NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015240

Metagenome / Metatranscriptome Family F015240

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015240
Family Type Metagenome / Metatranscriptome
Number of Sequences 256
Average Sequence Length 48 residues
Representative Sequence MAGKADFTEDEWDALQKGVTGAGMLVSVADRDFTDSFGEA
Number of Associated Samples 205
Number of Associated Scaffolds 256

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.44 %
% of genes near scaffold ends (potentially truncated) 98.05 %
% of genes from short scaffolds (< 2000 bps) 96.48 %
Associated GOLD sequencing projects 194
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.031 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.797 % of family members)
Environment Ontology (ENVO) Unclassified
(26.562 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.453 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.59%    β-sheet: 0.00%    Coil/Unstructured: 54.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 256 Family Scaffolds
PF01435Peptidase_M48 6.25
PF01654Cyt_bd_oxida_I 3.12
PF02627CMD 1.95
PF01594AI-2E_transport 1.95
PF09851SHOCT 1.95
PF07883Cupin_2 1.95
PF07690MFS_1 1.95
PF00196GerE 1.56
PF11146DUF2905 1.17
PF03364Polyketide_cyc 1.17
PF11790Glyco_hydro_cc 1.17
PF02350Epimerase_2 1.17
PF03976PPK2 0.78
PF00294PfkB 0.78
PF12802MarR_2 0.78
PF02604PhdYeFM_antitox 0.78
PF04879Molybdop_Fe4S4 0.78
PF01738DLH 0.78
PF01740STAS 0.78
PF01471PG_binding_1 0.78
PF06897DUF1269 0.78
PF10011DUF2254 0.78
PF17032zinc_ribbon_15 0.78
PF00753Lactamase_B 0.78
PF00689Cation_ATPase_C 0.78
PF01863YgjP-like 0.78
PF04011LemA 0.39
PF00773RNB 0.39
PF00501AMP-binding 0.39
PF13561adh_short_C2 0.39
PF07755DUF1611 0.39
PF06224HTH_42 0.39
PF13091PLDc_2 0.39
PF05995CDO_I 0.39
PF00582Usp 0.39
PF08281Sigma70_r4_2 0.39
PF04228Zn_peptidase 0.39
PF13412HTH_24 0.39
PF00571CBS 0.39
PF01042Ribonuc_L-PSP 0.39
PF04024PspC 0.39
PF00892EamA 0.39
PF00486Trans_reg_C 0.39
PF00011HSP20 0.39
PF04226Transgly_assoc 0.39
PF09900DUF2127 0.39
PF00676E1_dh 0.39
PF00392GntR 0.39
PF00837T4_deiodinase 0.39
PF06271RDD 0.39
PF01312Bac_export_2 0.39
PF05988DUF899 0.39
PF03147FDX-ACB 0.39
PF00990GGDEF 0.39
PF03706LPG_synthase_TM 0.39
PF05872HerA_C 0.39
PF01058Oxidored_q6 0.39
PF01022HTH_5 0.39
PF14026DUF4242 0.39
PF01391Collagen 0.39
PF07452CHRD 0.39
PF04545Sigma70_r4 0.39
PF00370FGGY_N 0.39
PF01182Glucosamine_iso 0.39
PF14087DUF4267 0.39
PF06772LtrA 0.39
PF03807F420_oxidored 0.39
PF00274Glycolytic 0.39
PF02322Cyt_bd_oxida_II 0.39
PF08808RES 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 256 Family Scaffolds
COG1271Cytochrome bd-type quinol oxidase, subunit 1Energy production and conversion [C] 3.12
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 1.95
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 1.95
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.95
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 1.17
COG0707UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferaseCell wall/membrane/envelope biogenesis [M] 1.17
COG1451UTP pyrophosphatase, metal-dependent hydrolase familyGeneral function prediction only [R] 0.78
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.78
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.78
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.78
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.78
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.78
COG1294Cytochrome bd-type quinol oxidase, subunit 2Energy production and conversion [C] 0.39
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.39
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.39
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.39
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.39
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.39
COG2321Predicted metalloproteaseGeneral function prediction only [R] 0.39
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.39
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.39
COG3367Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase familyGeneral function prediction only [R] 0.39
COG3588Fructose-bisphosphate aldolase class 1Carbohydrate transport and metabolism [G] 0.39
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.39
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.39
COG4776Exoribonuclease IITranscription [K] 0.39
COG5553Predicted metal-dependent enzyme of the double-stranded beta helix superfamilyGeneral function prediction only [R] 0.39
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.39
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.39
COG0072Phenylalanyl-tRNA synthetase beta subunitTranslation, ribosomal structure and biogenesis [J] 0.39
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.39
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.39
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.39
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.39
COG0433Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domainsReplication, recombination and repair [L] 0.39
COG0557Exoribonuclease RTranscription [K] 0.39
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.39
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.03 %
UnclassifiedrootN/A17.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459007|GJ8XV2H01BMMW1All Organisms → cellular organisms → Bacteria512Open in IMG/M
2170459019|G14TP7Y01BPNT7All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104923677All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300000789|JGI1027J11758_12568183All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300000858|JGI10213J12805_10006933All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300000891|JGI10214J12806_11120405All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300000956|JGI10216J12902_100565973All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300000956|JGI10216J12902_104243743Not Available571Open in IMG/M
3300000956|JGI10216J12902_105004038All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300001213|JGIcombinedJ13530_100986053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300001213|JGIcombinedJ13530_100987824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300001213|JGIcombinedJ13530_102915937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300001431|F14TB_100578649All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300001431|F14TB_101193673All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300004013|Ga0055465_10065214Not Available1017Open in IMG/M
3300004070|Ga0055488_10004119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium2045Open in IMG/M
3300004081|Ga0063454_101465582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium582Open in IMG/M
3300004081|Ga0063454_101684906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300004081|Ga0063454_101988674All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300004114|Ga0062593_101061201All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300004156|Ga0062589_101266888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium710Open in IMG/M
3300004463|Ga0063356_102061263Not Available865Open in IMG/M
3300004463|Ga0063356_103707382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300004479|Ga0062595_101287927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales657Open in IMG/M
3300004479|Ga0062595_101901223Not Available570Open in IMG/M
3300004480|Ga0062592_100880512All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300004480|Ga0062592_100931192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae786Open in IMG/M
3300004480|Ga0062592_102055350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300004643|Ga0062591_101110165All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300004779|Ga0062380_10153240Not Available903Open in IMG/M
3300004800|Ga0058861_11809874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300005093|Ga0062594_101821877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300005093|Ga0062594_101944654All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300005093|Ga0062594_103035377Not Available524Open in IMG/M
3300005186|Ga0066676_10122957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1603Open in IMG/M
3300005206|Ga0068995_10109772All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005289|Ga0065704_10685861Not Available552Open in IMG/M
3300005328|Ga0070676_10428846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14925Open in IMG/M
3300005332|Ga0066388_104323524Not Available724Open in IMG/M
3300005334|Ga0068869_101901549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300005338|Ga0068868_100872292Not Available816Open in IMG/M
3300005354|Ga0070675_102029855Not Available530Open in IMG/M
3300005356|Ga0070674_102154709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300005366|Ga0070659_101039671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium720Open in IMG/M
3300005436|Ga0070713_101779023All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005441|Ga0070700_100314944All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300005543|Ga0070672_101756268All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005543|Ga0070672_101883319All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005546|Ga0070696_100626045All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300005549|Ga0070704_101037810Not Available743Open in IMG/M
3300005564|Ga0070664_101818139Not Available578Open in IMG/M
3300005569|Ga0066705_10943639All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005577|Ga0068857_100636495All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300005587|Ga0066654_10818632All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005713|Ga0066905_101200014All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005834|Ga0068851_10861715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales566Open in IMG/M
3300005840|Ga0068870_10110732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1567Open in IMG/M
3300005841|Ga0068863_100762377All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300005841|Ga0068863_102305031All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005844|Ga0068862_102570658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300005844|Ga0068862_102787904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300005937|Ga0081455_10409383All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300006046|Ga0066652_100244212Not Available1569Open in IMG/M
3300006049|Ga0075417_10335945All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300006173|Ga0070716_101790505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300006237|Ga0097621_100734694Not Available911Open in IMG/M
3300006237|Ga0097621_102079905All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300006237|Ga0097621_102348589All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006576|Ga0074047_10012347All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006581|Ga0074048_13184262All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300006755|Ga0079222_11500958All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300006844|Ga0075428_100369982All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300006844|Ga0075428_102389342Not Available543Open in IMG/M
3300006865|Ga0073934_10845746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300006871|Ga0075434_100809678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium953Open in IMG/M
3300006914|Ga0075436_101020534Not Available621Open in IMG/M
3300006969|Ga0075419_10553819All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300007799|Ga0105049_11148657All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300008470|Ga0115371_10794409All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300009036|Ga0105244_10586340All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300009094|Ga0111539_11973443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300009100|Ga0075418_10712966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium1082Open in IMG/M
3300009100|Ga0075418_11117635All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300009100|Ga0075418_11199472Not Available822Open in IMG/M
3300009100|Ga0075418_11949448Not Available639Open in IMG/M
3300009146|Ga0105091_10069734All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300009147|Ga0114129_10273470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2259Open in IMG/M
3300009147|Ga0114129_12249535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300009148|Ga0105243_10755647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria954Open in IMG/M
3300009156|Ga0111538_11111865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium999Open in IMG/M
3300009156|Ga0111538_12295308All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300009176|Ga0105242_11876848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300009176|Ga0105242_12142377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300009819|Ga0105087_1095586All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009840|Ga0126313_11241358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300009840|Ga0126313_11351933All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300010038|Ga0126315_10156582All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300010166|Ga0126306_10203041All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300010335|Ga0134063_10585168All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010336|Ga0134071_10804609All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010359|Ga0126376_12683335All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300010362|Ga0126377_11274931All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300010400|Ga0134122_11725229All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300011107|Ga0151490_1294829Not Available589Open in IMG/M
3300011412|Ga0137424_1006123Not Available1434Open in IMG/M
3300011423|Ga0137436_1166387All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300011440|Ga0137433_1105752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium882Open in IMG/M
3300012469|Ga0150984_115855598All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300012483|Ga0157337_1039601All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012903|Ga0157289_10220063All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012907|Ga0157283_10028294All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300012907|Ga0157283_10243289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300012908|Ga0157286_10275193Not Available605Open in IMG/M
3300012911|Ga0157301_10034203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1221Open in IMG/M
3300012911|Ga0157301_10164936All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300012912|Ga0157306_10233697All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300012960|Ga0164301_10406772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia954Open in IMG/M
3300012960|Ga0164301_10711577All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300012961|Ga0164302_11265970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium594Open in IMG/M
3300012985|Ga0164308_11804134All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300012986|Ga0164304_10395300Not Available980Open in IMG/M
3300012986|Ga0164304_11308910All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300012987|Ga0164307_11735292All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300013297|Ga0157378_10060591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3377Open in IMG/M
3300013306|Ga0163162_12271909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter marinus623Open in IMG/M
3300013308|Ga0157375_12708097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium593Open in IMG/M
3300013308|Ga0157375_12771387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300014272|Ga0075327_1289017All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300014325|Ga0163163_11670663All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300014326|Ga0157380_10928576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300014326|Ga0157380_13298518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium516Open in IMG/M
3300014968|Ga0157379_12417003All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300014969|Ga0157376_10588669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1106Open in IMG/M
3300015077|Ga0173483_10337408All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300015077|Ga0173483_10988714All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300015200|Ga0173480_10247561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi969Open in IMG/M
3300015201|Ga0173478_10554541Not Available587Open in IMG/M
3300015201|Ga0173478_10562647All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300015201|Ga0173478_10617719Not Available566Open in IMG/M
3300015371|Ga0132258_10378017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3512Open in IMG/M
3300015372|Ga0132256_103008167Not Available567Open in IMG/M
3300015373|Ga0132257_101194251Not Available963Open in IMG/M
3300015374|Ga0132255_100808602All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300015374|Ga0132255_101843927All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300015374|Ga0132255_102867940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium737Open in IMG/M
3300015374|Ga0132255_103350110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14682Open in IMG/M
3300016294|Ga0182041_11397032All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300016744|Ga0183099_1239629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300017654|Ga0134069_1287319All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300017792|Ga0163161_11228234Not Available649Open in IMG/M
3300017947|Ga0187785_10438716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300017965|Ga0190266_10840500Not Available595Open in IMG/M
3300017974|Ga0187777_11247062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300018052|Ga0184638_1053985All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300018073|Ga0184624_10144433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300018422|Ga0190265_10303305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1668Open in IMG/M
3300018433|Ga0066667_10907365All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300018466|Ga0190268_11186429All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300018469|Ga0190270_11113849All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300018481|Ga0190271_10821166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1054Open in IMG/M
3300018481|Ga0190271_11969253All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300018481|Ga0190271_12735901All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300019238|Ga0180112_1212233All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300019356|Ga0173481_10007925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2924Open in IMG/M
3300019356|Ga0173481_10436309Not Available650Open in IMG/M
3300019361|Ga0173482_10024099All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300019361|Ga0173482_10174932All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes858Open in IMG/M
3300021445|Ga0182009_10264996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi857Open in IMG/M
3300021510|Ga0222621_1146121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300022883|Ga0247786_1123450Not Available571Open in IMG/M
3300022901|Ga0247788_1055868Not Available739Open in IMG/M
3300023057|Ga0247797_1062917Not Available547Open in IMG/M
3300023079|Ga0247758_1112972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300023268|Ga0247765_1095202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300024254|Ga0247661_1098005All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300024286|Ga0247687_1027019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium827Open in IMG/M
3300025796|Ga0210113_1124347All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025901|Ga0207688_10798069All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes598Open in IMG/M
3300025911|Ga0207654_10791933Not Available684Open in IMG/M
3300025924|Ga0207694_11066247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300025926|Ga0207659_11128066All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes674Open in IMG/M
3300025927|Ga0207687_11281956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium630Open in IMG/M
3300025932|Ga0207690_10803659All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300025937|Ga0207669_10529606Not Available947Open in IMG/M
3300025942|Ga0207689_11665118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300026023|Ga0207677_10346750Not Available1243Open in IMG/M
3300026023|Ga0207677_11996425All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300026075|Ga0207708_11394860All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300026088|Ga0207641_12330969All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300026121|Ga0207683_10532354All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300026121|Ga0207683_11089743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300026324|Ga0209470_1287788All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300026953|Ga0207835_1023151All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300026981|Ga0207822_1028300All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300027421|Ga0207563_104651Not Available534Open in IMG/M
3300027614|Ga0209970_1086264All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300027900|Ga0209253_10933863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300027907|Ga0207428_11272897Not Available510Open in IMG/M
3300027915|Ga0209069_10521363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300028072|Ga0247675_1068285All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300028597|Ga0247820_10807544Not Available660Open in IMG/M
3300028708|Ga0307295_10171654All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300028710|Ga0307322_10175964All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300028711|Ga0307293_10079071All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300028720|Ga0307317_10101726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300028787|Ga0307323_10001017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8848Open in IMG/M
3300028803|Ga0307281_10334174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300028811|Ga0307292_10432105All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300028861|Ga0302259_1094172All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300028878|Ga0307278_10498846All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300030019|Ga0311348_10281805Not Available1239Open in IMG/M
3300030019|Ga0311348_11489275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300030336|Ga0247826_11249502All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300030336|Ga0247826_11535590All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300030673|Ga0302287_10224664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300030943|Ga0311366_11510164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300031092|Ga0308204_10125549Not Available736Open in IMG/M
3300031099|Ga0308181_1124267All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031228|Ga0299914_10557642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium984Open in IMG/M
3300031521|Ga0311364_10449521All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300031547|Ga0310887_11148141Not Available500Open in IMG/M
3300031562|Ga0310886_10189142All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300031572|Ga0318515_10058726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1953Open in IMG/M
3300031716|Ga0310813_12118039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300031771|Ga0318546_10047950All Organisms → cellular organisms → Bacteria2644Open in IMG/M
3300031847|Ga0310907_10676580All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300031852|Ga0307410_10052806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2747Open in IMG/M
3300031854|Ga0310904_10251198All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300031858|Ga0310892_10562478Not Available768Open in IMG/M
3300031873|Ga0315297_11542421All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031908|Ga0310900_10689454All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300031908|Ga0310900_11048337All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300031910|Ga0306923_11056868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium878Open in IMG/M
3300031918|Ga0311367_11607366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum635Open in IMG/M
3300031940|Ga0310901_10293943Not Available680Open in IMG/M
3300031942|Ga0310916_11717731All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031997|Ga0315278_11037586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300032013|Ga0310906_11089590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia xyli → Leifsonia xyli subsp. xyli577Open in IMG/M
3300032066|Ga0318514_10534510All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium624Open in IMG/M
3300032075|Ga0310890_11135468All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300032075|Ga0310890_11492210Not Available557Open in IMG/M
3300032143|Ga0315292_11184837All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300032157|Ga0315912_11504751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300032164|Ga0315283_10730955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1064Open in IMG/M
3300032164|Ga0315283_10776627All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300032180|Ga0307471_103280756Not Available573Open in IMG/M
3300032342|Ga0315286_11213033Not Available737Open in IMG/M
3300032342|Ga0315286_11712130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300032516|Ga0315273_11396054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides soli868Open in IMG/M
3300032516|Ga0315273_11426771All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300032782|Ga0335082_10772721All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium822Open in IMG/M
3300032828|Ga0335080_10840536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300033004|Ga0335084_11480313All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium672Open in IMG/M
3300033521|Ga0316616_100076692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2804Open in IMG/M
3300034150|Ga0364933_142248All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300034672|Ga0314797_057725All Organisms → cellular organisms → Bacteria720Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.69%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.73%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.95%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.56%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.17%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.17%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.17%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.39%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.39%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.39%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.39%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.39%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.39%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.39%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.39%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.39%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.39%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.39%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.39%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.39%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.39%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.39%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.39%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.39%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.39%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.39%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.39%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.39%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.39%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.39%
BioreactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor0.39%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007799Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06EnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016744Microbial communities from bioreactor (seeded with anoxic lake sediment) at LBNL, California, USA - Biofuel metagenome 1EngineeredOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023079Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4EnvironmentalOpen in IMG/M
3300023268Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026953Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes)EnvironmentalOpen in IMG/M
3300026981Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes)EnvironmentalOpen in IMG/M
3300027421Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A2-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030673Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L02_034433802170459007Grass SoilMATKTDFTEAEWTALQRGVTGSAMLVSLADRDFTDTFGEVGAMTKFLQGQQ
4MG_046527702170459019Switchgrass, Maize And Mischanthus LitterMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSFGEAGAMGKFLAGAQVASASPLVR
INPhiseqgaiiFebDRAFT_10492367713300000364SoilMATKADFTEDEWHALQKGVTGTGMLVSVSDADFTDSFGEASALAKFLAEQRRT
JGI1027J11758_1256818323300000789SoilMAXKSDFTQDEWEAIHKGVTGAGMLVSVGDRDFTDTFGEAGALAKRLR
JGI10213J12805_1000693333300000858SoilMATKADFTEDEWKAMQKGVTGAGMLVAVGDRDFTDSFGE
JGI10214J12806_1112040523300000891SoilMASKTDFTEDEWAALQKGVTGSAMLVSLSDRDFTDSFGEASALAKHLAGQQVA
JGI10216J12902_10056597313300000956SoilMAGKADFTEEEWDALEKGVTGAGMLVSTAHRDFTDSFGEAKALASHLAAHTGS
JGI10216J12902_10424374313300000956SoilMAGKADFTEDEWKGLQQGVTGAGLLVSTAHRDFTDSFGEASAVAKQLAAHRDS
JGI10216J12902_10500403823300000956SoilMAARTDFTDPEWSALQKGVTGSGLLVSLSDRDFTDTFGEVGAMGKYLAGQQV
JGIcombinedJ13530_10098605323300001213WetlandMAGKADFSEQEWSALQKGVTGAGMLVSVAHRDFTDSFGEAKA
JGIcombinedJ13530_10098782423300001213WetlandMAGKADFTEQEWSALQKGVTGAGMLVSVSHRDFTDSFGEAKAIAS
JGIcombinedJ13530_10291593723300001213WetlandMAGKADFTEAEWKTLSRSVTGAGMLVSLAHKDFTDSFGESNAMAKEMASEHVHSQSQLVRDLGSTHS
F14TB_10057864923300001431SoilMATKQDFSEQEWATLERSISGTGLLVSLADRDFTDTFGEVGAMAKYLSGQQVAAS
F14TB_10119367323300001431SoilVATKADFTEEEWKTMQKGVTGAGALVSISDPDFTDSFGEASALGKYLAEQHEKSDS
Ga0055465_1006521413300004013Natural And Restored WetlandsMAGKADFTEDEWKDLQQGVTGAGLLVSTAHRDFTDSFGEASAVAKQLAAHRESDSQLVRE
Ga0055488_1000411913300004070Natural And Restored WetlandsMATRADFTEVEWKAMQKGITGAGMLASISDRDFTDSFGEASALAKFLGAQRTSN
Ga0063454_10146558213300004081SoilMATKNDFTQPEWETLQKGVTGAGMLVSLSDRDFTDTFGEVGAMTKYLAGQNV
Ga0063454_10168490613300004081SoilMTTKADFSESEWSALQKGVTGSAMLVSLADRDLTDSFGEVGAMTKYLQGQQVAGSTELMRELA
Ga0063454_10198867413300004081SoilMATKADFTEEEWKALQRGVTGPGLLVSVSDRDFTDTFGEASALATYMAGQHEKNE
Ga0062593_10106120113300004114SoilMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSFGEA
Ga0062589_10126688813300004156SoilMATKSDFTEQEWEALKKGITGSGMLVSLSDRDFTDTFGEVGA
Ga0063356_10206126333300004463Arabidopsis Thaliana RhizosphereMAGKTDFTEEEWKNLQQGVTGAGLLVSAAHRDFTDSFGEASTVAKQ
Ga0063356_10370738223300004463Arabidopsis Thaliana RhizosphereMATKADFTEQEWDALRKGVSGAGLLVSLSDRDFTDSFGEAGALAKYLSGQ
Ga0062595_10128792723300004479SoilMATKADFTEDEWNALQKGVMGAGMLVSVSDADFTDSFGEASALAK
Ga0062595_10190122313300004479SoilMAGKADFTEDEWNDLQQGVTGAGLLVSSAHRDFTDSFGEAKAVASHL
Ga0062592_10088051213300004480SoilMATRNDFTETEWTALVKGLVGAGMLVSMSDRDLSDSFGEASAMAKYI
Ga0062592_10093119223300004480SoilMATKADFTEEEWKTMQKGVTGAGALVSISDPDFTDSFGEASAIGKYLAEQREKSDSV
Ga0062592_10205535013300004480SoilMATKADFTEQEWEALKKGITGSGMLVSLSDRDFTDTFGEVGAL
Ga0062591_10111016513300004643SoilMATKADFTEGEWAALQKGLTGSAMLVSLSDRDLSDTFGEVGALAKFLQGQQVAGSSELMR
Ga0062380_1015324013300004779Wetland SedimentMAGKADFSEDEWKALQKGVTGSGMFVSIADRDFTDSFGEAST
Ga0058861_1180987423300004800Host-AssociatedMATKQDFTEQEWASLERSISGTGLLVSLADRDFTDTFGEVGAMAKYLSG
Ga0062594_10182187723300005093SoilMATKADFTEDEWHALQKGVTGAGMLVSVSDADFTDSFGEASAFGKFLAEQHQKN
Ga0062594_10194465423300005093SoilVATKADFTEAEWKTMQKGVTGAGMLVSVSDPDFTDSFGEA
Ga0062594_10303537723300005093SoilVATKADFTEDEWKTMQRGVTGAGALTSVADADFTDSFGEASALAKYLADRRR
Ga0066676_1012295733300005186SoilMSGKGACVATKADFTEDEWGTLHKGVTGAGMLVSVSDRDFTDTFGEAGALAKRLRKEH
Ga0068995_1010977223300005206Natural And Restored WetlandsMAKRADFTEDEWKGLRKGVTGAGMLVSVGHRDFSDSFGEASALAKQMVSERGSES
Ga0065704_1068586113300005289Switchgrass RhizosphereMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTDTFGEASAVAKYLGRQRESGAS
Ga0070676_1042884613300005328Miscanthus RhizosphereMATRQDFTDEEWAALQKGLTGSGMLVSVSDRDFTDTFGEAGALAKYLAGQ
Ga0066388_10432352413300005332Tropical Forest SoilMAGKADFTEEEWKELQQGVTGAGLLVSAAHRDFTDSFGEAKAVASQLAAHRDS
Ga0068869_10190154923300005334Miscanthus RhizosphereVATKADFTEAEWKTMQKGVTGAGMLVSVSDPDFTDSFGEASSLAKYLAEQQ
Ga0068868_10087229223300005338Miscanthus RhizosphereVAAKTDFTEDEWKELQQGVTGAGLLVSTAHRDFTDSFGEAKAVATQLA
Ga0070675_10202985523300005354Miscanthus RhizosphereMASKANFTEQEWDDLQQGVTGAGMLVSAAHRDFTDSFGEASSIAKQ
Ga0070674_10215470913300005356Miscanthus RhizosphereMAGKADFTEDEWDALQKGVTGSGMLVSVSHRDFTDSFGEAKAIAKD
Ga0070659_10103967123300005366Corn RhizosphereMATKADFTEQEWEALKKGITGSGMLVSLSDRDFTDTFGEVGALAKYL
Ga0070713_10177902313300005436Corn, Switchgrass And Miscanthus RhizosphereMATKADFTEQEWETLHKGVTGAGMLVSTSDPGFMDSFGEASALAKHL
Ga0070700_10031494433300005441Corn, Switchgrass And Miscanthus RhizosphereVATKADFTEEEWKTMQKGVTGAGMLVSVSDPDFTDSFGEASSL
Ga0070672_10175626813300005543Miscanthus RhizosphereMATKQDFTETEWATLQKGITGSGMLVSLSDRDFTDSFGEAGAMGKYLSGQQLTGATD
Ga0070672_10188331923300005543Miscanthus RhizosphereVATRQDFTDEEWAALQKGLMGSGALVSVSDRDLTDTFGEASALSKFLAGQQVAATN
Ga0070696_10062604513300005546Corn, Switchgrass And Miscanthus RhizosphereMATKADFTEDEWHTLQRGITGSGMLVSLSDRDLTDSFGEAGAMG
Ga0070704_10103781013300005549Corn, Switchgrass And Miscanthus RhizosphereVAGKTDFTEDEWKNLQQGVTGAGLLVSTAHRDFTDSFGEASAVAKQLAA
Ga0070664_10181813913300005564Corn RhizosphereMAGKADFTEDEWNDLQQGVTGAGLLVSSAHRDFTDSFGEAKAVASHLAAHRSSESELVR
Ga0066705_1094363923300005569SoilMIVERKVVMANKADFTDQEWKAMQKGVTGAGMLVSISDRDFTDTFGEAG
Ga0068857_10063649533300005577Corn RhizosphereMATKADFTEEEWKTMQKGVTGAGALVSISDPDFTDSFGEASAIGK
Ga0066654_1081863223300005587SoilVATKADFTEDEWGTLHKGVTGAGMLVSVSDRDFTDTFGE
Ga0066905_10120001423300005713Tropical Forest SoilMATKTDFTEEEWAALQRGVTGSGMLVSLSDRDFTDSFGEASAMGKY
Ga0068851_1086171523300005834Corn RhizosphereMTTKTDFTETEWAALQKGVTGSGFLVSLSDRDLSDTFG
Ga0068870_1011073213300005840Miscanthus RhizosphereVAAKTDFTEDEWKELQQGVTGAGLLVSTAHRDFTDSF
Ga0068863_10076237733300005841Switchgrass RhizosphereMATKTDFTEQEWSALQKGMTGSGMLVSLSDRDLSDSFGEASAMGKY
Ga0068863_10230503123300005841Switchgrass RhizosphereMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSFGEAGAMGKFLAGAQVASASP
Ga0068862_10257065823300005844Switchgrass RhizosphereMATKSDFTEQEWEALKKGITGSGMLVSLSDRDFTDTFGEVGALAKYLTGQEVSSSSQ
Ga0068862_10278790423300005844Switchgrass RhizosphereMATKQDFSEEEWAALQRGVTGSGMLVSLSDRDFTDSFGEASALGKYLAGQQVAGAT
Ga0081455_1040938323300005937Tabebuia Heterophylla RhizosphereMATKADFTEEEWKTMQKGVTGTGLLVSVGDRDFTDSFGEVSALAKYLAA
Ga0066652_10024421213300006046SoilVATKADFSEDEWKTMQKALTGAGMLVSMADADFTDTFGEVRALTKY
Ga0075417_1033594513300006049Populus RhizosphereMAGKADFTEEEWEDLKQGVTGSGLLVSTAHRDFTDSFGEASSIAKQL
Ga0070716_10179050513300006173Corn, Switchgrass And Miscanthus RhizosphereMATKADFTEEEWDTLHKGVTGAGMYVSSSDADFTDSFGEAKALAK
Ga0097621_10073469413300006237Miscanthus RhizosphereMAGKADFTEDEWKGLQQGVTGAGMLVSTSHRDFTDSFGEAKAVAKQLQAHRASDS
Ga0097621_10207990513300006237Miscanthus RhizosphereMATRQDFTDDEWTRLQKGVTGSAMLVSLSDRDFTDTFGEVGA
Ga0097621_10234858913300006237Miscanthus RhizosphereMAGKSDFTSDEWEALQRGVVGAGMLVSTAHPGFTEGFGEA
Ga0074047_1001234713300006576SoilMAGKDAFTEDEWKTLQQGLAGAGMLVSTADRDFTDSFGEANALAKELNAHAESESELVRA
Ga0074048_1318426213300006581SoilMAGKADFTEDEWKNLQQGVTGAGMLVSAAHRDFTDSFGEAGAVAKQLSAHRESESQLV
Ga0079222_1150095823300006755Agricultural SoilMATKQDFSDEEWAAFQRGVTGSGMLVSISDRDFTDSFGEAGALGKFLAGQQT
Ga0075428_10036998233300006844Populus RhizosphereMAGKADFTEEEWDALHKGVTGAGMLVSVGDRDFTDSFGEASALAHRLLEEH
Ga0075428_10238934223300006844Populus RhizosphereMAGKTDFTEDEWKDLQQGVTGAALLVSAAHRDFTDSFG
Ga0073934_1084574633300006865Hot Spring SedimentMATKADFTDEEWKALERGVTGAGMLVSVGDRDFTDAFGEASALAKALAAQHQ
Ga0075434_10080967813300006871Populus RhizosphereMAGKTDFTEDEWKNLQQGVTGAGLLVSTAHRDFTDSFGEASAVAKQLAAHR
Ga0075436_10102053423300006914Populus RhizosphereVAGKTDFTEDEWKNLQQGVTGAGLLVSTAHRDFTDSFGEASAVAKQLAAHRDSESQ
Ga0075419_1055381923300006969Populus RhizosphereMAGKADFTEEEWEDLKQGVTGSGLLVSTAHRDLTESFGEASSIAKQLAAHRDSESELVRDLS
Ga0105049_1114865723300007799FreshwaterMAGKADFTGGEWKALAKGVTGAGMLVSLAHKDFTDSFGEATALAKEMSNQHVHSQSQLVRELGAT
Ga0115371_1079440913300008470SedimentMVTKADFTEDEWETLQRGLTGAGMLVSVADPGVMDSFG
Ga0105244_1058634023300009036Miscanthus RhizosphereMTTKTDFTESEWTALQKGITGSGLLVSLSDRDLSDTFGEVGAMAKYLSGQQVAASS
Ga0111539_1197344313300009094Populus RhizosphereMASKADFTEQEWETMRKGVAGAGMLVSVGDRDFTDTFGE
Ga0075418_1071296633300009100Populus RhizosphereVATKADFTEEQWKTLEKGLMGAGLLVSLSDPDFTDTFGEASAMAKYLAEQR
Ga0075418_1111763523300009100Populus RhizosphereMAGKADFTEQEWEDLQQGVTGAGLLVSTAHRDFTDSFGEASSIAKQLAAHRDSESEL
Ga0075418_1119947223300009100Populus RhizosphereMAGKADFTDEEWKELQQGVTGAGLLVSTAHRDFTDSFGEAKAVAAELAAHRDS
Ga0075418_1194944813300009100Populus RhizosphereVHVATRQDFTDEEWAALQKGLMGSGMLVLVSDRDLTDSIGEPDALSKYLA
Ga0105091_1006973443300009146Freshwater SedimentMATKADFTEDEWETMSKGVTGAGMLVSIGDRDFTDTFG
Ga0114129_1027347063300009147Populus RhizosphereMAGKADFTEQEWEDLKQGVTGAGLLVSTAHRDFTDSFGEA
Ga0114129_1224953513300009147Populus RhizosphereMATKADFTEDEWETLRKGVSGAGMLVSLSDRDFTDTFGEAGALAKY
Ga0105243_1075564723300009148Miscanthus RhizosphereMAGKSDFTSEEWEALQKGVTGAGMLVSVAHRDFTDSFGEAK
Ga0111538_1111186513300009156Populus RhizosphereMAGKADFTEEEWHTLQQGVTGAGLLVSLAHRDFTD
Ga0111538_1229530823300009156Populus RhizosphereMAGKADFTEEEWDALRKGVTGAGLLVSVGDRDFTDSFGEANALAHRLLEEHE
Ga0105242_1187684823300009176Miscanthus RhizosphereMAGKADFTEDEWDALQKGVTGSGMLVSVSHRDFTDSFGEAKAIAKDLAANRENTSQLVRELAE
Ga0105242_1214237723300009176Miscanthus RhizosphereMAGKTDFTSEEWEALQKGVTGAGMLVSVAHRDFTDSFGEAKAIAHDLAAHRESESQLV
Ga0105087_109558613300009819Groundwater SandMATKADFTEDEWETMQKGVTGAGMLVSVGDRDFTDSFGEAGA
Ga0126313_1124135823300009840Serpentine SoilMATRADFTEDEWETMRKGVTGAGMLVSIKDRDFTDTFGEVGALAKRLSEERKD
Ga0126313_1135193313300009840Serpentine SoilMATKADFTEDEWETMRKGVTGAGMLVSIGDRDFTDTFGE
Ga0126315_1015658233300010038Serpentine SoilMATKADFTEDEWETMRKGVTGAGMLVSIGDRDFTDTFG
Ga0126306_1020304113300010166Serpentine SoilMATKADFTEDEWEAMRKGVTGAGMLVSIGDRDFTDTFGEVSALAK
Ga0134063_1058516823300010335Grasslands SoilMASKADFTEEEWETMRKGVAGAGMLVSVGDRDFTD
Ga0134071_1080460913300010336Grasslands SoilMASKADFTEEEWETMRKGVAGAGMLVSVGDRDFTDTFGEAGALAKRLGQE
Ga0126376_1268333513300010359Tropical Forest SoilMATKTDFTDAEWSTLQKGVTGSGMLVSLSDRDFTDTFGE
Ga0126377_1127493123300010362Tropical Forest SoilMAGKTDFTEEEWKALQQGVTGAGLLVSSAHRDFTDSF
Ga0134122_1172522923300010400Terrestrial SoilMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSFGEAGAMGKYLAGAQVASAS
Ga0151490_129482923300011107SoilMATKTEFTEDEWKALQRGVTGAGTLVSVSDRDFTDSFG
Ga0137424_100612323300011412SoilMAGKADFTEDEWKELQQGVTGAGLLVSTAHRDFTDSFGEASTVAKQLAAHR
Ga0137436_116638713300011423SoilMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTDTFGEASALAKYLGNQRESG
Ga0137433_110575223300011440SoilMATKADFTEPEWESLRKGVSGAGLLVSLSDRDFTDTFGEAGALAK
Ga0150984_11585559813300012469Avena Fatua RhizosphereMFMATKQDFSEQEWASLERGISGTGLLVSLADRDFTDTFGEVGAMAKYLAGQQVAASSE
Ga0157337_103960123300012483Arabidopsis RhizosphereMATKADFTEDEWKTLQKGVTGAGLLVSASDRDFTDTFGEAGALAKYLAEQREK
Ga0157289_1022006313300012903SoilMAAKTDFTDAEWLALRKGAVGSGLLVSVIDRDFTDSFGEASAMAKYLN
Ga0157283_1002829443300012907SoilMAGKADFTEDEWNDLQQGVTGAGLLVSSAHRDFTD
Ga0157283_1024328913300012907SoilMAGKADFTEEEWDALQKGVTGSGMLVSVAHRDFTDSFGEANAI
Ga0157286_1027519323300012908SoilMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTDTFGEASALAKYLGRQRES
Ga0157301_1003420333300012911SoilMGMQMTTKTDFTESEWVALQKGVTGSGFLVSLSDRDLSDTFGEVGAMAKYLAGQQVAG
Ga0157301_1016493613300012911SoilMATRQDFTDEEWAALQKGLTGSGMLVSVSDRDFTDTFGEAGALAKYLAGQQTAAT
Ga0157306_1023369713300012912SoilMEDGGHVATRQDFTEEEWATLQKGLGGSGALVSVSDRDFTDTFGEASA
Ga0164301_1040677213300012960SoilMTGKADFTEEEWKALQKGVTGSGLLVSVSDRDFTDTFGEASALAKRMA
Ga0164301_1071157723300012960SoilMATRQDFTDDEWTRLQKGVTGSAMLVSLSDRDFTDTFGEVGAMTKYL
Ga0164302_1126597023300012961SoilMATKADFTEDEFETIQRGVSGAGMLVSLADRDFTDSFGDAKAL*
Ga0164308_1180413433300012985SoilMAGKADFTEEEWDALQKGGAGSGMLVSVADRDFTDSFGEAKAIAK
Ga0164304_1039530013300012986SoilMAGKTEFTEDEWKNLQQGVTGAGLLVSTAHRDFTDSFGEASAVAKQLAAHRESDSQL
Ga0164304_1130891023300012986SoilMATKQDFTEQEWASLERSISGTGLLVSLADRDLTDTFGEVGAMAKYLAGQQVAASSELLREL
Ga0164307_1173529223300012987SoilMATKQDFTETEWATLQKGITGSGMLVSLSDRDFTDSFGEAGAMGKYLSGQQLTGATDLMR
Ga0157378_1006059163300013297Miscanthus RhizosphereMAGKSDFTSDEWEALQRGVVGAGMLVSTAHPGFTEGFGEAK
Ga0163162_1227190913300013306Switchgrass RhizosphereMTTKTDFTESEWTALQKGITGSCFLVSLSDRDLSDTFGEVGAM
Ga0157375_1270809723300013308Miscanthus RhizosphereMASKADFTEEEWKTLGKGVIGVGLLVSVSDRDFTDSFGEATALAKYLTSQRES
Ga0157375_1277138713300013308Miscanthus RhizosphereMAGRADFTEEEWDALQKGVTGSGMLVSVAHRDFTDSFGEAKA
Ga0075327_128901713300014272Natural And Restored WetlandsMEDAMATKADFSESEWQAMQRGVTGAGVLVSVADRDLTDSFG
Ga0163163_1167066323300014325Switchgrass RhizosphereMATRQDFTDEEWAALQKGLTGSGMLVSVSDRDFTDTFGEAGALAKYLAGQQTAA
Ga0157380_1092857613300014326Switchgrass RhizosphereMAGKADFTEDEWKELQQGVTGAGLLVSAAHRDFTDSF
Ga0157380_1329851813300014326Switchgrass RhizosphereMAGKADFTEEEWDALQKGVTGSGMLVSVAPRDFTDS
Ga0157379_1241700313300014968Switchgrass RhizosphereMATKADFTEDEWHTLQRGMTGSGMLVSLSDRDLTDSFGEAGAMSKYLA
Ga0157376_1058866933300014969Miscanthus RhizosphereMAGKADFTEDEWKELQQGVTGAGLLVSSAHRDFTDSFGEAKAVASHLAAHRSSERARP*
Ga0173483_1033740813300015077SoilMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSFGEAGAMGKYLAGAQ
Ga0173483_1098871423300015077SoilVATKADFTEDEWETMQKGVMGAGLLVSLSDPDFTDTFGEASAIAKYLA
Ga0173480_1024756113300015200SoilVHVAGRKDFDEAEWASMRKGIVGTGMLVSLSDRDFTDTFGEVSAMAKY
Ga0173478_1055454133300015201SoilMAGKADFTEDEWKELQQGVTGAGLLVSSAHRDFTDTFGEAKAVASHLAAHRSSE
Ga0173478_1056264723300015201SoilMTAKTDFTEAEWTALQKGITGSGFLVSLSDRDLTDTFGEVGAMAKYLSGQQVAGSSE
Ga0173478_1061771913300015201SoilMASKANFTEQEWDDLQQGVTGAGMLVSAAHRDFTDSFGEASSIAKQLAAHRKSESQLIRD
Ga0132258_1037801793300015371Arabidopsis RhizosphereVATKADFTEDEWDALHKGVTGAGLLVSVGDRDFTDTFGEAGALAKRLRQEH
Ga0132256_10300816713300015372Arabidopsis RhizosphereMATKQDFTEQEWATLERSISGTGLLVSLADRDLTDTFGEVGAMAKYLAGQPVAASSELLR
Ga0132257_10119425123300015373Arabidopsis RhizosphereMAGKADFTEDEWKELQQGVTGAGLLVSAAHRDFTD
Ga0132255_10080860233300015374Arabidopsis RhizosphereMATKTDFTEQEWSALQKGITGSGMLVSLSDRDLSDSFGEASAMGKYLA
Ga0132255_10184392723300015374Arabidopsis RhizosphereVATRQDFTDEEWAALQKGLMGSGALVSVSDRDLTDTFGEASALSKFLAGQQVAIPPKYLP
Ga0132255_10286794013300015374Arabidopsis RhizosphereMAGKADFTEDEWKELQQGVTGAGMLVSTSHRDFTDSFGEAKA
Ga0132255_10335011013300015374Arabidopsis RhizosphereMATRQDFTDEEWAALQKGLTGSGMLVSVSDRDFTDTFG
Ga0182041_1139703213300016294SoilVATKDMFTEDEWEALHKGATGAGLLVSVSDRDFTDSFGEAS
Ga0183099_123962923300016744BioreactorMATKADFTEDEWKALQRGVTGAGTLVSVSHRDFTDSFGEASALAKHLSEQQN
Ga0134069_128731913300017654Grasslands SoilVATKADFTEDEWGTLHKGVTGAGMLVSVSDRDFTDTFGEAGALAKRL
Ga0163161_1122823413300017792Switchgrass RhizosphereYEMTTKTDFTESEWTALQKGITGSGFLVSLSDRDLSDTFGEVGAMAK
Ga0187785_1043871613300017947Tropical PeatlandVATKTDFSEDEWKAMHKGVTGAGMLVSVSDADFTDSFGE
Ga0190266_1084050013300017965SoilMAGKADFTEDEWDALEKGVTGAGMLVSTGHKDFTDSFGEASAMAKELVEQR
Ga0187777_1124706223300017974Tropical PeatlandMAGKADFTEDEWKAMQKGVTGAGLLVSVGDRDFTD
Ga0184638_105398543300018052Groundwater SedimentMAGKADFTEGEWEGLQRGVTGAGLLVSTAHRDFTDSFGEASAVAK
Ga0184624_1014443323300018073Groundwater SedimentMAGKADFTEEEWDALQKGVTGSGMLVSVADRDFTDSFGEAKAIAKDLVANREN
Ga0190265_1030330513300018422SoilMAGKADFTEEEWNELQQGVTGAGLLVSTAHRDFTDAFGEASTVAKQLAAHRESESQL
Ga0066667_1090736513300018433Grasslands SoilMASKADFTEQEWKAMQKGVTGAGMLVSISDRDFTDTFGEAGALAKYLGEEHEKRGSEL
Ga0190268_1118642923300018466SoilMAGKSDFTEDEWKNLQQGVVGAGMLVSAAHRDFTDSFSEAVGGRPAR
Ga0190270_1111384923300018469SoilMASEADFTEDEWKTMQKGVTGAGMLVSAGDRDFTDSFGEAGALAKYLAGQRETSE
Ga0190271_1082116633300018481SoilMAGKADFTEEEWKTLHQGVTGAGLLVSLAHRDFTDGFGEASAMAHELSDEHLTS
Ga0190271_1196925313300018481SoilMATKADFTEPEWEALRKGISGTGLLVSLSDRDFTDTFGEVGALGKYLA
Ga0190271_1273590123300018481SoilMATKADFTEPEWDALRKGITGAGMLVSLSDRDFTDTFGEVGALGKYLAGQQVA
Ga0180112_121223313300019238Groundwater SedimentMATKADFTAAEWDNLHTGVTGAGMLVSLSDRDLSDSFGESTAM
Ga0173481_1000792543300019356SoilMATRQDFTDEEWAALQKGLTGSGMLVSVSDRDFTD
Ga0173481_1043630913300019356SoilMAAKTDFTDAEWLALRKGAVGSGLLVSVIDRDFTDSF
Ga0173482_1002409913300019361SoilMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSF
Ga0173482_1017493213300019361SoilMATRADFTDGEWAALQKGLTGSALLVSLSDRDLSDTFGEVGALAKYLQGQQVAGSSELMREI
Ga0182009_1026499613300021445SoilMATRSDFTDEEWAALQKGLTGSAMLVSLSDRDFTDTFGEVGAMAKFFASQQLAA
Ga0222621_114612113300021510Groundwater SedimentMAAKTDFTEDEWKELQQGVTGAGLLVSTAHRDFTDSFGEAK
Ga0247786_112345033300022883SoilMAGKADFTEDEWKELQQGVTGAGLLVSSAHRDFTDSFGEAKAVASHLA
Ga0247788_105586813300022901SoilMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTDTFGEASAVAKYLG
Ga0247797_106291723300023057SoilMASKANFTEQEWDDLQQGVTGAGMLVSAAHRDFTDSFGEASSIAK
Ga0247758_111297213300023079Plant LitterMAGKADFTEEEWDALQKGVTGSGMLVSVAHRDFTDSFGEA
Ga0247765_109520223300023268Plant LitterMAGKADFTEEEWDALQKGVTGSGMLVSVAHRDFTDSFGEAKAIAKDLG
Ga0247661_109800523300024254SoilMATKADFTEDEWHALQKGVTGAGMLVSVSDADFTDSFGEASAFGKFLAEQHRKN
Ga0247687_102701923300024286SoilVATKADFTEDEWKTMQRGVTGAGTLTSVADADFTDTF
Ga0210113_112434723300025796Natural And Restored WetlandsVATRHDFSDDEWAALQKGLIGSGMLVSVSDRDLTDTFGEAGALGKYLAGQQVAATSE
Ga0207688_1079806913300025901Corn, Switchgrass And Miscanthus RhizosphereMATRADFTDGEWAALQKGLTGSALLVSLSDRDLSDTF
Ga0207654_1079193313300025911Corn RhizosphereMATKADFTEDEWHTLQRGMTGSGMLVSLSDRDLTDSFGEAGAMSKYLAGAQVASASPLV
Ga0207694_1106624723300025924Corn RhizosphereMAGKSDFTSDEWEALQRGVVGAGMLVSTAHPGFTEGFGEAKAIASD
Ga0207659_1112806623300025926Miscanthus RhizosphereMATRADFTDGEWAALQKGLTGSALLVSLSDRDLSDTFGEVGALAKYLQGQQVAGSSDLMR
Ga0207687_1128195613300025927Miscanthus RhizosphereMAGKADFTEDEWKGLQQGVTGAGMLVSTSHRDFTDSFGEAKAVAKQLQSH
Ga0207690_1080365913300025932Corn RhizosphereMATKADFTEDEWHTLQRGMTGSGMLVSLSDRDLSD
Ga0207669_1052960613300025937Miscanthus RhizosphereMAGKADFTEDEWKELQQGVTGAGMLVSTSHRDFTDSFGE
Ga0207689_1166511813300025942Miscanthus RhizosphereMAGKSDFTSDEWEALQRGVVGAGMLVSTAHPGFTEG
Ga0207677_1034675013300026023Miscanthus RhizosphereVAAKTDFTEDEWKELQQGVTGAGLLVSTAHRDFTDSFSE
Ga0207677_1199642513300026023Miscanthus RhizosphereMATKADFTEDEWHTLQRGMTGSGMLVSLSDRDLTDS
Ga0207708_1139486023300026075Corn, Switchgrass And Miscanthus RhizosphereMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSFGEAGA
Ga0207641_1233096913300026088Switchgrass RhizosphereMATKADFTEDEWHVLQRGVTGSGVLVSLSDRDLTDSFGEAGAMGKY
Ga0207683_1053235423300026121Miscanthus RhizosphereMATKTDFTEQEWSALQKGMTGSGMLVSLSDRDLSDSFGEASAMGKYLAGAQVA
Ga0207683_1108974323300026121Miscanthus RhizosphereMAGKADFTEDEWKQLQQGVTGAGLLVSAAHRDFTDSFGEAKAVAKDLAAHRQSESEL
Ga0209470_128778823300026324SoilVATKADFTEDEWGTLHKGVTGAGMLVSVSDRDFTDTFGEAGALAKRLRKEH
Ga0207835_102315123300026953Tropical Forest SoilMATKQDFSEAEWETLRKAVTGSGMLVSLSDRDLSDSFGEAGAMAKYLAGQQ
Ga0207822_102830023300026981Tropical Forest SoilMATRADFSDDEWKTLQRGLTGAGMLVSMSDRDLSDSFGEAGAMGALPGGGK
Ga0207563_10465113300027421SoilMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTDTFGEASAVA
Ga0209970_108626423300027614Arabidopsis Thaliana RhizosphereMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTD
Ga0209253_1093386313300027900Freshwater Lake SedimentMAGKADFTEDEWKALQKGVTGAGMFVSIADRDFTDSFGEASTIAKQLAAHRESESQLVR
Ga0207428_1127289713300027907Populus RhizosphereMAGKADFTEDEWKELQQGVTGAGLLVSSAHRDFTDSFGEAKA
Ga0209069_1052136313300027915WatershedsMAQKADFTEDEWKGLRKGVTGAGMLVSIGHRDFTDSFGEASA
Ga0247675_106828513300028072SoilMATKADFTEDEWHALQKGMTGAGMLVSVSDADFTDSFGEASAFGKFLAEQH
Ga0247820_1080754423300028597SoilMAGKADFTDEEWKELQQGVTGAGLLVSTAHRDFTDSFGEAKAVAA
Ga0307295_1017165413300028708SoilVASKADFTDEEWKTMQKGVTGAGTLVSISDPDFTD
Ga0307322_1017596413300028710SoilMATKSDFTDEEWKALEKGVTGAGMLVSVSDRDLTDAFGEASALAKALAARRDDA
Ga0307293_1007907123300028711SoilMATRADFTDDEWKTLRKGVTGAGVLVSVSDRDFTDSFGEASALA
Ga0307317_1010172613300028720SoilMAGKADFTEDEWKELQQGVTGAGLLVSTAHRDFTDSFGEASA
Ga0307323_10001017113300028787SoilMATRADFTDDEWKTLQKGVTGAGMLVSVSDRDFTDSFGEAS
Ga0307281_1033417423300028803SoilVASKADFTDEEWKTMQKGVTGAGTLVSISDPDFTDSFGEASAIGKYLAEQR
Ga0307292_1043210513300028811SoilMIELGRRKSMATRADFTDDEWEAMRKGVTGAGMLVSIGDRDFTDTFGEVGALAKRLSEER
Ga0302259_109417213300028861FenMASKADFTADEWETMWKGVTGAGMLVSVADRDFTDSFG
Ga0307278_1049884613300028878SoilMAAKTDFTEDEWKELQQGVTGAGLLVSTAHRDLTDS
Ga0311348_1028180523300030019FenMASKDDFSADEWGTLWKGVTGAGMLVSVADRDFTDSFGEASALAKRISEERVQGASELLR
Ga0311348_1148927513300030019FenMAGKADFTEDEWKGLAKGVTGAGMLVSLAHKDFTDS
Ga0247826_1124950213300030336SoilMATKADFTEQEWDALRKGITGAGMLVSLSDRDFTDTFGEVGALGKYLAGQQVAATSPLV
Ga0247826_1153559023300030336SoilMATKQDFSEEEWAALQRGVTGSGMLVSLSDRDFTDSFGEASALGKYLAGQQ
Ga0302287_1022466413300030673FenMASKADFTADEWETMWKGVTGAGMLVSVADRDFTDSFGEASALAKRISE
Ga0311366_1151016413300030943FenMAGKADFTEQEWSTLQKGVTGAGMLVSVAHRDFTDSFGEAKAI
Ga0308204_1012554933300031092SoilMAGKADFTEEEWEELHQGVTGAGMLVSTAHRDFTDSFGEASSIA
Ga0308181_112426713300031099SoilMAAKTDFTEDEWKELQQGVTGAGLLVSTAHRDFTDSFGEAKAVA
Ga0299914_1055764223300031228SoilMAGKADFTEDEWKDLQQGVTGAGMLVSAAHRDFTDSFGEATTVAKQLAAHGENESQLVR
Ga0311364_1044952133300031521FenMAGKADFTEQEWSTLQKGVTGAGMLVSVAHRDFTDSFGEAKAIAQDLAKHR
Ga0310887_1114814123300031547SoilMAGKADFTDEEWKELQQGVTGAGLLVSTAHRDFTDSFGEAKAVAAELAAHRDSASELVR
Ga0310886_1018914213300031562SoilMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTDTF
Ga0318515_1005872613300031572SoilVATKDMFTEDEWEALHKGATGAGLLVSVSDRDFTDSFGEASELAKRLRQEHE
Ga0310813_1211803913300031716SoilVATKADFTEDEWKTMQRGLTGAGALTAMADPDFTDSFGEASALA
Ga0318546_1004795013300031771SoilVATKDMFTEDEWEALHKGATGAGLLVSVSDRDFTDSFGEASELAKR
Ga0310907_1067658023300031847SoilMATKQDFSEEEWAALQRGVTGSGMLVSLSDRDFTDSFGEASAL
Ga0307410_1005280643300031852RhizosphereMTTKADFTEEEWETLRKGVSGAGTLASLSDRDFTDAFGEA
Ga0310904_1025119813300031854SoilMAGKADFTEDEWNELQQGVTGAGLLVSSAHRDFTDSFGEAKAVASHLAAHRS
Ga0310892_1056247813300031858SoilMASKTDFTEDEWAALQKGVTGSAMLVSLSDRDFTDMFGEVGAMAKYISGQSVASSSQLVRELSHG
Ga0315297_1154242113300031873SedimentMAGKADFTEDEWEALQQGVTGAGMLVSVADRDFTDSFGEASALAKQIAAHRENESRLVRD
Ga0310900_1068945433300031908SoilMAGKADFTEDEWNELQQGVTGAGLLVSSAHRDFTDSFGE
Ga0310900_1104833723300031908SoilMATRQDFTDEEWAALQKGLTGSGMLVSVSDRDFTDTFGEAGALAKYLAGQQTAATNE
Ga0306923_1105686813300031910SoilMATKADFSENEWATLHKGVTGAGLLVSVGDRDFTDTFGEAGALAKKLREEHEQNDNEL
Ga0311367_1160736613300031918FenMAAKADFTAEEWETLWKGVTGAGMLVSVGDRDFTDSFGEASALAKRISEE
Ga0310901_1029394313300031940SoilMAGKADFTDEEWKELQQGVTGAGLLVSTAHRDFTDSFGEAKAVAAELAAHR
Ga0310916_1171773113300031942SoilMATKADFTEDEWKAMQKGITGAGMLVSVSDQDFTDSFGEASALAKALAAQ
Ga0315278_1103758633300031997SedimentMAGKADFTEDEWDALQKGVTGAGMLVSVADRDFTDSFGEA
Ga0310906_1108959013300032013SoilMATKADFSEDEWKTMQKGITGAGVLVSVSDRDFTDTFGE
Ga0318514_1053451013300032066SoilMATKADFTEEEWEALHRGVTGAGMMVSTSDPGFTDSFGEASALAKH
Ga0310890_1113546823300032075SoilMATRSDFTDDEWEAMQKGVTGAGALVSVSDRDFTDTFGEASALAKALAAYREQ
Ga0310890_1149221023300032075SoilMAGKADFTEDEWRELQQGVTGAGMLVSTAHRDFTDSFGEAKAVAKQLQAHRASDSQLVRD
Ga0315292_1118483723300032143SedimentMAGKDDFSKDEWEELQKGVTGAGMLVSVSHRDFTDSFGEAST
Ga0315912_1150475113300032157SoilMAGKDAFTEDEWKTLHQGLAGAGMLVSTADRDFTDSFGEASALAK
Ga0315283_1073095523300032164SedimentMAGKADFSEDEWKALQKGVTGSGMLVSIADRDFTDSF
Ga0315283_1077662713300032164SedimentMAGKADFTEDEWEALQKGVTGAGMLVSVAHRDFTD
Ga0307471_10328075613300032180Hardwood Forest SoilMAGKADFTEQEWEDLQQGVTGAGMLVSAADRDFTDSFGEASAIAKRLAAHRESESQLV
Ga0315286_1121303313300032342SedimentMAGKADFSEDEWDALQKGVTGAGMLVSVADRDFTDSFGE
Ga0315286_1171213013300032342SedimentMAGKADFTEAEWKELQQGVTGAGMLVSTAHRDFTDSFAEASTVAKQLAAHRESESQLVRE
Ga0315273_1139605423300032516SedimentMAGRADFTEAEWKELQQGVTGAGMLVSTAHRDFTDSFAEAST
Ga0315273_1142677133300032516SedimentMAGKTNFSEDEWDALQKGVTGAGMLVSVADRDFTDSFGEASALAKQLAAHRESES
Ga0335082_1077272123300032782SoilMATKADFTEDEWDAMQKGVTGAGLLVSLSDADFTDSFGEASALAKYLAGQ
Ga0335080_1084053643300032828SoilVATKTDFSEDEWKAMHKGVTGAGMLVSVSDADFTDSFGEAKALAKELV
Ga0335084_1148031323300033004SoilMATKADFTEAEWDALQRGVTGAGLLVSLSDADFTDSFGEASAL
Ga0316616_10007669243300033521SoilMATRADFTEDEWKRLHQGVSGAGMLVSLADRDFSDSFGEATALAKFL
Ga0364933_142248_1_1803300034150SedimentMAAKTDFTEDEWKELQQGVTGAGLLVSTAHRDFTDSFGEAKAVASQLAAHRDSESELVRD
Ga0314797_057725_2_1603300034672SoilMATKQDFTEQEWASLERSISGTGLLVSLADRDFTDTFGEVGAMAKYLAGQQVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.