Basic Information | |
---|---|
Family ID | F015109 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 257 |
Average Sequence Length | 47 residues |
Representative Sequence | EIETLARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Number of Associated Samples | 211 |
Number of Associated Scaffolds | 257 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.16 % |
% of genes near scaffold ends (potentially truncated) | 86.38 % |
% of genes from short scaffolds (< 2000 bps) | 78.21 % |
Associated GOLD sequencing projects | 198 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.490 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.062 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.070 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.467 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 257 Family Scaffolds |
---|---|---|
PF13452 | MaoC_dehydrat_N | 10.12 |
PF00296 | Bac_luciferase | 8.17 |
PF00144 | Beta-lactamase | 5.84 |
PF02515 | CoA_transf_3 | 5.84 |
PF02627 | CMD | 3.11 |
PF07076 | DUF1344 | 3.11 |
PF13365 | Trypsin_2 | 3.11 |
PF13458 | Peripla_BP_6 | 2.33 |
PF13530 | SCP2_2 | 1.95 |
PF04392 | ABC_sub_bind | 1.95 |
PF04909 | Amidohydro_2 | 1.95 |
PF01266 | DAO | 1.95 |
PF01168 | Ala_racemase_N | 1.56 |
PF13714 | PEP_mutase | 1.56 |
PF14534 | DUF4440 | 1.56 |
PF01042 | Ribonuc_L-PSP | 1.17 |
PF00848 | Ring_hydroxyl_A | 1.17 |
PF06808 | DctM | 1.17 |
PF02738 | MoCoBD_1 | 1.17 |
PF01425 | Amidase | 1.17 |
PF12200 | DUF3597 | 0.78 |
PF13561 | adh_short_C2 | 0.78 |
PF01566 | Nramp | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF07883 | Cupin_2 | 0.78 |
PF07690 | MFS_1 | 0.78 |
PF04366 | Ysc84 | 0.78 |
PF00842 | Ala_racemase_C | 0.78 |
PF05685 | Uma2 | 0.78 |
PF02585 | PIG-L | 0.39 |
PF10543 | ORF6N | 0.39 |
PF12399 | BCA_ABC_TP_C | 0.39 |
PF00903 | Glyoxalase | 0.39 |
PF00892 | EamA | 0.39 |
PF01738 | DLH | 0.39 |
PF00805 | Pentapeptide | 0.39 |
PF00042 | Globin | 0.39 |
PF11127 | DUF2892 | 0.39 |
PF02566 | OsmC | 0.39 |
PF02368 | Big_2 | 0.39 |
PF13419 | HAD_2 | 0.39 |
PF00355 | Rieske | 0.39 |
PF00248 | Aldo_ket_red | 0.39 |
PF13414 | TPR_11 | 0.39 |
PF12804 | NTP_transf_3 | 0.39 |
PF13185 | GAF_2 | 0.39 |
PF04991 | LicD | 0.39 |
PF07973 | tRNA_SAD | 0.39 |
PF01764 | Lipase_3 | 0.39 |
PF13683 | rve_3 | 0.39 |
PF13370 | Fer4_13 | 0.39 |
PF12697 | Abhydrolase_6 | 0.39 |
PF01411 | tRNA-synt_2c | 0.39 |
PF02069 | Metallothio_Pro | 0.39 |
PF13193 | AMP-binding_C | 0.39 |
PF10518 | TAT_signal | 0.39 |
PF00561 | Abhydrolase_1 | 0.39 |
COG ID | Name | Functional Category | % Frequency in 257 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 8.17 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 5.84 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 5.84 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 5.84 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 5.84 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 3.11 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 3.11 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 2.33 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.95 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.17 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.17 |
COG0787 | Alanine racemase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.78 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.78 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.78 |
COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.39 |
COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 0.39 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.39 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.39 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.39 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.39 |
COG3475 | Phosphorylcholine metabolism protein LicD | Lipid transport and metabolism [I] | 0.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.49 % |
Unclassified | root | N/A | 17.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c1991521 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100626108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1905 | Open in IMG/M |
3300000891|JGI10214J12806_11059739 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300000891|JGI10214J12806_11359034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
3300000953|JGI11615J12901_10757524 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300000955|JGI1027J12803_107564473 | Not Available | 629 | Open in IMG/M |
3300002121|C687J26615_10153996 | Not Available | 581 | Open in IMG/M |
3300002911|JGI25390J43892_10081876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 729 | Open in IMG/M |
3300003371|JGI26145J50221_1006279 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300003911|JGI25405J52794_10143090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
3300004114|Ga0062593_100222293 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300004114|Ga0062593_100269921 | Not Available | 1423 | Open in IMG/M |
3300004114|Ga0062593_101196318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
3300004268|Ga0066398_10056569 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300004268|Ga0066398_10149278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
3300004281|Ga0066397_10006213 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300005093|Ga0062594_101256924 | Not Available | 739 | Open in IMG/M |
3300005159|Ga0066808_1020841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
3300005167|Ga0066672_10697649 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300005167|Ga0066672_10912847 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005172|Ga0066683_10913403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
3300005174|Ga0066680_10177827 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300005176|Ga0066679_10987502 | Not Available | 525 | Open in IMG/M |
3300005183|Ga0068993_10061829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1120 | Open in IMG/M |
3300005186|Ga0066676_10355389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 981 | Open in IMG/M |
3300005289|Ga0065704_10346125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 816 | Open in IMG/M |
3300005294|Ga0065705_10257913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1171 | Open in IMG/M |
3300005294|Ga0065705_10954180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
3300005295|Ga0065707_10300849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1004 | Open in IMG/M |
3300005332|Ga0066388_100128122 | All Organisms → cellular organisms → Bacteria | 3077 | Open in IMG/M |
3300005332|Ga0066388_105571578 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005335|Ga0070666_11041698 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300005440|Ga0070705_100575369 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 867 | Open in IMG/M |
3300005440|Ga0070705_101547366 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005444|Ga0070694_100021877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4092 | Open in IMG/M |
3300005446|Ga0066686_10052992 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
3300005450|Ga0066682_10347469 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300005458|Ga0070681_10963277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 773 | Open in IMG/M |
3300005458|Ga0070681_10975225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 767 | Open in IMG/M |
3300005468|Ga0070707_100216269 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
3300005468|Ga0070707_102033098 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005518|Ga0070699_100328363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1375 | Open in IMG/M |
3300005536|Ga0070697_100916860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
3300005536|Ga0070697_100955162 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300005555|Ga0066692_10369138 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300005556|Ga0066707_10632552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
3300005557|Ga0066704_10669642 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300005569|Ga0066705_10047556 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
3300005576|Ga0066708_10243781 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300005577|Ga0068857_101674519 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300005713|Ga0066905_100052130 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
3300005713|Ga0066905_101836326 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005719|Ga0068861_101521373 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300005719|Ga0068861_102380662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
3300005764|Ga0066903_108077612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
3300005764|Ga0066903_108148112 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300005841|Ga0068863_102714892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
3300005983|Ga0081540_1015064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4907 | Open in IMG/M |
3300006034|Ga0066656_10329767 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300006046|Ga0066652_101683014 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300006058|Ga0075432_10462525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
3300006237|Ga0097621_100642352 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300006796|Ga0066665_10150136 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300006796|Ga0066665_10344747 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300006852|Ga0075433_10118652 | All Organisms → cellular organisms → Bacteria | 2348 | Open in IMG/M |
3300006853|Ga0075420_100196508 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
3300006871|Ga0075434_101720029 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300006880|Ga0075429_100136026 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
3300006880|Ga0075429_100673760 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 906 | Open in IMG/M |
3300006880|Ga0075429_100967005 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300006894|Ga0079215_11414499 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300006914|Ga0075436_101154646 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300007076|Ga0075435_100428625 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300009089|Ga0099828_10181332 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300009089|Ga0099828_11274991 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300009093|Ga0105240_10797033 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300009094|Ga0111539_12371536 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300009098|Ga0105245_12904688 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300009148|Ga0105243_11911129 | Not Available | 626 | Open in IMG/M |
3300009156|Ga0111538_11710211 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300009156|Ga0111538_12400954 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 662 | Open in IMG/M |
3300009162|Ga0075423_10186495 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
3300009177|Ga0105248_11422501 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 785 | Open in IMG/M |
3300009177|Ga0105248_12157786 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300009545|Ga0105237_12467406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
3300009553|Ga0105249_11112356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 860 | Open in IMG/M |
3300009553|Ga0105249_12042075 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300009777|Ga0105164_10169144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1115 | Open in IMG/M |
3300009837|Ga0105058_1199615 | Not Available | 500 | Open in IMG/M |
3300010043|Ga0126380_10129580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1575 | Open in IMG/M |
3300010046|Ga0126384_11163161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
3300010047|Ga0126382_10920427 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300010166|Ga0126306_11447969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
3300010333|Ga0134080_10063686 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300010333|Ga0134080_10332640 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 688 | Open in IMG/M |
3300010337|Ga0134062_10560174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
3300010360|Ga0126372_10133130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1949 | Open in IMG/M |
3300010361|Ga0126378_10884171 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300010362|Ga0126377_10176528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2029 | Open in IMG/M |
3300010362|Ga0126377_10527497 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300010362|Ga0126377_10582017 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300010362|Ga0126377_11059690 | Not Available | 879 | Open in IMG/M |
3300010362|Ga0126377_12979914 | Not Available | 546 | Open in IMG/M |
3300010366|Ga0126379_13062027 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010371|Ga0134125_11604192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 708 | Open in IMG/M |
3300010373|Ga0134128_12206282 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300010375|Ga0105239_13219362 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
3300010376|Ga0126381_104810095 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300010391|Ga0136847_11883900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 642 | Open in IMG/M |
3300010398|Ga0126383_11168716 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300010401|Ga0134121_10527615 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300011003|Ga0138514_100154440 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
3300011107|Ga0151490_1167311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 921 | Open in IMG/M |
3300012189|Ga0137388_11700801 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012207|Ga0137381_10147427 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
3300012209|Ga0137379_10036310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 4754 | Open in IMG/M |
3300012212|Ga0150985_104335077 | Not Available | 786 | Open in IMG/M |
3300012351|Ga0137386_10510388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
3300012353|Ga0137367_10236086 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300012355|Ga0137369_11141795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300012400|Ga0134048_1142239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 697 | Open in IMG/M |
3300012685|Ga0137397_10919913 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012917|Ga0137395_10007180 | All Organisms → cellular organisms → Bacteria | 5866 | Open in IMG/M |
3300012922|Ga0137394_10072968 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2863 | Open in IMG/M |
3300012922|Ga0137394_10479802 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300012923|Ga0137359_10359648 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300012925|Ga0137419_11657782 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300012929|Ga0137404_10071893 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
3300012930|Ga0137407_10460294 | Not Available | 1184 | Open in IMG/M |
3300012944|Ga0137410_11849651 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300012948|Ga0126375_10588855 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300012948|Ga0126375_11530699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300012957|Ga0164303_10915472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
3300012971|Ga0126369_10060108 | All Organisms → cellular organisms → Bacteria | 3288 | Open in IMG/M |
3300012971|Ga0126369_10283768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1648 | Open in IMG/M |
3300012971|Ga0126369_10413639 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1389 | Open in IMG/M |
3300012971|Ga0126369_11033460 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300012971|Ga0126369_12533609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
3300012984|Ga0164309_10889905 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300013307|Ga0157372_10169748 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
3300014262|Ga0075301_1112142 | Not Available | 601 | Open in IMG/M |
3300014968|Ga0157379_12509414 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300015054|Ga0137420_1338122 | Not Available | 4968 | Open in IMG/M |
3300015077|Ga0173483_10539272 | Not Available | 630 | Open in IMG/M |
3300015357|Ga0134072_10245585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
3300015358|Ga0134089_10000504 | All Organisms → cellular organisms → Bacteria | 9110 | Open in IMG/M |
3300015371|Ga0132258_12320875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1345 | Open in IMG/M |
3300015372|Ga0132256_101536468 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300015373|Ga0132257_100920315 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300015373|Ga0132257_102519710 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300015373|Ga0132257_102700027 | Not Available | 647 | Open in IMG/M |
3300016294|Ga0182041_11756078 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300017654|Ga0134069_1290954 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300018052|Ga0184638_1179062 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300018063|Ga0184637_10206597 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300018084|Ga0184629_10347930 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300018431|Ga0066655_10200129 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300018468|Ga0066662_10929932 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300019998|Ga0193710_1008410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1037 | Open in IMG/M |
3300020084|Ga0194110_10244936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1311 | Open in IMG/M |
3300020109|Ga0194112_10758247 | Not Available | 640 | Open in IMG/M |
3300020150|Ga0187768_1072468 | Not Available | 775 | Open in IMG/M |
3300021560|Ga0126371_10383693 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300022534|Ga0224452_1022342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1773 | Open in IMG/M |
3300022563|Ga0212128_10380408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 876 | Open in IMG/M |
3300025165|Ga0209108_10040061 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
3300025326|Ga0209342_10340636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1291 | Open in IMG/M |
3300025560|Ga0210108_1012109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1511 | Open in IMG/M |
3300025903|Ga0207680_10875413 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300025910|Ga0207684_10116620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2288 | Open in IMG/M |
3300025910|Ga0207684_10298295 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300025912|Ga0207707_10781288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300025915|Ga0207693_10004501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11791 | Open in IMG/M |
3300025917|Ga0207660_10426642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1070 | Open in IMG/M |
3300025922|Ga0207646_10168881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1975 | Open in IMG/M |
3300025927|Ga0207687_11067763 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300025933|Ga0207706_10763455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
3300025941|Ga0207711_12052812 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300026295|Ga0209234_1153240 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300026324|Ga0209470_1109234 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300026331|Ga0209267_1120964 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300026335|Ga0209804_1014793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4147 | Open in IMG/M |
3300026371|Ga0257179_1004153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1295 | Open in IMG/M |
3300026376|Ga0257167_1004392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1656 | Open in IMG/M |
3300026482|Ga0257172_1064993 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300026536|Ga0209058_1155204 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300026540|Ga0209376_1274209 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300027252|Ga0209973_1026446 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300027384|Ga0209854_1075429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
3300027395|Ga0209996_1001042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3307 | Open in IMG/M |
3300027875|Ga0209283_10647154 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300027876|Ga0209974_10012925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2786 | Open in IMG/M |
3300027909|Ga0209382_11137700 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300028536|Ga0137415_11174961 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300028589|Ga0247818_10341002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1002 | Open in IMG/M |
3300028592|Ga0247822_11095918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 661 | Open in IMG/M |
3300028716|Ga0307311_10110883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
3300028812|Ga0247825_10104161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1922 | Open in IMG/M |
3300028812|Ga0247825_10482733 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 881 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10040775 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10123192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 704 | Open in IMG/M |
3300031231|Ga0170824_113763956 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
(restricted) 3300031237|Ga0255334_1025708 | Not Available | 680 | Open in IMG/M |
3300031543|Ga0318516_10088263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1738 | Open in IMG/M |
3300031544|Ga0318534_10001020 | All Organisms → cellular organisms → Bacteria | 10592 | Open in IMG/M |
3300031546|Ga0318538_10580916 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031572|Ga0318515_10106986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1470 | Open in IMG/M |
3300031573|Ga0310915_10316577 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300031679|Ga0318561_10625158 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031681|Ga0318572_10327914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
3300031716|Ga0310813_10032850 | All Organisms → cellular organisms → Bacteria | 3685 | Open in IMG/M |
3300031720|Ga0307469_12357635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
3300031740|Ga0307468_101367945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
3300031779|Ga0318566_10012465 | All Organisms → cellular organisms → Bacteria | 3577 | Open in IMG/M |
3300031824|Ga0307413_11835063 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
3300031852|Ga0307410_11840666 | Not Available | 538 | Open in IMG/M |
3300031860|Ga0318495_10041788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2023 | Open in IMG/M |
3300032043|Ga0318556_10131161 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300032090|Ga0318518_10058638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1849 | Open in IMG/M |
3300032174|Ga0307470_10633840 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300032174|Ga0307470_11871229 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032205|Ga0307472_102662087 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032829|Ga0335070_10045100 | All Organisms → cellular organisms → Bacteria | 4892 | Open in IMG/M |
3300032954|Ga0335083_10320553 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1353 | Open in IMG/M |
3300033289|Ga0310914_11472798 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300033502|Ga0326731_1156580 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300033550|Ga0247829_10448163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1065 | Open in IMG/M |
3300033550|Ga0247829_11167353 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300033551|Ga0247830_10374364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1105 | Open in IMG/M |
3300034165|Ga0364942_0259138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
3300034690|Ga0364923_0071764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 843 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.95% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.17% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.17% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.17% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.17% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.17% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.78% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.39% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.39% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.39% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.39% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.39% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.39% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.39% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.39% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.39% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.39% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.39% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Host-Associated | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031237 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_19915211 | 3300000033 | Soil | EALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD* |
INPhiseqgaiiFebDRAFT_1006261081 | 3300000364 | Soil | RVAVPVSAAAGLPEQVKTPDDVLRYGKEMIARFR* |
JGI10214J12806_110597392 | 3300000891 | Soil | QGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
JGI10214J12806_113590342 | 3300000891 | Soil | SRVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR* |
JGI11615J12901_107575241 | 3300000953 | Soil | RVAGPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
JGI1027J12803_1075644731 | 3300000955 | Soil | DPKEIEALAKQGVARVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR* |
C687J26615_101539962 | 3300002121 | Soil | DPAEIEALARQGIARVAVPISNAAGLPAQLKTPDDVLRYGRDVIARFR* |
JGI25615J43890_10591191 | 3300002910 | Grasslands Soil | PKAIEITVAAPTDVAEIEALARQGIARVAVPVSAAAGLPAQLKTPDDVLRYGKDVIARFR |
JGI25390J43892_100818762 | 3300002911 | Grasslands Soil | AEPAEIESLARLGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD* |
JGI26145J50221_10062792 | 3300003371 | Arabidopsis Thaliana Rhizosphere | PAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR* |
JGI25405J52794_101430902 | 3300003911 | Tabebuia Heterophylla Rhizosphere | RQGITRVAVPVSAAAGLPAQVKTPDDVLRYGREVIAKFR* |
Ga0062593_1002222931 | 3300004114 | Soil | ADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR* |
Ga0062593_1002699213 | 3300004114 | Soil | AEIEALAKMGVTRVAVPVSSGAGLPAQVKTPDDVLRYGKTMIARFDR* |
Ga0062593_1011963182 | 3300004114 | Soil | EIEALARRGIARVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0062589_1002131404 | 3300004156 | Soil | EAAGRDPKTIEITVAAPADPAEIAGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG* |
Ga0066398_100565691 | 3300004268 | Tropical Forest Soil | VSAPTTPEEIEALARRGVTRVAVPVSSAAGLPAQVKTPDDVLRYGKIMIDRFRE* |
Ga0066398_101492781 | 3300004268 | Tropical Forest Soil | AEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR* |
Ga0066397_100062132 | 3300004281 | Tropical Forest Soil | AIEITVAAPADAAEIEALEQQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0062594_1012569242 | 3300005093 | Soil | EALAKQGVARVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR* |
Ga0066808_10208413 | 3300005159 | Soil | WEIEALAKRGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFTR* |
Ga0066672_106976492 | 3300005167 | Soil | AAPTEASEIEALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0066672_109128471 | 3300005167 | Soil | EEIEALARRGVTRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR* |
Ga0066683_109134032 | 3300005172 | Soil | IEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR* |
Ga0066680_101778271 | 3300005174 | Soil | AKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0066679_109875022 | 3300005176 | Soil | EALAKRGITRVGVPVNSSAGLPAQVKTPEDVLRYGKDVIARFR* |
Ga0066685_104380271 | 3300005180 | Soil | ADIEITVAAPTAPSEIEALARLGVTRVAVPVSSAAGLPAQVQTPDDVLRYGREVIARLRD |
Ga0068993_100618292 | 3300005183 | Natural And Restored Wetlands | VAAPPEPAEIEALAKRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0066676_103553891 | 3300005186 | Soil | AKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0065704_103461252 | 3300005289 | Switchgrass Rhizosphere | AIEITVAAPADPEEIEGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR* |
Ga0065705_102579132 | 3300005294 | Switchgrass Rhizosphere | EGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR* |
Ga0065705_109541801 | 3300005294 | Switchgrass Rhizosphere | GLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG* |
Ga0065707_103008492 | 3300005295 | Switchgrass Rhizosphere | LARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR* |
Ga0070690_1012499491 | 3300005330 | Switchgrass Rhizosphere | EAAGRDPASIEITLAAPADPKEIEALAVQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH* |
Ga0066388_1001281225 | 3300005332 | Tropical Forest Soil | KAIEVTVAAPADPTEIEGLARQGVARVAVPISNAAGLPAQVKTPDDVLRYGKEVIARFR* |
Ga0066388_1055715781 | 3300005332 | Tropical Forest Soil | LERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIVRFR* |
Ga0070666_110416982 | 3300005335 | Switchgrass Rhizosphere | EIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0070705_1005753691 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | APAEPAEIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR* |
Ga0070705_1015473661 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VAHLVEITVAAPPEPAEIEALAKRGVTRVAVPVSAAAGLPEQVKTPDDVLRYGKEMIARFR* |
Ga0070694_1000218771 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR* |
Ga0066686_100529924 | 3300005446 | Soil | LGVTRVAVPVSSAAGLPAQVQTPDDVLRYGREVIARLRD* |
Ga0066682_103474693 | 3300005450 | Soil | EIEALAKRGVSRVAVPVSGAAGLPAQVRTPDDVLRYGKDVIARLRD* |
Ga0070663_1006352742 | 3300005455 | Corn Rhizosphere | EAAGRDPKAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0070681_109632773 | 3300005458 | Corn Rhizosphere | LARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG* |
Ga0070681_109752251 | 3300005458 | Corn Rhizosphere | KMGVTRVAVPVSSGAGLPAQVKTPDDVLRYGKTMIARFDR* |
Ga0070707_1002162693 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EALAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0070707_1020330981 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PSNVSEIEALAKRGVARVAVPVSAAAGLPAQVRTPDDVLRYGKEVIARFQ* |
Ga0070699_1003283633 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EITVSAPTTPEEIEALARRGVTRVAVPVSSAAGLPAQVKTRDDVLRYGKTMIERFRDR* |
Ga0070697_1009168602 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAPTEVSEIEALAKSGVSRVAVPVSPAAGLPAQVRTPDEVLRYGKEVIARFRS* |
Ga0070697_1009551622 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EITVSAPTEPAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD* |
Ga0070686_1001226291 | 3300005544 | Switchgrass Rhizosphere | AGRDPASIEITLAAPADPKEIEALAVQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH* |
Ga0066692_103691381 | 3300005555 | Soil | GVKRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRD* |
Ga0066692_108368301 | 3300005555 | Soil | ELFDEMRRAAEAAGRDPKAIELTVAAPADPKEIEALARRGITRVGVPVNSSAGLPAQVKTPEDVLRYGKDVIARFR* |
Ga0066707_106325523 | 3300005556 | Soil | KRGVSRVAVPVSAAAGLPAQVKTPDDVLRYGRDVIARFADV* |
Ga0066704_106696421 | 3300005557 | Soil | SAPTTPEEIEALARRGVTRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR* |
Ga0066705_100475561 | 3300005569 | Soil | EIEALAKRGVSRVAVPVSGAAGLPAQVGTPDDVLRYGKDVIARLRD* |
Ga0066708_102437811 | 3300005576 | Soil | SRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD* |
Ga0068857_1016745191 | 3300005577 | Corn Rhizosphere | PAQIEALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD* |
Ga0066706_114668501 | 3300005598 | Soil | AIELTVAAPADPKEIEALAKRGITRVGVPVNSSAGLPAQVKTPEDVLRYGKDVIARFR* |
Ga0066905_1000521301 | 3300005713 | Tropical Forest Soil | VARVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRE* |
Ga0066905_1008370152 | 3300005713 | Tropical Forest Soil | RDPSTIEITVAAPAEPLGIEALARQGVARVAVPVSAAAGLPAQVRTPDDVLRYGKQVIEKFRDTKAR* |
Ga0066905_1018363261 | 3300005713 | Tropical Forest Soil | VSAPTEPAEIEALARRGVARVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE* |
Ga0068861_1015213732 | 3300005719 | Switchgrass Rhizosphere | PPEPAEIEALARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR* |
Ga0068861_1023806621 | 3300005719 | Switchgrass Rhizosphere | AKRGIARVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0066903_1080776122 | 3300005764 | Tropical Forest Soil | ASTEPAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF* |
Ga0066903_1081481121 | 3300005764 | Tropical Forest Soil | PAEPAEIEALARRGVKRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE* |
Ga0068863_1027148922 | 3300005841 | Switchgrass Rhizosphere | RGIARVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0068862_1021711372 | 3300005844 | Switchgrass Rhizosphere | AGRDPASIEITLAAPADPKEIEALAGQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH* |
Ga0081540_10150641 | 3300005983 | Tabebuia Heterophylla Rhizosphere | AAEIEALERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMITRFR* |
Ga0066656_103297671 | 3300006034 | Soil | GVARVAVPLSGAAGLPAQVRTPDDVLRYGKDVIARLRD* |
Ga0066652_1016830143 | 3300006046 | Soil | EIEALARLGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD* |
Ga0075432_104625251 | 3300006058 | Populus Rhizosphere | PAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF* |
Ga0097621_1006423521 | 3300006237 | Miscanthus Rhizosphere | PADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0066665_101501361 | 3300006796 | Soil | EALAKRGVSRVAVPVSGAAGLPAQVRTPDDVLRYGKDVIARLRD* |
Ga0066665_103447471 | 3300006796 | Soil | APSGIEALARLGVTRVAVPVSSAAGLPAQVQTPDDVLRYGREVIARLRD* |
Ga0075433_101186523 | 3300006852 | Populus Rhizosphere | VAAPTEPAEIEKLARQGVARVAVPISSAAGLPAQVRTPEDVLRYGKEMIARF* |
Ga0075420_1001965081 | 3300006853 | Populus Rhizosphere | APTDPAQIEALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD* |
Ga0075434_1017200292 | 3300006871 | Populus Rhizosphere | EPAEIEALARQGVTRVAVPVSAAAGLPSQVKTPDDVLRYGKEMIARFR* |
Ga0075429_1001360261 | 3300006880 | Populus Rhizosphere | VAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD* |
Ga0075429_1006737602 | 3300006880 | Populus Rhizosphere | PPEAEEIEKLAKQGVTRVAVPVSSAAGLPAQVRTPDDVLRYGKEMIARFR* |
Ga0075429_1009670052 | 3300006880 | Populus Rhizosphere | TRVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0079215_114144992 | 3300006894 | Agricultural Soil | EALAKQGVARVAVPVSAAAGLPAQVRTPDDVLRYGREVIARFS* |
Ga0075436_1011546462 | 3300006914 | Populus Rhizosphere | TEPAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD* |
Ga0075435_1004286251 | 3300007076 | Populus Rhizosphere | EIETLARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0099828_101813323 | 3300009089 | Vadose Zone Soil | RVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0099828_112749912 | 3300009089 | Vadose Zone Soil | AKRGAARVAVPVSAAAGLPAQVKTPDDVRRYSKETIARFR* |
Ga0105240_107970331 | 3300009093 | Corn Rhizosphere | AEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0111539_123715362 | 3300009094 | Populus Rhizosphere | IEALAKRGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFRD* |
Ga0105245_129046882 | 3300009098 | Miscanthus Rhizosphere | SEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0114129_114778952 | 3300009147 | Populus Rhizosphere | EAAGRDPKGIEITLAAPAEPAEIETLARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0105243_119111292 | 3300009148 | Miscanthus Rhizosphere | SAPQDPTEIEALAKRGIARVAVPVSSGAGLPAQVRTPDDVLRYGKEVISRFR* |
Ga0111538_117102111 | 3300009156 | Populus Rhizosphere | TVAAPTDPKEIEALAKQGVARVAVPVSAAAGLPAQVRTPDDVLRYGREMIARFS* |
Ga0111538_124009544 | 3300009156 | Populus Rhizosphere | VAVPVSSGAGLPAQVKTPDDVLQYGKNVIARFDR* |
Ga0075423_101864954 | 3300009162 | Populus Rhizosphere | VAAPTEPAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF* |
Ga0105104_103768042 | 3300009168 | Freshwater Sediment | AGRDPASIEITLAAPTEPAEIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR* |
Ga0105248_114225012 | 3300009177 | Switchgrass Rhizosphere | PEIEALATQGVARVAVPISAAAGLPAQLMTPDDVLRYGKDMIARFR* |
Ga0105248_121577862 | 3300009177 | Switchgrass Rhizosphere | AEIEALARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR* |
Ga0105237_109426091 | 3300009545 | Corn Rhizosphere | DPKAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0105237_124674062 | 3300009545 | Corn Rhizosphere | LARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR* |
Ga0105249_111123561 | 3300009553 | Switchgrass Rhizosphere | EIEALAKQGVARVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR* |
Ga0105249_120420751 | 3300009553 | Switchgrass Rhizosphere | EIEALARKGVSRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR* |
Ga0105164_101691441 | 3300009777 | Wastewater | SEIEGLARLGVTRVAVPVSAAAGLPAQVKTPDDVLRYGRDVIARFA* |
Ga0105058_11996151 | 3300009837 | Groundwater Sand | RQGVARVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0126380_101295804 | 3300010043 | Tropical Forest Soil | LGRQGITRVAVPVSKAAGLPAQVKTPDDVLRYGKQMIARFR* |
Ga0126384_111631611 | 3300010046 | Tropical Forest Soil | ASVGADIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGEEMIARFR* |
Ga0126382_109204272 | 3300010047 | Tropical Forest Soil | QGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR* |
Ga0126306_114479692 | 3300010166 | Serpentine Soil | TVAAPVTPAEIEALAREGVNRVAVPVSNAAGLAAHVRTPEDVVRYGKEVIARFRA* |
Ga0134088_101373513 | 3300010304 | Grasslands Soil | RAAEAAGRSPDAIEITTAAPTDLFEIEALAKRGVARVAVPLSGAAGPPAQVRTPDDVLRYGKDVIARLRD* |
Ga0134080_100636863 | 3300010333 | Grasslands Soil | RGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0134080_103326401 | 3300010333 | Grasslands Soil | KRVAVPVSSAGGLSAQVTTPDDVLRYGRTVIARLRD* |
Ga0134071_103941551 | 3300010336 | Grasslands Soil | DEMRRAAEAAGRNPDAIEITTAAPTDLFEIEALAKRGVARVAVALSGAAGLPAQVRTPDDVLRYGKDVIARLRD* |
Ga0134062_105601743 | 3300010337 | Grasslands Soil | AAPAAVAEIEALAKRGITRVAVPVSAAAGLPAQVKTPEDVLRYGRDVIARFADV* |
Ga0126372_101331301 | 3300010360 | Tropical Forest Soil | RQGIARVAVPVSSAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0126378_108841712 | 3300010361 | Tropical Forest Soil | ERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0126377_101765284 | 3300010362 | Tropical Forest Soil | RRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE* |
Ga0126377_105274971 | 3300010362 | Tropical Forest Soil | VAAPTEASEIEALGRQGIARVAVPASSAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0126377_105820172 | 3300010362 | Tropical Forest Soil | EIEALERQGITRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0126377_110596901 | 3300010362 | Tropical Forest Soil | VPVSAAAGLPAQVRTPDDVLRYGKQVIEKFRDTKAR* |
Ga0126377_129799142 | 3300010362 | Tropical Forest Soil | EPSEIEGLARLGVARVAVPVSAAAGLPPQVKTPDDVLRYGKNVIEKFR* |
Ga0126379_104318741 | 3300010366 | Tropical Forest Soil | DPRAIELTVSAPTDPAEIEALGRQGVTRVAVPVSAAAGLPAQLKTPDDVLRYGKEMIARFR* |
Ga0126379_130620272 | 3300010366 | Tropical Forest Soil | RVAVPVSNAAGLPAQVKTPDDVLRYGKEMIGRFR* |
Ga0134125_116041922 | 3300010371 | Terrestrial Soil | AAPADPAEIASLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG* |
Ga0134128_122062822 | 3300010373 | Terrestrial Soil | TVAAPPEPAEIEALAQRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0105239_132193621 | 3300010375 | Corn Rhizosphere | EVLAKRGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFTR* |
Ga0126381_1048100951 | 3300010376 | Tropical Forest Soil | GVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE* |
Ga0136847_118839001 | 3300010391 | Freshwater Sediment | LARLGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0126383_111687161 | 3300010398 | Tropical Forest Soil | EKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR* |
Ga0134121_105276154 | 3300010401 | Terrestrial Soil | RQGVARVAVPVSAAAGLPAQVKTPDDVLRYGRDVIARFR* |
Ga0138514_1001544401 | 3300011003 | Soil | KQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKNVIARLRDRD* |
Ga0151490_11673111 | 3300011107 | Soil | EIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFR* |
Ga0137388_117008011 | 3300012189 | Vadose Zone Soil | AAPTEPAEIEALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0137381_101474273 | 3300012207 | Vadose Zone Soil | VTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0137379_100363101 | 3300012209 | Vadose Zone Soil | AEPAEIEKLARQGVARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARFR* |
Ga0150985_1043350771 | 3300012212 | Avena Fatua Rhizosphere | AAPADPAEIAGLERSGVSRVMVPVTGAAGLPPLVKDPDEVLRYGREVIGRYGAA* |
Ga0137386_105103882 | 3300012351 | Vadose Zone Soil | VVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0137367_102360861 | 3300012353 | Vadose Zone Soil | ALAQQGVARVAVPVSSAAGLPAQVKTPDDLLRYGKDVIARFH* |
Ga0137369_111417951 | 3300012355 | Vadose Zone Soil | ADLAEIEALARQGVARVAVPVSAAAGLPAQVKTPEDVLRYGRDVIARFR* |
Ga0137375_102246861 | 3300012360 | Vadose Zone Soil | AEAAGRDLASIEITLAAPAEPAEIEALAKQGVTRVAVPISAAAGLPAQLKTPDDVLRYGKDMIARFH* |
Ga0134048_11422393 | 3300012400 | Grasslands Soil | APAEPAEIEALARVGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD* |
Ga0137397_109199131 | 3300012685 | Vadose Zone Soil | PAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD* |
Ga0137395_100071801 | 3300012917 | Vadose Zone Soil | ITVAAPPEPAEIEALAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0137394_100729681 | 3300012922 | Vadose Zone Soil | EITVAAPADPAEIESLARQGIARVAVPVSAAAGLPAQVRTPDDVLRYGKDVIARFR* |
Ga0137394_104798022 | 3300012922 | Vadose Zone Soil | LAKRGVSRVAVPVSGAAGLPAQVRTPDDVLRYGKDVIARLRD* |
Ga0137359_103596481 | 3300012923 | Vadose Zone Soil | ALARQGIARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0137419_116577822 | 3300012925 | Vadose Zone Soil | PTEAPEIEALARRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0137404_100718931 | 3300012929 | Vadose Zone Soil | EPAEIEALARQGVARVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0137407_104602941 | 3300012930 | Vadose Zone Soil | EIEVLARQGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFG* |
Ga0137410_118496511 | 3300012944 | Vadose Zone Soil | IEALAKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0126375_105888551 | 3300012948 | Tropical Forest Soil | KIEALARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE* |
Ga0126375_115306991 | 3300012948 | Tropical Forest Soil | SAPAEAGEIEKLARQGVARVAVPVSSAAGLPAQVRTPDDVLRYGKEMITRFR* |
Ga0164303_109154721 | 3300012957 | Soil | ALAKRGITRVAVPVSSGAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0126369_100601084 | 3300012971 | Tropical Forest Soil | VARVAVPVSSAAGLPAQVRTPEDVLRYGKEMIARF* |
Ga0126369_102837681 | 3300012971 | Tropical Forest Soil | TEASEIEALGRQGTARVAVPVSNAAGLPAQVKTPDDGLRYGKEMIARFR* |
Ga0126369_104136392 | 3300012971 | Tropical Forest Soil | IEITLAAPPEPAAIEALARRGIARVAVPVSSAAGLPAQVKTPDDVLRYGKDVITHFR* |
Ga0126369_110334601 | 3300012971 | Tropical Forest Soil | IARVAVPVSNAAGLSAQVKTPDDVLRYGKEMIARFR* |
Ga0126369_125336092 | 3300012971 | Tropical Forest Soil | APSDVSEIEALARRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGQEIIARFR* |
Ga0164309_108899052 | 3300012984 | Soil | EIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD* |
Ga0157372_101697481 | 3300013307 | Corn Rhizosphere | QADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR* |
Ga0075301_11121421 | 3300014262 | Natural And Restored Wetlands | LAEIDALARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR* |
Ga0157379_125094141 | 3300014968 | Switchgrass Rhizosphere | VAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD* |
Ga0137420_13381226 | 3300015054 | Vadose Zone Soil | VARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR* |
Ga0173483_105392721 | 3300015077 | Soil | SAPAEPAEIEALAKMGVTRVAVPVSSGAGLPAQVKTPDDVLRYGKTMIARFDR* |
Ga0134072_102455851 | 3300015357 | Grasslands Soil | AEIEALARVGVTRVTVPVSAAAGLPAQVKTPDDVLRYGRDVIARLRD* |
Ga0134089_100005049 | 3300015358 | Grasslands Soil | VKRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRD* |
Ga0132258_123208751 | 3300015371 | Arabidopsis Rhizosphere | IEALAKRGIARVAVPVSSGAGLPAQVKTPDDVLRYGKEVISRFR* |
Ga0132256_1015364682 | 3300015372 | Arabidopsis Rhizosphere | VAAPAEASEIEALARKGVSRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR* |
Ga0132256_1029673082 | 3300015372 | Arabidopsis Rhizosphere | VELTVAAPTDAKEIAALAEQGVARVAVPVSAAAGLPAQVRTPDDVLRYGREMIARFG* |
Ga0132257_1009203152 | 3300015373 | Arabidopsis Rhizosphere | ASEIEALARKGVSRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR* |
Ga0132257_1025197101 | 3300015373 | Arabidopsis Rhizosphere | ALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR* |
Ga0132257_1027000271 | 3300015373 | Arabidopsis Rhizosphere | RVAVPISAAAGLPAQIKTPDDVLRYGKDVIARFR* |
Ga0182041_117560781 | 3300016294 | Soil | TEASDIEALARRGVKRVAVPVSAAAGLPAHVRTPDDVLRYGKTMIERFRD |
Ga0134069_12909542 | 3300017654 | Grasslands Soil | AEIEALAKRGVSRVAVPVSGAAGLPAQVGTPDDVLRYGKDVIARLRD |
Ga0184638_11790621 | 3300018052 | Groundwater Sediment | IARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0184637_102065973 | 3300018063 | Groundwater Sediment | AAAPAEPSEIEALAKLGVTRVAVPVSAAAGLPAQVKTPDDLLRYGNDVIAKFR |
Ga0184629_103479304 | 3300018084 | Groundwater Sediment | RQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0066655_102001293 | 3300018431 | Grasslands Soil | EALARRGVKRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFGE |
Ga0066662_109299322 | 3300018468 | Grasslands Soil | VKRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRD |
Ga0193710_10084102 | 3300019998 | Soil | VPDGWATGTPTPGLLDEMRRAAEAAGRDPKTIEITVAAPADPAEIEGLARKGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG |
Ga0194110_102449361 | 3300020084 | Freshwater Lake | GVSRVAVPVSNAAGLAAQVRTPEDVLRYGKEVIARFR |
Ga0194112_107582471 | 3300020109 | Freshwater Lake | AKRGIARVAVPISSGAGLPAQVKTPDDVLRYGKDVIRSFGDGGR |
Ga0187768_10724681 | 3300020150 | Tropical Peatland | GIEALARQGIARVAVPISNAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0126371_103836933 | 3300021560 | Tropical Forest Soil | TRVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0224452_10223424 | 3300022534 | Groundwater Sediment | LAKQGITRVAVPVSSGAGLPAQVKTPDDVLRYGKNVIARFAR |
Ga0212128_103804082 | 3300022563 | Thermal Springs | GVTRVAVPVSAAAGLPAQVRTPDDVLRYGKEMIARFR |
Ga0209108_100400611 | 3300025165 | Soil | PAEIEALARQGIARVAVPISNAAGLPAQLKTPDDVLRYGRDVIARFR |
Ga0209342_103406362 | 3300025326 | Soil | LTVAAPPEPAEIEKQARQSVARVAVPVSSAAGLPAQVRTPDDVLRYGKEMIARFR |
Ga0210108_10121092 | 3300025560 | Natural And Restored Wetlands | VAAPPEPAEIEALAKRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0207680_108754131 | 3300025903 | Switchgrass Rhizosphere | IEITLAALADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR |
Ga0207684_101166204 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRVAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR |
Ga0207684_102982951 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AKRGVTRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0207707_107812883 | 3300025912 | Corn Rhizosphere | ADPAEIASLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG |
Ga0207671_102436583 | 3300025914 | Corn Rhizosphere | DPKAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARF |
Ga0207693_100045011 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR |
Ga0207660_104266421 | 3300025917 | Corn Rhizosphere | RQGISRVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0207646_101688811 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0207687_110677631 | 3300025927 | Miscanthus Rhizosphere | AEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR |
Ga0207706_107634552 | 3300025933 | Corn Rhizosphere | QDPKDIEALAKRGIARVAVPISSGAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0207711_120528121 | 3300025941 | Switchgrass Rhizosphere | RQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR |
Ga0209234_11532402 | 3300026295 | Grasslands Soil | AEIEALARLGVTRVAVPVSSAAGLPAQVQTPDDVLRYGRDVIARLRD |
Ga0209470_11092342 | 3300026324 | Soil | RGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0209267_11209642 | 3300026331 | Soil | APTEASEIEALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0209804_10147935 | 3300026335 | Soil | VAVPVSSAAGLPAQVKTPDDVLRYGKTMIERFRDR |
Ga0257179_10041531 | 3300026371 | Soil | QGIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0257167_10043924 | 3300026376 | Soil | PADPAEIEGLARQDIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0257172_10649931 | 3300026482 | Soil | LARQGIARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0209058_11552042 | 3300026536 | Soil | MEALARQGVARVAVPVSSAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0209376_12742091 | 3300026540 | Soil | ALAKRGITRVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0209973_10264462 | 3300027252 | Arabidopsis Thaliana Rhizosphere | AEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR |
Ga0209854_10754293 | 3300027384 | Groundwater Sand | EALARQGITRVAVPVSSGAGLPAQVKTPDDLLRYGKNMIARFAR |
Ga0209996_10010421 | 3300027395 | Arabidopsis Thaliana Rhizosphere | PADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR |
Ga0209178_13273891 | 3300027725 | Agricultural Soil | KAIEITLAAPADPAEIEALARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR |
Ga0209283_106471541 | 3300027875 | Vadose Zone Soil | AKRGAARVAVPVSAAAGLPAQVKTPDDVRRYSKETIARFR |
Ga0209974_100129251 | 3300027876 | Arabidopsis Thaliana Rhizosphere | EITVAAPADPAEIEALARQGISRVGVPVSAAAGLPAQVKTPDDVLRYGREVIAHFR |
Ga0209382_111377002 | 3300027909 | Populus Rhizosphere | AKQGVTRVAVPVSSAAGLPAQVRTPDDVLRYGKEMIARFR |
Ga0137415_111749612 | 3300028536 | Vadose Zone Soil | RGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD |
Ga0247818_103410021 | 3300028589 | Soil | PGEIEALARQGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDMIARFDR |
Ga0247822_110959181 | 3300028592 | Soil | ALARAGVTRVAVPVSSGAGLPAQVKTPDDVLQYGKNVIARFDR |
Ga0307313_102187283 | 3300028715 | Soil | RDPKAVEITLAAPTDVAEIEALARQGVARVAVPVSAAAGLPAQLKTPDDVLRYGKDVIARFR |
Ga0307311_101108833 | 3300028716 | Soil | RQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0247825_101041611 | 3300028812 | Soil | EIVGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFR |
Ga0247825_104827331 | 3300028812 | Soil | VAAPADPAEIASLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG |
(restricted) Ga0255310_100407753 | 3300031197 | Sandy Soil | RRGVARVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD |
(restricted) Ga0255310_101231921 | 3300031197 | Sandy Soil | ARQGIARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0170824_1137639562 | 3300031231 | Forest Soil | VARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR |
(restricted) Ga0255334_10257081 | 3300031237 | Sandy Soil | DPGEIETLARQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0318516_100882631 | 3300031543 | Soil | TVAAPTEASEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0318534_1000102012 | 3300031544 | Soil | TEASEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0318538_105809162 | 3300031546 | Soil | ARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE |
Ga0318515_101069865 | 3300031572 | Soil | SEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0310915_103165771 | 3300031573 | Soil | KRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD |
Ga0318561_106251582 | 3300031679 | Soil | AGSPAAEPAEIEALARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE |
Ga0318572_103279141 | 3300031681 | Soil | VAAPTEASEIEALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0310813_100328501 | 3300031716 | Soil | EAAPADVAEIEELARQGVARVAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0307469_123576351 | 3300031720 | Hardwood Forest Soil | AKRGVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0307468_1008672931 | 3300031740 | Hardwood Forest Soil | RDPAEIEITVAAPVALAEIEALAARGIARVAVPVSGAAGLPAQVRTPDDVLRYGRDVIARFR |
Ga0307468_1013679452 | 3300031740 | Hardwood Forest Soil | KTIEITVAAPADPAEIEGLARQGIARVAVPVSAAAGLPAQVRTPEDVVRYGKDVIARFR |
Ga0318566_100124651 | 3300031779 | Soil | EALARKGVTRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR |
Ga0307413_118350632 | 3300031824 | Rhizosphere | PAEIEALARMGVSRVAVPVSSGAGLPAQVKTPDDVLRYGRTMIARFRD |
Ga0307410_118406661 | 3300031852 | Rhizosphere | VPADVAAIEALGKQGVGRVAVPVSSLAGTNVQLRTPDDVLRYGRDVIARLRD |
Ga0310892_109618392 | 3300031858 | Soil | PKGIEITLAAPAEPAEIETLARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR |
Ga0318495_100417881 | 3300031860 | Soil | AEPAEIEALARRGVRRVAVPVSSAAGLPAQVRTPDDVLRYGKTMIERFRE |
Ga0310902_101823531 | 3300032012 | Soil | LLDEMRRAAEAAGRDPKGIEITLAAPAEPAEIETLARQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR |
Ga0318556_101311611 | 3300032043 | Soil | ALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD |
Ga0318518_100586381 | 3300032090 | Soil | EALGRQGIARVAVPVSNAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0307470_106338401 | 3300032174 | Hardwood Forest Soil | GVARVAVPVSAAAGLPAQVKTPDDVLRYGKEMIARFR |
Ga0307470_118712292 | 3300032174 | Hardwood Forest Soil | DPAEIEALARQGITRVGVPVSAAAGLPAQVKTPDDVLRYGRDVIARFR |
Ga0307471_1000548791 | 3300032180 | Hardwood Forest Soil | AEAAGRDPGAIEITVAAPPEPAEIEALARRGVARVAVPVSAAAGLPAQVKTPEDVLRYGKEMIARFR |
Ga0307471_1002994611 | 3300032180 | Hardwood Forest Soil | RRAAEAAGRDPKTIEITVAAPADPAEIEGLARQGIARVAVPVSAAAGLPAQVKTPEDVLRYGKDVIARFG |
Ga0307472_1026620872 | 3300032205 | Hardwood Forest Soil | SAPTEPAEIEALARRGVKRVAVPVSAAAGLPAQVRTPDDVLRYGKTMIERFRD |
Ga0335070_100451001 | 3300032829 | Soil | LARQGVARFAVPVSAAAGLPAQVKTPDDVLRYGKDVIARFR |
Ga0335083_103205531 | 3300032954 | Soil | QGIARVAVPISNAAGLPAQVRTPDDVLRYGKDVIARFR |
Ga0310914_114727981 | 3300033289 | Soil | VTRVAVPVSSAAGLPSQVKTPDDVLRYGKEMIARFR |
Ga0326731_11565802 | 3300033502 | Peat Soil | ITVSAPTEPAEIEALARRGVKRVAVPVSGAAGLPAQVRTPDDVLRYGKTMIERFRD |
Ga0247829_104481631 | 3300033550 | Soil | TGEIEALARQGVTRVAVPISSGAGLPAQVKTPDDVLRYGKDMIARFDR |
Ga0247829_111673532 | 3300033550 | Soil | FDLGRQGVARVAVPISAAAGLPAQLKTPEDVLRYGREVIARFR |
Ga0247830_103743641 | 3300033551 | Soil | EIEALARAGVTRVAVPVSSGAGLPAQVKTPDDVLQYGKNVIARFDR |
Ga0364942_0259138_6_119 | 3300034165 | Sediment | VTRVAVPVSSAAGQPAQVKTPDDVLRYGKTVIARLRD |
Ga0364923_0071764_2_133 | 3300034690 | Sediment | EARARQGVARVAVPVSAAAGLPAQVRTPDDVLRYGKDVIARFR |
⦗Top⦘ |