


| Basic Information | |
|---|---|
| Family ID | F015201 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 256 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 256 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.86 % |
| % of genes near scaffold ends (potentially truncated) | 19.53 % |
| % of genes from short scaffolds (< 2000 bps) | 69.92 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.047 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (26.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.453 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (47.656 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 256 Family Scaffolds |
|---|---|---|
| PF02511 | Thy1 | 56.64 |
| PF14284 | PcfJ | 3.12 |
| PF13482 | RNase_H_2 | 2.34 |
| PF00436 | SSB | 1.95 |
| PF01050 | MannoseP_isomer | 1.56 |
| PF00476 | DNA_pol_A | 1.56 |
| PF00908 | dTDP_sugar_isom | 0.39 |
| PF04014 | MazE_antitoxin | 0.39 |
| PF13392 | HNH_3 | 0.39 |
| PF02945 | Endonuclease_7 | 0.39 |
| PF00856 | SET | 0.39 |
| PF00210 | Ferritin | 0.39 |
| PF13936 | HTH_38 | 0.39 |
| PF13439 | Glyco_transf_4 | 0.39 |
| COG ID | Name | Functional Category | % Frequency in 256 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 56.64 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.95 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.95 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.56 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.39 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.95 % |
| Unclassified | root | N/A | 48.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10002153 | Not Available | 11641 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10005981 | Not Available | 6657 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10008538 | All Organisms → cellular organisms → Bacteria | 5448 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10066958 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1479 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10093879 | Not Available | 1150 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10132364 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 881 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10175295 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 512 | Open in IMG/M |
| 3300000126|BS_KBB_SWE26_205mDRAFT_c1003142 | All Organisms → Viruses → Predicted Viral | 3052 | Open in IMG/M |
| 3300000882|FwDRAFT_10047878 | Not Available | 826 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108334095 | Not Available | 852 | Open in IMG/M |
| 3300001687|WOR8_10020328 | Not Available | 6287 | Open in IMG/M |
| 3300005346|Ga0074242_11110431 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 2698 | Open in IMG/M |
| 3300005517|Ga0070374_10614243 | Not Available | 539 | Open in IMG/M |
| 3300005527|Ga0068876_10000190 | Not Available | 47410 | Open in IMG/M |
| 3300005527|Ga0068876_10285568 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 939 | Open in IMG/M |
| 3300005527|Ga0068876_10301011 | Not Available | 910 | Open in IMG/M |
| 3300005662|Ga0078894_10524633 | Not Available | 1061 | Open in IMG/M |
| 3300005662|Ga0078894_10878198 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 779 | Open in IMG/M |
| 3300005805|Ga0079957_1143257 | Not Available | 1227 | Open in IMG/M |
| 3300006025|Ga0075474_10183450 | Not Available | 647 | Open in IMG/M |
| 3300006026|Ga0075478_10002886 | Not Available | 6229 | Open in IMG/M |
| 3300006026|Ga0075478_10079481 | Not Available | 1056 | Open in IMG/M |
| 3300006026|Ga0075478_10133257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage PSS2 | 781 | Open in IMG/M |
| 3300006030|Ga0075470_10010970 | Not Available | 2794 | Open in IMG/M |
| 3300006734|Ga0098073_1003096 | All Organisms → Viruses → Predicted Viral | 3879 | Open in IMG/M |
| 3300006734|Ga0098073_1008373 | All Organisms → Viruses → Predicted Viral | 1861 | Open in IMG/M |
| 3300006734|Ga0098073_1017307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Lirvirus → Synechococcus virus SCBP3 | 1115 | Open in IMG/M |
| 3300006734|Ga0098073_1046427 | Not Available | 585 | Open in IMG/M |
| 3300006802|Ga0070749_10061831 | All Organisms → Viruses | 2258 | Open in IMG/M |
| 3300006802|Ga0070749_10070550 | Not Available | 2096 | Open in IMG/M |
| 3300006802|Ga0070749_10111954 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300006802|Ga0070749_10178344 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1225 | Open in IMG/M |
| 3300006802|Ga0070749_10206317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1124 | Open in IMG/M |
| 3300006802|Ga0070749_10231437 | Not Available | 1051 | Open in IMG/M |
| 3300006802|Ga0070749_10314992 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 875 | Open in IMG/M |
| 3300006810|Ga0070754_10007117 | Not Available | 7359 | Open in IMG/M |
| 3300006810|Ga0070754_10443763 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 563 | Open in IMG/M |
| 3300006867|Ga0075476_10091274 | Not Available | 1178 | Open in IMG/M |
| 3300006867|Ga0075476_10347305 | Not Available | 514 | Open in IMG/M |
| 3300006869|Ga0075477_10024826 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
| 3300006869|Ga0075477_10331197 | Not Available | 601 | Open in IMG/M |
| 3300006870|Ga0075479_10057778 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1647 | Open in IMG/M |
| 3300006916|Ga0070750_10132584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1137 | Open in IMG/M |
| 3300006919|Ga0070746_10017040 | All Organisms → Viruses → Predicted Viral | 4032 | Open in IMG/M |
| 3300006919|Ga0070746_10320926 | Not Available | 707 | Open in IMG/M |
| 3300007214|Ga0103959_1138040 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300007344|Ga0070745_1073402 | Not Available | 1369 | Open in IMG/M |
| 3300007538|Ga0099851_1001144 | Not Available | 11221 | Open in IMG/M |
| 3300007538|Ga0099851_1017333 | Not Available | 2924 | Open in IMG/M |
| 3300007538|Ga0099851_1019725 | All Organisms → Viruses → Predicted Viral | 2725 | Open in IMG/M |
| 3300007538|Ga0099851_1066034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1407 | Open in IMG/M |
| 3300007538|Ga0099851_1083382 | Not Available | 1229 | Open in IMG/M |
| 3300007538|Ga0099851_1110840 | Not Available | 1041 | Open in IMG/M |
| 3300007538|Ga0099851_1196516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 735 | Open in IMG/M |
| 3300007538|Ga0099851_1278282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 594 | Open in IMG/M |
| 3300007539|Ga0099849_1095857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1186 | Open in IMG/M |
| 3300007541|Ga0099848_1006260 | Not Available | 5433 | Open in IMG/M |
| 3300007541|Ga0099848_1043138 | Not Available | 1840 | Open in IMG/M |
| 3300007541|Ga0099848_1240592 | Not Available | 636 | Open in IMG/M |
| 3300007541|Ga0099848_1279153 | Not Available | 578 | Open in IMG/M |
| 3300007541|Ga0099848_1297333 | Not Available | 555 | Open in IMG/M |
| 3300007542|Ga0099846_1104976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1038 | Open in IMG/M |
| 3300007640|Ga0070751_1220745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300007960|Ga0099850_1057518 | Not Available | 1649 | Open in IMG/M |
| 3300007960|Ga0099850_1139366 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 982 | Open in IMG/M |
| 3300007973|Ga0105746_1236147 | Not Available | 628 | Open in IMG/M |
| 3300008055|Ga0108970_10410472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1144 | Open in IMG/M |
| 3300008120|Ga0114355_1055013 | Not Available | 1784 | Open in IMG/M |
| 3300008120|Ga0114355_1096562 | Not Available | 1173 | Open in IMG/M |
| 3300008262|Ga0114337_1128337 | Not Available | 1134 | Open in IMG/M |
| 3300009001|Ga0102963_1029150 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 2310 | Open in IMG/M |
| 3300009009|Ga0105105_10233964 | Not Available | 967 | Open in IMG/M |
| 3300009009|Ga0105105_10414061 | Not Available | 754 | Open in IMG/M |
| 3300009027|Ga0102957_1095568 | Not Available | 1033 | Open in IMG/M |
| 3300009075|Ga0105090_10664179 | Not Available | 633 | Open in IMG/M |
| 3300009165|Ga0105102_10481743 | Not Available | 671 | Open in IMG/M |
| 3300009165|Ga0105102_10517968 | Not Available | 649 | Open in IMG/M |
| 3300009169|Ga0105097_10080679 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1771 | Open in IMG/M |
| 3300009170|Ga0105096_10538011 | Not Available | 610 | Open in IMG/M |
| 3300009450|Ga0127391_1001591 | All Organisms → Viruses | 5110 | Open in IMG/M |
| 3300009492|Ga0127412_10007799 | Not Available | 1020 | Open in IMG/M |
| 3300009492|Ga0127412_10009976 | Not Available | 922 | Open in IMG/M |
| 3300009492|Ga0127412_10022647 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 679 | Open in IMG/M |
| 3300010296|Ga0129348_1177291 | Not Available | 730 | Open in IMG/M |
| 3300010296|Ga0129348_1179372 | Not Available | 726 | Open in IMG/M |
| 3300010297|Ga0129345_1268928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 594 | Open in IMG/M |
| 3300010299|Ga0129342_1186786 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 741 | Open in IMG/M |
| 3300010354|Ga0129333_10006122 | Not Available | 11372 | Open in IMG/M |
| 3300010354|Ga0129333_10048597 | All Organisms → Viruses | 3980 | Open in IMG/M |
| 3300010354|Ga0129333_10056286 | All Organisms → cellular organisms → Bacteria | 3673 | Open in IMG/M |
| 3300010354|Ga0129333_10337548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 1342 | Open in IMG/M |
| 3300010354|Ga0129333_10345628 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1324 | Open in IMG/M |
| 3300010354|Ga0129333_10443867 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1143 | Open in IMG/M |
| 3300010354|Ga0129333_10590678 | Not Available | 965 | Open in IMG/M |
| 3300010354|Ga0129333_10712570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → Actinomyces procaprae | 862 | Open in IMG/M |
| 3300010354|Ga0129333_10739686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 843 | Open in IMG/M |
| 3300010354|Ga0129333_10741630 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 841 | Open in IMG/M |
| 3300010354|Ga0129333_11220423 | Not Available | 624 | Open in IMG/M |
| 3300010354|Ga0129333_11276403 | Not Available | 607 | Open in IMG/M |
| 3300010354|Ga0129333_11349497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 588 | Open in IMG/M |
| 3300010354|Ga0129333_11755714 | Not Available | 504 | Open in IMG/M |
| 3300010370|Ga0129336_10092013 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1782 | Open in IMG/M |
| 3300010370|Ga0129336_10288366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 | 915 | Open in IMG/M |
| 3300010389|Ga0136549_10030937 | Not Available | 3006 | Open in IMG/M |
| 3300011984|Ga0119931_1018611 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012000|Ga0119951_1025684 | Not Available | 2011 | Open in IMG/M |
| 3300012013|Ga0153805_1058045 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 655 | Open in IMG/M |
| 3300013087|Ga0163212_1153302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 728 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10140928 | Not Available | 1609 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10177479 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1477 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10038482 | Not Available | 4897 | Open in IMG/M |
| 3300014050|Ga0119952_1004598 | Not Available | 6698 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10288204 | Not Available | 987 | Open in IMG/M |
| 3300014801|Ga0119946_1017361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 739 | Open in IMG/M |
| 3300016697|Ga0180057_1058949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 1133 | Open in IMG/M |
| 3300017707|Ga0181363_1001643 | All Organisms → cellular organisms → Bacteria | 5282 | Open in IMG/M |
| 3300017747|Ga0181352_1015684 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 2394 | Open in IMG/M |
| 3300017785|Ga0181355_1214374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 751 | Open in IMG/M |
| 3300017788|Ga0169931_10051687 | Not Available | 4413 | Open in IMG/M |
| 3300017788|Ga0169931_10228180 | Not Available | 1549 | Open in IMG/M |
| 3300017788|Ga0169931_10279190 | Not Available | 1334 | Open in IMG/M |
| 3300017951|Ga0181577_10038929 | Not Available | 3420 | Open in IMG/M |
| 3300017956|Ga0181580_10305259 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1082 | Open in IMG/M |
| 3300017963|Ga0180437_10580127 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 820 | Open in IMG/M |
| 3300017968|Ga0181587_10664022 | Not Available | 661 | Open in IMG/M |
| 3300017968|Ga0181587_11017655 | Not Available | 506 | Open in IMG/M |
| 3300019784|Ga0181359_1004421 | All Organisms → Viruses | 4461 | Open in IMG/M |
| 3300019784|Ga0181359_1008462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 3557 | Open in IMG/M |
| 3300019784|Ga0181359_1156036 | Not Available | 778 | Open in IMG/M |
| 3300020074|Ga0194113_10036620 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 4999 | Open in IMG/M |
| 3300020074|Ga0194113_10242743 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300020074|Ga0194113_10446696 | Not Available | 939 | Open in IMG/M |
| 3300020074|Ga0194113_10734972 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 681 | Open in IMG/M |
| 3300020109|Ga0194112_10238948 | Not Available | 1430 | Open in IMG/M |
| 3300020179|Ga0194134_10003009 | Not Available | 18835 | Open in IMG/M |
| 3300020179|Ga0194134_10006240 | Not Available | 10809 | Open in IMG/M |
| 3300020179|Ga0194134_10207730 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 835 | Open in IMG/M |
| 3300020179|Ga0194134_10270515 | Not Available | 685 | Open in IMG/M |
| 3300020183|Ga0194115_10050819 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2627 | Open in IMG/M |
| 3300020183|Ga0194115_10297399 | Not Available | 738 | Open in IMG/M |
| 3300020190|Ga0194118_10103344 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1744 | Open in IMG/M |
| 3300020204|Ga0194116_10038506 | Not Available | 3572 | Open in IMG/M |
| 3300020378|Ga0211527_10047739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1346 | Open in IMG/M |
| 3300020498|Ga0208050_1003939 | All Organisms → Viruses | 1878 | Open in IMG/M |
| 3300020551|Ga0208360_1013702 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1123 | Open in IMG/M |
| 3300020566|Ga0208222_1002946 | All Organisms → Viruses | 4465 | Open in IMG/M |
| 3300021092|Ga0194122_10265424 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 888 | Open in IMG/M |
| 3300021092|Ga0194122_10669419 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 507 | Open in IMG/M |
| 3300021335|Ga0213867_1001530 | Not Available | 10320 | Open in IMG/M |
| 3300021356|Ga0213858_10388756 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 656 | Open in IMG/M |
| 3300021376|Ga0194130_10167787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1332 | Open in IMG/M |
| 3300021376|Ga0194130_10388200 | Not Available | 745 | Open in IMG/M |
| 3300021960|Ga0222715_10142731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 1494 | Open in IMG/M |
| 3300021961|Ga0222714_10001421 | Not Available | 26956 | Open in IMG/M |
| 3300021961|Ga0222714_10036322 | All Organisms → cellular organisms → Bacteria | 3585 | Open in IMG/M |
| 3300021961|Ga0222714_10037972 | All Organisms → cellular organisms → Bacteria | 3482 | Open in IMG/M |
| 3300021961|Ga0222714_10095466 | All Organisms → Viruses → Predicted Viral | 1896 | Open in IMG/M |
| 3300021961|Ga0222714_10161812 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1330 | Open in IMG/M |
| 3300021962|Ga0222713_10006804 | Not Available | 10807 | Open in IMG/M |
| 3300021962|Ga0222713_10053070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 3085 | Open in IMG/M |
| 3300021962|Ga0222713_10374288 | Not Available | 884 | Open in IMG/M |
| 3300021963|Ga0222712_10217047 | Not Available | 1242 | Open in IMG/M |
| 3300021964|Ga0222719_10467949 | Not Available | 765 | Open in IMG/M |
| 3300022069|Ga0212026_1017405 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 994 | Open in IMG/M |
| 3300022176|Ga0212031_1008634 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1394 | Open in IMG/M |
| 3300022176|Ga0212031_1024228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 959 | Open in IMG/M |
| 3300022179|Ga0181353_1003376 | All Organisms → cellular organisms → Bacteria | 3577 | Open in IMG/M |
| 3300022179|Ga0181353_1066734 | Not Available | 924 | Open in IMG/M |
| 3300022187|Ga0196899_1109640 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 808 | Open in IMG/M |
| 3300022198|Ga0196905_1000292 | Not Available | 20200 | Open in IMG/M |
| 3300022198|Ga0196905_1003066 | Not Available | 6168 | Open in IMG/M |
| 3300022198|Ga0196905_1035391 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
| 3300022198|Ga0196905_1151408 | Not Available | 597 | Open in IMG/M |
| 3300022198|Ga0196905_1163260 | Not Available | 569 | Open in IMG/M |
| 3300022200|Ga0196901_1007810 | All Organisms → cellular organisms → Bacteria | 4644 | Open in IMG/M |
| 3300022200|Ga0196901_1008814 | Not Available | 4334 | Open in IMG/M |
| 3300022200|Ga0196901_1079362 | Not Available | 1173 | Open in IMG/M |
| 3300022407|Ga0181351_1037599 | All Organisms → Viruses | 2049 | Open in IMG/M |
| 3300022752|Ga0214917_10117580 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1493 | Open in IMG/M |
| 3300022752|Ga0214917_10266029 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 787 | Open in IMG/M |
| 3300023116|Ga0255751_10150163 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1368 | Open in IMG/M |
| 3300023176|Ga0255772_10244267 | Not Available | 986 | Open in IMG/M |
| 3300024354|Ga0255171_1099562 | Not Available | 514 | Open in IMG/M |
| 3300025057|Ga0208018_100365 | Not Available | 12556 | Open in IMG/M |
| 3300025057|Ga0208018_101370 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 4973 | Open in IMG/M |
| 3300025057|Ga0208018_109860 | Not Available | 1356 | Open in IMG/M |
| 3300025283|Ga0208048_1003739 | All Organisms → cellular organisms → Bacteria | 6899 | Open in IMG/M |
| 3300025610|Ga0208149_1001575 | Not Available | 8389 | Open in IMG/M |
| 3300025646|Ga0208161_1039430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1594 | Open in IMG/M |
| 3300025646|Ga0208161_1052433 | Not Available | 1296 | Open in IMG/M |
| 3300025646|Ga0208161_1097780 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 815 | Open in IMG/M |
| 3300025646|Ga0208161_1103838 | Not Available | 778 | Open in IMG/M |
| 3300025646|Ga0208161_1107720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300025646|Ga0208161_1155402 | Not Available | 566 | Open in IMG/M |
| 3300025647|Ga0208160_1080550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 873 | Open in IMG/M |
| 3300025647|Ga0208160_1105862 | Not Available | 724 | Open in IMG/M |
| 3300025655|Ga0208795_1141551 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 609 | Open in IMG/M |
| 3300025671|Ga0208898_1154163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 616 | Open in IMG/M |
| 3300025828|Ga0208547_1080795 | Not Available | 1039 | Open in IMG/M |
| 3300025853|Ga0208645_1047073 | All Organisms → Viruses | 2083 | Open in IMG/M |
| 3300025853|Ga0208645_1134501 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 965 | Open in IMG/M |
| 3300027683|Ga0209392_1069442 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1137 | Open in IMG/M |
| 3300027693|Ga0209704_1113858 | Not Available | 774 | Open in IMG/M |
| 3300027693|Ga0209704_1170751 | Not Available | 632 | Open in IMG/M |
| 3300027697|Ga0209033_1249811 | Not Available | 512 | Open in IMG/M |
| 3300027762|Ga0209288_10121061 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 830 | Open in IMG/M |
| 3300027762|Ga0209288_10123820 | Not Available | 821 | Open in IMG/M |
| 3300027793|Ga0209972_10146119 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300027814|Ga0209742_10058677 | Not Available | 1258 | Open in IMG/M |
| 3300027814|Ga0209742_10290424 | Not Available | 538 | Open in IMG/M |
| 3300027892|Ga0209550_10077831 | All Organisms → Viruses | 2556 | Open in IMG/M |
| 3300027917|Ga0209536_100260755 | All Organisms → Viruses | 2171 | Open in IMG/M |
| 3300029930|Ga0119944_1003482 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
| 3300029933|Ga0119945_1036461 | Not Available | 546 | Open in IMG/M |
| 3300031539|Ga0307380_10172419 | Not Available | 2121 | Open in IMG/M |
| 3300031539|Ga0307380_10505608 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300031539|Ga0307380_10684054 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 867 | Open in IMG/M |
| 3300031539|Ga0307380_11202589 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 587 | Open in IMG/M |
| 3300031565|Ga0307379_10213998 | Not Available | 1961 | Open in IMG/M |
| 3300031565|Ga0307379_11255764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300031566|Ga0307378_11534245 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 505 | Open in IMG/M |
| 3300031578|Ga0307376_10259395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1170 | Open in IMG/M |
| 3300031669|Ga0307375_10201765 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1334 | Open in IMG/M |
| 3300031673|Ga0307377_10575291 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 809 | Open in IMG/M |
| 3300031758|Ga0315907_10127740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus | 2166 | Open in IMG/M |
| 3300031784|Ga0315899_10010017 | Not Available | 10152 | Open in IMG/M |
| 3300031784|Ga0315899_11373301 | Not Available | 600 | Open in IMG/M |
| 3300031787|Ga0315900_10059736 | All Organisms → Viruses → Predicted Viral | 3952 | Open in IMG/M |
| 3300031857|Ga0315909_10015293 | Not Available | 7886 | Open in IMG/M |
| 3300031857|Ga0315909_10155235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 1877 | Open in IMG/M |
| 3300031857|Ga0315909_10572264 | Not Available | 762 | Open in IMG/M |
| 3300031857|Ga0315909_10815254 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 588 | Open in IMG/M |
| 3300031951|Ga0315904_10348480 | All Organisms → Viruses → Predicted Viral | 1364 | Open in IMG/M |
| 3300031951|Ga0315904_10409460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1226 | Open in IMG/M |
| 3300031951|Ga0315904_10464770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 1126 | Open in IMG/M |
| 3300032050|Ga0315906_10243389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1 | 1659 | Open in IMG/M |
| 3300032050|Ga0315906_10926320 | Not Available | 665 | Open in IMG/M |
| 3300032093|Ga0315902_10083364 | Not Available | 3524 | Open in IMG/M |
| 3300032136|Ga0316201_11101548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300033816|Ga0334980_0016589 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 3173 | Open in IMG/M |
| 3300033816|Ga0334980_0021001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2803 | Open in IMG/M |
| 3300033816|Ga0334980_0150112 | Not Available | 954 | Open in IMG/M |
| 3300033978|Ga0334977_0274727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 819 | Open in IMG/M |
| 3300033981|Ga0334982_0171731 | Not Available | 1090 | Open in IMG/M |
| 3300034012|Ga0334986_0000145 | Not Available | 58647 | Open in IMG/M |
| 3300034012|Ga0334986_0019750 | Not Available | 4618 | Open in IMG/M |
| 3300034019|Ga0334998_0228557 | Not Available | 1140 | Open in IMG/M |
| 3300034061|Ga0334987_0002454 | Not Available | 17959 | Open in IMG/M |
| 3300034061|Ga0334987_0646045 | Not Available | 616 | Open in IMG/M |
| 3300034072|Ga0310127_006868 | Not Available | 9250 | Open in IMG/M |
| 3300034072|Ga0310127_277914 | Not Available | 582 | Open in IMG/M |
| 3300034073|Ga0310130_0001567 | Not Available | 12200 | Open in IMG/M |
| 3300034073|Ga0310130_0001607 | All Organisms → Viruses | 11932 | Open in IMG/M |
| 3300034104|Ga0335031_0066725 | All Organisms → cellular organisms → Bacteria | 2573 | Open in IMG/M |
| 3300034118|Ga0335053_0047630 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300034355|Ga0335039_0454429 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 649 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 26.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.03% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.30% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.73% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.34% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.34% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.56% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.56% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.17% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.17% |
| Methane Seep | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep | 1.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.78% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.78% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.78% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.39% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.39% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.39% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.39% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.39% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.39% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.39% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.39% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.39% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.39% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.39% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.39% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.39% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.39% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.39% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009492 | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300016697 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100021532 | 3300000116 | Marine | MNKALIVYLVNNKKKVARQDIESQRALKELKKQTTASF* |
| DelMOSpr2010_1000598110 | 3300000116 | Marine | MNKALIVYLVNQKKKQARKNVESKHAVTELKKQSAATF* |
| DelMOSpr2010_100085385 | 3300000116 | Marine | MNKALIVYLVNQKKKQARKEIESKHAVAELKKQYAATF* |
| DelMOSpr2010_100669582 | 3300000116 | Marine | MSKALIVYLIDKRKKQARLDVESKHAVAELKKQSAATF* |
| DelMOSpr2010_100938792 | 3300000116 | Marine | MNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF* |
| DelMOSpr2010_101323642 | 3300000116 | Marine | MNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF* |
| BS_KBA_SWE12_21mDRAFT_101752952 | 3300000124 | Marine | MNQALIVYLQGQKKQAARKDVESKHAAKQLEKQATATF* |
| BS_KBB_SWE26_205mDRAFT_10031421 | 3300000126 | Marine | MNKALIVYLVDRKKKVARKDAESKHAIKQLEKQTTATF* |
| FwDRAFT_100478781 | 3300000882 | Freshwater And Marine | MNKALIVYLIDRKKKVARKDVESKHAIKQLEKQTTATF* |
| JGIcombinedJ13530_1083340952 | 3300001213 | Wetland | MNKALIVYLVDKRKKLARKNVESKHATAELKKQSAATF* |
| WOR8_100203289 | 3300001687 | Marine Sediment | MNKALIVYLIDKRKKQARMDVEFKHAVTELKKQSAATF* |
| Ga0074242_111104314 | 3300005346 | Saline Water And Sediment | MNKALSRFTWLNQKKKQARKEIESKHAVAELKKQYAATF* |
| Ga0070374_106142431 | 3300005517 | Freshwater Lake | MNKALIVYLVGQKKKAARKDVESKHGIKQLEKQTTATF*SLIVYV |
| Ga0068876_1000019043 | 3300005527 | Freshwater Lake | MNKALIIYLVDKKKKAARKDVESKHAVKQLEKQTTATF* |
| Ga0068876_102855682 | 3300005527 | Freshwater Lake | MNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAATF* |
| Ga0068876_103010112 | 3300005527 | Freshwater Lake | MNKALIVYLADRKKKVARKDVESKHAIKQLEKQTTATF* |
| Ga0078894_105246333 | 3300005662 | Freshwater Lake | MNKALIVYLMNKKKKLARKDVESKHAVTELKKQSAATF* |
| Ga0078894_108781982 | 3300005662 | Freshwater Lake | MKPALIVYLVSTKKKMTRKDVESKHAVTELKKQSAATF* |
| Ga0079957_11432574 | 3300005805 | Lake | MNKALIVYLVDKRKKLARKDVESKHATTELKKQSAATF* |
| Ga0075474_101834501 | 3300006025 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVTELKKQNA |
| Ga0075478_100028862 | 3300006026 | Aqueous | MNKALIIYLVNKKKKVARQDIESQRALKELKKQTTASF* |
| Ga0075478_100794812 | 3300006026 | Aqueous | MSKALIVYLIDKRKKQARLDMESKHAVAELKKQSAATF* |
| Ga0075478_101332571 | 3300006026 | Aqueous | MNKALIVYLVNQKKKQTRKDVESKHAVTELKKQSAATF* |
| Ga0075470_100109703 | 3300006030 | Aqueous | MNKALIVYLVDRKKKVARKDVESKHAIKELKKQTTATF* |
| Ga0098073_10030963 | 3300006734 | Marine | MNQALIVYLVGQKKQAARKDVESKRAVKELKKQPAATF* |
| Ga0098073_10083731 | 3300006734 | Marine | ALIVYLVNQKKKLARKDVESKHAVTELKKQSAATF* |
| Ga0098073_10173071 | 3300006734 | Marine | MNKALIVYLVNNKKKVARQDIESQRALKELKKQTT |
| Ga0098073_10464272 | 3300006734 | Marine | MNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF* |
| Ga0070749_100618312 | 3300006802 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAATF* |
| Ga0070749_100705507 | 3300006802 | Aqueous | RSNQMNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF* |
| Ga0070749_101119543 | 3300006802 | Aqueous | MNKALIVYLVDRKKKVARKDVESKHAIKQLEKQTTATF* |
| Ga0070749_101783442 | 3300006802 | Aqueous | MNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATF* |
| Ga0070749_102063173 | 3300006802 | Aqueous | MNQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV* |
| Ga0070749_102314371 | 3300006802 | Aqueous | MNKALIVYLVNQKKKQARKEIESKHAVKQLEKQTTATF* |
| Ga0070749_103149921 | 3300006802 | Aqueous | MNKALIVYLVNQKKKQTRKDMESKHAVTELKKQSAATF* |
| Ga0070754_1000711711 | 3300006810 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAATF* |
| Ga0070754_104437633 | 3300006810 | Aqueous | MNKALIVYLVGQKKDKARKDVESKRAVKELKKETAATF* |
| Ga0075476_100912741 | 3300006867 | Aqueous | LIVYLVNQKKKQARKDVESKHAVTELKKQNAATF* |
| Ga0075476_103473051 | 3300006867 | Aqueous | MNKALIVYLVNQKKKQTRKDVESKHAVTELKKQSAATF*SPL |
| Ga0075477_100248266 | 3300006869 | Aqueous | VNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF* |
| Ga0075477_103311971 | 3300006869 | Aqueous | MNKALIVYLVDKKKKQARKEIESKHAVVELKKQYAATF* |
| Ga0075479_100577781 | 3300006870 | Aqueous | MNKALIVYLVNQKKKQARLDVESKHAVTELKKQSAA |
| Ga0070750_101325843 | 3300006916 | Aqueous | SNQMNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF* |
| Ga0070746_100170407 | 3300006919 | Aqueous | MNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF*SPLV* |
| Ga0070746_103209262 | 3300006919 | Aqueous | HRRSNQMNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF* |
| Ga0103959_11380404 | 3300007214 | Freshwater Lake | MNKALIVYLVSQKKKEARKDVESKHAIKELKKQPSVTF* |
| Ga0070745_10734023 | 3300007344 | Aqueous | MNKALIVYLVNQKKKQARKEVESKHAVAELKKQYAATF* |
| Ga0099851_10011447 | 3300007538 | Aqueous | MNKALIVYLVDKKKKMARTDVESKHAIKELKKQSAATF* |
| Ga0099851_10173338 | 3300007538 | Aqueous | MNKALIVYLVDKRKKLARKDVESKHATAELKKQSAATF* |
| Ga0099851_10197258 | 3300007538 | Aqueous | RSNQMNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATF* |
| Ga0099851_10660342 | 3300007538 | Aqueous | MNKALIVYLVDKKKKVARKDVESKHAIAELKKQSAATF* |
| Ga0099851_10833822 | 3300007538 | Aqueous | MNKALIVYLIDKRKKQARMDVESKHAVTELKKQSAATF* |
| Ga0099851_11108402 | 3300007538 | Aqueous | MNKALIVYLVGQKKKVARKDVESKHALAELKKQSAATF* |
| Ga0099851_11965162 | 3300007538 | Aqueous | MKPALIVYLVSTKKKLARKEIESKHAIKELKKQYAATF* |
| Ga0099851_12782821 | 3300007538 | Aqueous | MNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATF* |
| Ga0099849_10958571 | 3300007539 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAA |
| Ga0099848_100626012 | 3300007541 | Aqueous | MNKALIVYLVDKRKKLARKDVESKHATGELKKQSAATF* |
| Ga0099848_10431381 | 3300007541 | Aqueous | SNQMNKALIVYLIDKRKKQARMDVESKHAVTELKKQSAATF* |
| Ga0099848_12405921 | 3300007541 | Aqueous | MNKALIVYLVDKRKKQTRKDVESKHAVTELKKQSAATF* |
| Ga0099848_12791532 | 3300007541 | Aqueous | MNKALIVYLVDKKKKTARKEVESKHAVQELKKQYAATF* |
| Ga0099848_12973331 | 3300007541 | Aqueous | NQMNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF* |
| Ga0099846_11049762 | 3300007542 | Aqueous | MNKALIVYLVNQKKKLARKDVESKHAVTELKKQSAATF* |
| Ga0070751_12207452 | 3300007640 | Aqueous | MNKALIVYLVNQKKKQARKDMESKHAVTELKKQSAATF* |
| Ga0099850_10575181 | 3300007960 | Aqueous | ALIVYLVDKKKKVARKDVESKHAIAELKKQSAATF* |
| Ga0099850_11393663 | 3300007960 | Aqueous | MNKALVVYLINKKKKMTRSDVESKHAIKELQKQSAATF* |
| Ga0105746_12361471 | 3300007973 | Estuary Water | MNKALIVYLVDKKKKTARKEIESKHAVEELKKQCAATF* |
| Ga0108970_104104722 | 3300008055 | Estuary | MDQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV* |
| Ga0114355_10550132 | 3300008120 | Freshwater, Plankton | MNKALIVYLIDKRKKQTRKDVESKHAVKQLEKQATATF* |
| Ga0114355_10965621 | 3300008120 | Freshwater, Plankton | QMNKALIVYLVDKRKKLTRKDVESKHAVSELKKQSAATF* |
| Ga0114337_11283372 | 3300008262 | Freshwater, Plankton | MNKALIVYLVGRKKKVARKDVESKHAIAELKKQSAATF* |
| Ga0102963_10291503 | 3300009001 | Pond Water | MNKALIVYLVDKRKKQARLDVESKHAVTELKKQSAATF* |
| Ga0105105_102339644 | 3300009009 | Freshwater Sediment | MNKALIVYLVDKRKKLARKDIESKHAVTELKKQSAATF* |
| Ga0105105_104140612 | 3300009009 | Freshwater Sediment | MNKALIVYLVNKKKKLARKDVESKHAVTELKKQSAATF* |
| Ga0102957_10955683 | 3300009027 | Pond Water | MSKALIVYLIDKRKKQARLDVESKHAVTELKKQSAATF* |
| Ga0105090_106641791 | 3300009075 | Freshwater Sediment | TNQMNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF* |
| Ga0105102_104817432 | 3300009165 | Freshwater Sediment | MNKALIVYLVNRRKKLARKDVESKHAVTELKKQSAATF* |
| Ga0105102_105179681 | 3300009165 | Freshwater Sediment | RHWKTNQMNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF* |
| Ga0105097_100806792 | 3300009169 | Freshwater Sediment | MNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF* |
| Ga0105096_105380113 | 3300009170 | Freshwater Sediment | MNKALIVYLVDRRKKLARKDVASKHAVTELKKQNAATF* |
| Ga0127391_100159113 | 3300009450 | Meromictic Pond | MNKALIVYLVNQKKKQARKDVESLHAVTELKKQSAATF* |
| Ga0127412_100077992 | 3300009492 | Methane Seep | MNKALIVYLEAQKKKVARKDVESKHAAEQLEKQATATF* |
| Ga0127412_100099762 | 3300009492 | Methane Seep | MSKALIVYLVNQKKKQARLDVESKHAVTELKKQSAATF* |
| Ga0127412_100226472 | 3300009492 | Methane Seep | MNQALIVYLINQKKKQARKDVESKHAVTELKKQSAATF* |
| Ga0129348_11772911 | 3300010296 | Freshwater To Marine Saline Gradient | MKKALIVYLVNQKKKQARKEIESKHAVAELKKQYAATF* |
| Ga0129348_11793721 | 3300010296 | Freshwater To Marine Saline Gradient | MNKALIVYLVSQKKKQARKEIESKHAVAELKKQYAATF* |
| Ga0129345_12689281 | 3300010297 | Freshwater To Marine Saline Gradient | MNKALIVYLVNQKKKLARKDVESKHAVTELKKQSA |
| Ga0129342_11867863 | 3300010299 | Freshwater To Marine Saline Gradient | MNKALIVYLVNQKKKQARKEIESKHAVAELKKQYA |
| Ga0129333_100061228 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVDRKKKVARKDVESNHAIKQLEKQTTATF* |
| Ga0129333_100485975 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVDKKKKVARKDVESKHAIKELKKQTTATF* |
| Ga0129333_100562865 | 3300010354 | Freshwater To Marine Saline Gradient | MKPALIVYLVNTKKKLARKEIESKHAITELKKQYAATF* |
| Ga0129333_103375482 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVDKRKKMARKDIESKHATTELKKQSAATF* |
| Ga0129333_103456283 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLIDQKKKTARRDIESKHAIKELKKQPASTF* |
| Ga0129333_104438673 | 3300010354 | Freshwater To Marine Saline Gradient | MSKALIVYLIDKRKKQARKDIESKHAVTELKKQSAATF* |
| Ga0129333_105906782 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVDKRKKLARKDVESKHAVKELKEQSTATF* |
| Ga0129333_107125704 | 3300010354 | Freshwater To Marine Saline Gradient | NKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF* |
| Ga0129333_107396862 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVDKRKKLARKDVESKHAVTELKKQNAATF* |
| Ga0129333_107416301 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVDKKKKVARKDVESKHAIKQLEKQTTATF* |
| Ga0129333_112204232 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVGQKKKVARKDVESKHAVKQLEKQATATF* |
| Ga0129333_112764032 | 3300010354 | Freshwater To Marine Saline Gradient | MNKALIVYLVNQKKKQTRKDVESQHAVTELKKQSAATF* |
| Ga0129333_113494971 | 3300010354 | Freshwater To Marine Saline Gradient | MKPALIVYLVDAKKKLARKEIESKHAIKELKKQYAATF* |
| Ga0129333_117557142 | 3300010354 | Freshwater To Marine Saline Gradient | MKPALIVYLVSTKKKMARKDVESKHAVTELKKQSAATF* |
| Ga0129336_100920132 | 3300010370 | Freshwater To Marine Saline Gradient | MNKALIVYLVNKKKKVARKDIESKHAIKELKKQATATF* |
| Ga0129336_102883661 | 3300010370 | Freshwater To Marine Saline Gradient | LIVYLVDKRKKLARKDVEYKHAVTELKKQSAATF* |
| Ga0136549_100309378 | 3300010389 | Marine Methane Seep Sediment | MNKALIVYLVNQKKKQARKDVESKHATAELKKQSAATF* |
| Ga0119931_10186112 | 3300011984 | Drinking Water Treatment Plant | MNKALIVYLVDRKKKMARQDIESKHAIKELKKQPASTF* |
| Ga0119951_10256841 | 3300012000 | Freshwater | MNKALIVYLVDQKKKTARKDTEFKHAIKELKKQPASTF* |
| Ga0153805_10580452 | 3300012013 | Surface Ice | MNQALIVYLVNQKKKTTRKEIESKHAIEALKKQYAATF* |
| Ga0163212_11533023 | 3300013087 | Freshwater | MNKVLIVYLVNQKKKAARKDIESKRAIKELKKQSTVTF* |
| (restricted) Ga0172367_101409282 | 3300013126 | Freshwater | MNKALIVYLVDQKKKTARKDIESKHAIKELKKQPTVTF* |
| (restricted) Ga0172373_101774793 | 3300013131 | Freshwater | MNKALIVYLVNQKKKEARKDIESKHAIKELKKQSTVTF* |
| (restricted) Ga0172375_100384823 | 3300013137 | Freshwater | MNKALIVYLVDQRKKTARKDIESKHALKELKKQPTVTF* |
| Ga0119952_10045982 | 3300014050 | Freshwater | MNKALIVYLVDQKKKTARKDTEFKHAIKELKKQPTVTF* |
| (restricted) Ga0172376_102882043 | 3300014720 | Freshwater | MNKALIVYLVVQKKKTARKDIESKHALKELKKQPTVTF* |
| Ga0119946_10173611 | 3300014801 | Aquatic | MNKALIVYLVDRKRKVVRKDVESKHAIKELKKQTTATF* |
| Ga0180057_10589491 | 3300016697 | Freshwater | MDQALLVYLANQKKKQTRKDVESKRAIQELKKQPAEVVV |
| Ga0181363_10016436 | 3300017707 | Freshwater Lake | MNKALIVYLVDKRKKMARKDVESKHAITELKKQSAATF |
| Ga0181352_10156843 | 3300017747 | Freshwater Lake | MKPALIVYLVSTKKKMTRKDVESKHAVTELKKQSAATF |
| Ga0181355_12143743 | 3300017785 | Freshwater Lake | MNKALIVYLVDRRKKLARKDIESKHAVTELKKQSAATF |
| Ga0169931_100516874 | 3300017788 | Freshwater | MNKALIVYLVNQKKKIARKEIESKHAVNELKKQYAATF |
| Ga0169931_102281802 | 3300017788 | Freshwater | MNKALITYLVDKKKKATRKDIESVRAIKELEKQPTSTF |
| Ga0169931_102791902 | 3300017788 | Freshwater | MNKALIVYLVDQRKKTARKDIESKHALKELKKQPTVTF |
| Ga0181577_100389298 | 3300017951 | Salt Marsh | MNKALIVYLVNNKKKVARQDIESQRALKELKKQTTASF |
| Ga0181580_103052592 | 3300017956 | Salt Marsh | MNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATF |
| Ga0180437_105801272 | 3300017963 | Hypersaline Lake Sediment | MNKALIVYLVNQKKKQARKDMESQHATAELKKQSVATF |
| Ga0181587_106640221 | 3300017968 | Salt Marsh | MNKALIVYLVIQKKKQARKEIESKHAVAELKKQYAATF |
| Ga0181587_110176552 | 3300017968 | Salt Marsh | MNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATFXSP |
| Ga0181359_10044215 | 3300019784 | Freshwater Lake | MDQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV |
| Ga0181359_10084628 | 3300019784 | Freshwater Lake | MNKALIVYLVDRKKKVARKDVESKHAIKQLEKQTTATF |
| Ga0181359_11560363 | 3300019784 | Freshwater Lake | MNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAATF |
| Ga0194113_100366206 | 3300020074 | Freshwater Lake | MNKALIVYLVNQKKKEARKDIESKHAIKELKKQSTVTF |
| Ga0194113_102427432 | 3300020074 | Freshwater Lake | MKQALIVYLVSQKKKRARQENESKHAIKELKKQAAVTLG |
| Ga0194113_104466962 | 3300020074 | Freshwater Lake | MNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0194113_107349722 | 3300020074 | Freshwater Lake | MNKALIVYLVNQKKKAARKDIESKRAIKELKKQSTVTF |
| Ga0194112_102389483 | 3300020109 | Freshwater Lake | MNKALIVYLVHQQKKVARKDVESKHAIKELEKQTT |
| Ga0194134_1000300923 | 3300020179 | Freshwater Lake | MNKALIIYLIDKKKKTTRTNVESVRAIKELEKQKSATF |
| Ga0194134_100062407 | 3300020179 | Freshwater Lake | MNKALIVYLVNQKKKTARKDIESKHAIKELKKQPTVTF |
| Ga0194134_102077302 | 3300020179 | Freshwater Lake | MNKALIIYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0194134_102705152 | 3300020179 | Freshwater Lake | PNQMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0194115_100508197 | 3300020183 | Freshwater Lake | MNKALIVYLAQQQKRVARKDVESKHAIKELEKQTTATF |
| Ga0194115_102973991 | 3300020183 | Freshwater Lake | KPNQMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0194118_101033441 | 3300020190 | Freshwater Lake | NKALIIYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0194116_100385061 | 3300020204 | Freshwater Lake | KALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0211527_100477395 | 3300020378 | Marine | MNTALLVHLLNKKKKQTRKEIELKHAVAELKKQYAATF |
| Ga0208050_10039392 | 3300020498 | Freshwater | MNQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV |
| Ga0208360_10137022 | 3300020551 | Freshwater | MNKALIVYLVNQKKKTTRKEIESKHAIEALKKQYAATF |
| Ga0208222_10029461 | 3300020566 | Freshwater | MNKALIVYLVDKRKKLARKDIESKHAVTELKKQSAATF |
| Ga0194122_102654242 | 3300021092 | Freshwater Lake | QINKALIIYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0194122_106694192 | 3300021092 | Freshwater Lake | NKALIVYLAHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0213867_100153028 | 3300021335 | Seawater | MNKALIVYLVNNKKKVARQDIESQRALKELKKQTTAAF |
| Ga0213858_103887562 | 3300021356 | Seawater | MNKALIVYLVNQKKKQARKEIESKHAVAELKKQYAATF |
| Ga0194130_101677873 | 3300021376 | Freshwater Lake | MNKALITYLVDKKKKTTRKDIESVRAIKELEKQPTSTF |
| Ga0194130_103882001 | 3300021376 | Freshwater Lake | NQMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF |
| Ga0222715_101427312 | 3300021960 | Estuarine Water | MNKALIVYLVDRKKKVTRKDVESKHAIKELKKQTTATF |
| Ga0222714_1000142147 | 3300021961 | Estuarine Water | MNKALIVYLVDKRKKLARKDVESKHATTELKKQSAATF |
| Ga0222714_100363222 | 3300021961 | Estuarine Water | MKKALIVYLVNQQKKVARKDVESKRALKELKKETAASF |
| Ga0222714_100379727 | 3300021961 | Estuarine Water | MNKALIVYLVNQKKKVARKDVESKHAIKELEKQTTATF |
| Ga0222714_100954661 | 3300021961 | Estuarine Water | NQMNKALIVYLVGQKKKAARKDVESKHAVKALEKQATATF |
| Ga0222714_101618122 | 3300021961 | Estuarine Water | MKPALIVYLVETKKKLARKENESKHAIKELKKQYAATF |
| Ga0222713_100068046 | 3300021962 | Estuarine Water | MNKALIVYLVDRKKKVARKDVESKHAIKQLEKQATATF |
| Ga0222713_100530705 | 3300021962 | Estuarine Water | MKPALIVYLVDTKKKLARKENESKHAIKELKKQYAATF |
| Ga0222713_103742882 | 3300021962 | Estuarine Water | MKQALIVYLVNQKKKKARRDIESQHAIKELKKQAAVTLG |
| Ga0222712_102170473 | 3300021963 | Estuarine Water | MNKALIVYLIDQKKKTARKDIESKHAIKELKKQPASTF |
| Ga0222719_104679492 | 3300021964 | Estuarine Water | MNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF |
| Ga0212026_10174052 | 3300022069 | Aqueous | MSKALIVYLIDKRKKQARLDMESKHAVAELKKQSAATF |
| Ga0212031_10086342 | 3300022176 | Aqueous | MNKALIVYLVDKKKKMARTDVESKHAIKELKKQSAATF |
| Ga0212031_10242282 | 3300022176 | Aqueous | MNKALIVYLVNQKKKLARKDVESKHAVTELKKQSAATF |
| Ga0181353_10033764 | 3300022179 | Freshwater Lake | MKPALIVYLVSTKKKMTRKDMESKHAVTELKKQSAATF |
| Ga0181353_10667342 | 3300022179 | Freshwater Lake | MNKALIVYLMNKKKKLARKDVESKHAVTELKKQSAATF |
| Ga0196899_11096403 | 3300022187 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAATF |
| Ga0196905_100029229 | 3300022198 | Aqueous | MNKALIVYLVDKKKKVARKDVESKHAIAELKKQSAATF |
| Ga0196905_10030668 | 3300022198 | Aqueous | MNKALIVYLVDKRKKLARKDVESKHATAELKKQSAATF |
| Ga0196905_10353911 | 3300022198 | Aqueous | QMNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF |
| Ga0196905_11514081 | 3300022198 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAATFXSPLC |
| Ga0196905_11632601 | 3300022198 | Aqueous | MNKALIVYLVDKKKKVARKDVESKHAIAELKKQSAATFXSPFV |
| Ga0196901_10078104 | 3300022200 | Aqueous | MNKALIVYLVDKRKKLARKDVESQHAVTELKKQSAATF |
| Ga0196901_100881410 | 3300022200 | Aqueous | MNKALIVYLVGQKKKVARKDVESKHALAELKKQSAATF |
| Ga0196901_10793622 | 3300022200 | Aqueous | MNKALIVYLVGQKKDKARKDVESKRAVKELKKETAATF |
| Ga0181351_10375995 | 3300022407 | Freshwater Lake | MNKALIVYLVDKKKKVARKDVESKHAIKELKKQTTATF |
| Ga0214917_101175802 | 3300022752 | Freshwater | MNKALIVYLVDQKKKTARKDTEFKHAIKELKKQPTVTF |
| Ga0214917_102660292 | 3300022752 | Freshwater | MNKALIVYLVDQKKKTARKDTESKHAIKELKKQPTVTF |
| Ga0255751_101501631 | 3300023116 | Salt Marsh | WRSNQMNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATF |
| Ga0255772_102442672 | 3300023176 | Salt Marsh | MNKALIVYLVDQKKKQARKEIESKHAVAELKKQYAATF |
| Ga0255171_10995621 | 3300024354 | Freshwater | MNKALIVYLVDKRKKLARKDVESKHATSELKKQSAATF |
| Ga0208018_10036513 | 3300025057 | Marine | MNQALIVYLVGQKKQAARKDVESKRAVKELKKQPAATF |
| Ga0208018_1013707 | 3300025057 | Marine | MNKALIVYLVNQKKKQTRKDVESKHAVTELKKQSAATF |
| Ga0208018_1098603 | 3300025057 | Marine | MNKALIVYLVDRKKKMARKDVESKHAVTELKKQSAATF |
| Ga0208048_10037394 | 3300025283 | Freshwater | MNKALIVYLFNQKKKEARKDIESKHAIKELKKQSTVTF |
| Ga0208149_10015759 | 3300025610 | Aqueous | MNKALIIYLVNKKKKVARQDIESQRALKELKKQTTASF |
| Ga0208161_10394304 | 3300025646 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF |
| Ga0208161_10524332 | 3300025646 | Aqueous | MNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATF |
| Ga0208161_10977802 | 3300025646 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAAT |
| Ga0208161_11038382 | 3300025646 | Aqueous | MNKALIVYLVNQKKKQARKDVESQHAVTELKKQSAATF |
| Ga0208161_11077202 | 3300025646 | Aqueous | MKPALIVYLVSTKKKLARKEIESKHAIKELKKQYAATF |
| Ga0208161_11554022 | 3300025646 | Aqueous | MNKALIVYLVDKRKKQTRKDVESQHAVTELKKQSAATF |
| Ga0208160_10805501 | 3300025647 | Aqueous | MNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAATF |
| Ga0208160_11058621 | 3300025647 | Aqueous | MNKALIVYLVSQKKKQARKEIESKHAVAELKKQYAATFXSPLIQT |
| Ga0208795_11415512 | 3300025655 | Aqueous | MNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATFXSPLI |
| Ga0208898_11541632 | 3300025671 | Aqueous | MNKALIVYLVNQKKKQARKDMESKHAVTELKKQSAATF |
| Ga0208547_10807951 | 3300025828 | Aqueous | LCHRRTNQMNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAATF |
| Ga0208645_10470736 | 3300025853 | Aqueous | MNKALIVYLVNQKKKQARLDVESKHAVTELKKQSAATF |
| Ga0208645_11345011 | 3300025853 | Aqueous | MNKALIVYLVNQKKKQTRKDMESKHAVTELKKQSAATF |
| Ga0209392_10694422 | 3300027683 | Freshwater Sediment | MNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF |
| Ga0209704_11138583 | 3300027693 | Freshwater Sediment | MNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF |
| Ga0209704_11707512 | 3300027693 | Freshwater Sediment | MNKALIVYLVNRRKKLARKDVESKHAVTELKKQSAATF |
| Ga0209033_12498111 | 3300027697 | Freshwater Lake | MNKALIVYLLDKRKKLARKDIESKHAVTELKKQSAATF |
| Ga0209288_101210613 | 3300027762 | Freshwater Sediment | MNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAAT |
| Ga0209288_101238201 | 3300027762 | Freshwater Sediment | NQMNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAATF |
| Ga0209972_101461194 | 3300027793 | Freshwater Lake | MNKALIIYLVDKKKKAARKDVESKHAVKQLEKQTTATF |
| Ga0209742_100586772 | 3300027814 | Marine Sediment | MNKALIVYLIDKRKKQARMDVEFKHAVTELKKQSAATF |
| Ga0209742_102904241 | 3300027814 | Marine Sediment | MNKALIVYLVNQKKKQARKEIESKHAVAELKKQYAAT |
| Ga0209550_100778314 | 3300027892 | Freshwater Lake | MNKALIVYLVGQKKKAARKDVESKHGIKQLEKQTTATF |
| Ga0209536_1002607551 | 3300027917 | Marine Sediment | MNKALIVYLVDKRKKLARKDVESKHATGELKKQSAATF |
| Ga0119944_10034824 | 3300029930 | Aquatic | MNKALIVYLVDRKKKMARQDIESKHAIKELKKQPASTF |
| Ga0119945_10364611 | 3300029933 | Aquatic | MNKALIVYLVGQKKKVARKDIESKHAIKELKKQATATF |
| Ga0307380_101724196 | 3300031539 | Soil | RHRRSNQMNQALIVYLVGQKKKAVRKDVESKHAAKQLEKQATATF |
| Ga0307380_105056082 | 3300031539 | Soil | MNQALIIYLQGQKKQAARKDVESKHAAKQLEKQATATF |
| Ga0307380_106840542 | 3300031539 | Soil | MNQALIVYLQGQKKLAVRKDVESKHAAKQLEKQATATF |
| Ga0307380_112025892 | 3300031539 | Soil | MNQALIVYLQGQKKQAARKDVESKHAAKQLEKQATATF |
| Ga0307379_102139982 | 3300031565 | Soil | MNQALIVYLVGQKKKAVRKDVESKHAAKQLEKQATATF |
| Ga0307379_112557642 | 3300031565 | Soil | MNKALIVYLQGQKKQAARKDVESKHAAKQLEKQATATF |
| Ga0307378_115342452 | 3300031566 | Soil | IVYLQAQKKKVARKDVESKHAAKQLEKQATATFXSPLV |
| Ga0307376_102593954 | 3300031578 | Soil | MNQALIVYLQGQKKQATRKDVESKHAAKQLEKQAT |
| Ga0307375_102017654 | 3300031669 | Soil | MNQALIVYLVGQKKKAVRKDVESKHAAKQLEKQATATFXLQLDG |
| Ga0307377_105752912 | 3300031673 | Soil | MNQALIVYLQGQKKLAVRKDVESKHAAKQLEKQATATFXSPLV |
| Ga0315907_101277404 | 3300031758 | Freshwater | MNKALIVYLADRKKKVARKDVESKHAIKQLEKQTTATF |
| Ga0315899_100100175 | 3300031784 | Freshwater | MNKALIVYLVDRKKKVARKDVESKHAIAELKKQSAATF |
| Ga0315899_113733011 | 3300031784 | Freshwater | MNKALIVYLVDRKKKVARKDVESKHAAKQLEKQATATF |
| Ga0315900_100597363 | 3300031787 | Freshwater | MNKALIVYLVGRKKKVARKDVESKHAIAELKKQSAATF |
| Ga0315909_1001529318 | 3300031857 | Freshwater | MNKALIVYLIDKRKKQTRKDVESKHAVKQLEKQATATF |
| Ga0315909_101552351 | 3300031857 | Freshwater | ELTKMNNALITYLIDKKKKATRKDVESKHAIKQLEKQTTATF |
| Ga0315909_105722642 | 3300031857 | Freshwater | MKQALIVYLVSQKKKKARRDTESQHAIKELKKQAAVTLG |
| Ga0315909_108152542 | 3300031857 | Freshwater | MNKALIVYLVGQKKKAARKDVESKHAVKELEKQATATFXSPLV |
| Ga0315904_103484802 | 3300031951 | Freshwater | MDQALLVYLANQKKKQTRRDVESKRAIKELKKQPAEVVV |
| Ga0315904_104094602 | 3300031951 | Freshwater | MNKALIVYLVDKRKKLTRKDVESKHAVTELKKQSAATF |
| Ga0315904_104647703 | 3300031951 | Freshwater | MNKALIIYLVDKRKKLARKDVESKHAVTELKKQSAATF |
| Ga0315906_102433893 | 3300032050 | Freshwater | MNKALIVYLVGRKKKVARKDVESKHAIAELKKQSAATFXSPLV |
| Ga0315906_109263201 | 3300032050 | Freshwater | MNKALIVYLVDKRKKLARKDVESKHAVTELKKQSA |
| Ga0315902_100833643 | 3300032093 | Freshwater | MNKALIVYLVDKKKKVARKDMESKHAIKQLEKQTTATF |
| Ga0316201_111015482 | 3300032136 | Worm Burrow | MNKSLIIYLVNKKKKVARQDIESQRALKELKKQTTASF |
| Ga0334980_0016589_1506_1622 | 3300033816 | Freshwater | MNQALIVYLVNQKKKTTRKEIESKHAIEALKKQYAATF |
| Ga0334980_0021001_976_1095 | 3300033816 | Freshwater | MDQALLVYLANQKKKQIRKDVESKRAIKELKKQPAEVVV |
| Ga0334980_0150112_292_408 | 3300033816 | Freshwater | MNKALIVYLVNRRKKLARKDVESKHAVTELRKQSAATF |
| Ga0334977_0274727_521_640 | 3300033978 | Freshwater | MDQALLVYLTNQKKKQTRKDVESKRAIKELKKQPAEVVV |
| Ga0334982_0171731_886_1002 | 3300033981 | Freshwater | MNKALIVYLIDQKKKTARKETESKHAIKELKKQPTVTF |
| Ga0334986_0000145_34148_34264 | 3300034012 | Freshwater | MKPALIVYLVNTKKKLARKDVESKHAIRELKKQYAATF |
| Ga0334986_0019750_4330_4446 | 3300034012 | Freshwater | MNQALIVYLVDKKKKTARKEIESKHAIEALKKQYAATF |
| Ga0334998_0228557_1029_1139 | 3300034019 | Freshwater | KALIVYLIDQKKKTARKDIESKHAIKELKKQPASTF |
| Ga0334987_0002454_16650_16766 | 3300034061 | Freshwater | MKPALIVYLVNTKKKLARKDVESKHAIKELKKQYTATF |
| Ga0334987_0646045_253_369 | 3300034061 | Freshwater | MNMALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF |
| Ga0310127_006868_6465_6581 | 3300034072 | Fracking Water | MKPALIVYLVNTKKKLARKEVESKHAIKELKKQYAATF |
| Ga0310127_277914_325_441 | 3300034072 | Fracking Water | MNKALIVYLVNKKKKLARKDVESKHAVTELRKQSAATF |
| Ga0310130_0001567_4275_4391 | 3300034073 | Fracking Water | MNKALIVYLVDKRKKMARKDVESKHATTELKKQSAATF |
| Ga0310130_0001607_1747_1863 | 3300034073 | Fracking Water | MNKALIVYLVNKKKKMTRSDVESKHAIKELQKQSVATF |
| Ga0335031_0066725_22_138 | 3300034104 | Freshwater | MNKALIVYLIDKRKKMARKDVESKHAVTELKKQSAATF |
| Ga0335053_0047630_2958_3065 | 3300034118 | Freshwater | MDQALLVYLANQKKKQTRKDVESKRAIKELKKQPAE |
| Ga0335039_0454429_2_112 | 3300034355 | Freshwater | MNKALIVYLTAQKKKTARKDTESKHAIRELKKQPTVT |
| ⦗Top⦘ |