freshwater | IGVMLCVVVGATSMAYVETLYMKAQLKREIKELRKLKQELKESK |
Ga0315294_106428972 | 3300031952 | Sediment | MGVMLCVVVGATSMAYVETLYMKAQLKKEMKELRKLKQELKESK |
Ga0315274_106288751 | 3300031999 | Sediment | VATTSIDYIETLYMKAQLKQEIRELRKLKRELKESK |
Ga0315274_116616251 | 3300031999 | Sediment | VGATSMAYVETLYMKAQLKREMKELRKLKQELKESK |
Ga0315284_112687691 | 3300032053 | Sediment | IGVAICIIVGVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK |
Ga0315284_113600882 | 3300032053 | Sediment | LIGVALCLVVATTSIAYIETMYMKAQLKQEMKELRKLKRELKESK |
Ga0315902_109242561 | 3300032093 | Freshwater | ICIIVAATSMAYVETLYMRAQLKQEMKELRKLKRELKENK |
Ga0315277_108596463 | 3300032118 | Sediment | LALCIIVATTSISYIETLYMKAQLKREIKELRKLKQELKENKXFQ |
Ga0315270_108234232 | 3300032275 | Sediment | AICIIVGVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK |
Ga0315275_109594271 | 3300032401 | Sediment | IVGVTSLSYIETMYMKAQLKQEMKELRKLKRELKESK |
Ga0334722_105003132 | 3300033233 | Sediment | LIGVAVCIIVGITSMAYVETLYMRAQLKQEMKELRKLKRELKESK |
Ga0334722_107907533 | 3300033233 | Sediment | IIVGVTSMAYVETLYMRAQLKQEIKELRKLKRELKEQK |
Ga0335035_0073776_305_430 | 3300034105 | Freshwater | MLCVVVGATSMAYVETLYMKAQLKKEIKELRKLKQELKESK |
⦗Top⦘ |