NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F015108

Metagenome Family F015108

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015108
Family Type Metagenome
Number of Sequences 257
Average Sequence Length 48 residues
Representative Sequence FGGKDKKTLFVLARGAQDAEGNEVANAAQVWSIPMIAQGYKGRAK
Number of Associated Samples 218
Number of Associated Scaffolds 257

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 99.22 %
% of genes from short scaffolds (< 2000 bps) 92.61 %
Associated GOLD sequencing projects 211
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.879 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.171 % of family members)
Environment Ontology (ENVO) Unclassified
(30.739 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(39.300 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.14%    Coil/Unstructured: 69.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 257 Family Scaffolds
PF14041Lipoprotein_21 5.06
PF00072Response_reg 3.50
PF13620CarboxypepD_reg 3.11
PF00903Glyoxalase 1.95
PF13360PQQ_2 1.95
PF02687FtsX 1.95
PF07519Tannase 1.95
PF13185GAF_2 1.56
PF00196GerE 1.17
PF00581Rhodanese 1.17
PF00892EamA 1.17
PF00909Ammonium_transp 1.17
PF01268FTHFS 1.17
PF07963N_methyl 1.17
PF01541GIY-YIG 0.78
PF04299FMN_bind_2 0.78
PF01717Meth_synt_2 0.78
PF00753Lactamase_B 0.78
PF12704MacB_PCD 0.78
PF08240ADH_N 0.78
PF13490zf-HC2 0.78
PF07626PSD3 0.39
PF00107ADH_zinc_N 0.39
PF01042Ribonuc_L-PSP 0.39
PF12732YtxH 0.39
PF06267DUF1028 0.39
PF03712Cu2_monoox_C 0.39
PF00135COesterase 0.39
PF01453B_lectin 0.39
PF11821ActD 0.39
PF01694Rhomboid 0.39
PF00378ECH_1 0.39
PF00180Iso_dh 0.39
PF01161PBP 0.39
PF13414TPR_11 0.39
PF13633Obsolete Pfam Family 0.39
PF03352Adenine_glyco 0.39
PF013675_3_exonuc 0.39
PF07719TPR_2 0.39
PF07606DUF1569 0.39
PF13683rve_3 0.39
PF02146SIR2 0.39
PF07690MFS_1 0.39
PF13378MR_MLE_C 0.39
PF13590DUF4136 0.39
PF03976PPK2 0.39
PF07729FCD 0.39
PF01152Bac_globin 0.39
PF00478IMPDH 0.39
PF13561adh_short_C2 0.39
PF00912Transgly 0.39
PF14325DUF4383 0.39
PF13426PAS_9 0.39
PF00583Acetyltransf_1 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 257 Family Scaffolds
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 1.17
COG2759Formyltetrahydrofolate synthetaseNucleotide transport and metabolism [F] 1.17
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.78
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.39
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.39
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.39
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.39
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.39
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.39
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.39
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.39
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.39
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.39
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.39
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 0.39
COG3342Uncharacterized conserved protein, Ntn-hydrolase superfamilyGeneral function prediction only [R] 0.39
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.39
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.88 %
UnclassifiedrootN/A17.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000178|FW301_c1054950All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium508Open in IMG/M
3300001151|JGI12713J13577_1022322All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300002245|JGIcombinedJ26739_101502175All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300003998|Ga0055472_10033105All Organisms → cellular organisms → Bacteria → Acidobacteria1221Open in IMG/M
3300004156|Ga0062589_102065430All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300004156|Ga0062589_102773137All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300004268|Ga0066398_10129718All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300004480|Ga0062592_100592188All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300005093|Ga0062594_102659345Not Available553Open in IMG/M
3300005169|Ga0066810_10197281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300005174|Ga0066680_10705664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300005294|Ga0065705_10934261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300005295|Ga0065707_10095376All Organisms → cellular organisms → Bacteria3386Open in IMG/M
3300005295|Ga0065707_10505080All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005330|Ga0070690_101343956All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005355|Ga0070671_101526854All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005365|Ga0070688_100666543All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005438|Ga0070701_10326960Not Available950Open in IMG/M
3300005440|Ga0070705_100113334All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300005451|Ga0066681_10572316All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005459|Ga0068867_101150252All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300005459|Ga0068867_101976562Not Available551Open in IMG/M
3300005544|Ga0070686_100859428All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300005544|Ga0070686_101256516All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005545|Ga0070695_100392491All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300005555|Ga0066692_10988822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300005561|Ga0066699_10074610All Organisms → cellular organisms → Bacteria2168Open in IMG/M
3300005577|Ga0068857_100499745All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300005577|Ga0068857_102337916All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005578|Ga0068854_101712508All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005617|Ga0068859_101587374Not Available722Open in IMG/M
3300005718|Ga0068866_10773173All Organisms → cellular organisms → Bacteria → Proteobacteria665Open in IMG/M
3300005719|Ga0068861_100082039All Organisms → cellular organisms → Bacteria → Proteobacteria2526Open in IMG/M
3300005719|Ga0068861_102514059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300005764|Ga0066903_100031302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6024Open in IMG/M
3300005764|Ga0066903_103608181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300005834|Ga0068851_10687941All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005842|Ga0068858_101474266Not Available671Open in IMG/M
3300005844|Ga0068862_102205795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300005921|Ga0070766_10911834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia602Open in IMG/M
3300006031|Ga0066651_10053997All Organisms → cellular organisms → Bacteria → Proteobacteria1891Open in IMG/M
3300006046|Ga0066652_101282188Not Available692Open in IMG/M
3300006237|Ga0097621_100797690All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium875Open in IMG/M
3300006358|Ga0068871_100944188All Organisms → cellular organisms → Bacteria → Proteobacteria801Open in IMG/M
3300006755|Ga0079222_10379814All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300006797|Ga0066659_10688831All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium834Open in IMG/M
3300006844|Ga0075428_102705341All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.505Open in IMG/M
3300006846|Ga0075430_100683058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300006852|Ga0075433_10644209All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300006854|Ga0075425_102463257All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300006876|Ga0079217_10031305All Organisms → cellular organisms → Bacteria → Acidobacteria1987Open in IMG/M
3300006880|Ga0075429_100090375All Organisms → cellular organisms → Bacteria → Acidobacteria2670Open in IMG/M
3300006881|Ga0068865_100256913All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300006881|Ga0068865_101334486All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300006903|Ga0075426_11136796Not Available592Open in IMG/M
3300006904|Ga0075424_100009234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium9696Open in IMG/M
3300006918|Ga0079216_11188725All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300007004|Ga0079218_13663674All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300007076|Ga0075435_100078285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2711Open in IMG/M
3300007076|Ga0075435_100735114All Organisms → cellular organisms → Bacteria → Proteobacteria858Open in IMG/M
3300007076|Ga0075435_101556358All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300009089|Ga0099828_11505128All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300009090|Ga0099827_10583448All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300009098|Ga0105245_13277959Not Available501Open in IMG/M
3300009143|Ga0099792_10850187All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300009147|Ga0114129_10372150All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1888Open in IMG/M
3300009147|Ga0114129_10773851All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300009147|Ga0114129_12792643All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300009148|Ga0105243_11403439Not Available719Open in IMG/M
3300009162|Ga0075423_11455270All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300009166|Ga0105100_10771441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29595Open in IMG/M
3300009176|Ga0105242_10258493All Organisms → cellular organisms → Bacteria → Acidobacteria1572Open in IMG/M
3300009177|Ga0105248_10310982All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300009521|Ga0116222_1045483All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300009523|Ga0116221_1125030All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300009609|Ga0105347_1025767All Organisms → cellular organisms → Bacteria2036Open in IMG/M
3300009672|Ga0116215_1177268All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300010040|Ga0126308_10014663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4079Open in IMG/M
3300010046|Ga0126384_10698375All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300010047|Ga0126382_10986530All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300010359|Ga0126376_12865676Not Available532Open in IMG/M
3300010361|Ga0126378_11852588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300010366|Ga0126379_11620413All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300010396|Ga0134126_11014926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium929Open in IMG/M
3300010397|Ga0134124_11512172All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300010397|Ga0134124_11877295All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300010397|Ga0134124_12439581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300010399|Ga0134127_11434558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300010399|Ga0134127_12147772Not Available637Open in IMG/M
3300010400|Ga0134122_12029431All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300010401|Ga0134121_13154028All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300011119|Ga0105246_12418785All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300011120|Ga0150983_15880639All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300011271|Ga0137393_10677728All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300011439|Ga0137432_1228597All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300011439|Ga0137432_1235852All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300011444|Ga0137463_1209806All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300011444|Ga0137463_1381822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300011445|Ga0137427_10060420Not Available1503Open in IMG/M
3300012349|Ga0137387_10952369Not Available618Open in IMG/M
3300012360|Ga0137375_10785535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium768Open in IMG/M
3300012685|Ga0137397_10264997All Organisms → cellular organisms → Bacteria → Proteobacteria1280Open in IMG/M
3300012685|Ga0137397_11245812All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300012891|Ga0157305_10255251All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012893|Ga0157284_10239944All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012910|Ga0157308_10127736All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300012922|Ga0137394_10096700All Organisms → cellular organisms → Bacteria2484Open in IMG/M
3300012922|Ga0137394_11059533All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300012922|Ga0137394_11335476All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300012922|Ga0137394_11489695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300012931|Ga0153915_13349586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300012948|Ga0126375_10656522All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300012971|Ga0126369_10183026All Organisms → cellular organisms → Bacteria2004Open in IMG/M
3300012976|Ga0134076_10267426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300012986|Ga0164304_10956832Not Available674Open in IMG/M
3300013297|Ga0157378_12984655All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300014326|Ga0157380_11771177All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300014501|Ga0182024_10803237All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300014745|Ga0157377_11415662All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300015245|Ga0137409_10201832All Organisms → cellular organisms → Bacteria1790Open in IMG/M
3300015245|Ga0137409_10670728All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300015245|Ga0137409_10935471All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300015372|Ga0132256_100607596Not Available1208Open in IMG/M
3300015372|Ga0132256_102690573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300015374|Ga0132255_102578985All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300015374|Ga0132255_104358941All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300016294|Ga0182041_10001197All Organisms → cellular organisms → Bacteria12905Open in IMG/M
3300016294|Ga0182041_11537974All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium613Open in IMG/M
3300017792|Ga0163161_10578703Not Available923Open in IMG/M
3300017928|Ga0187806_1070920All Organisms → cellular organisms → Bacteria → Acidobacteria1083Open in IMG/M
3300017930|Ga0187825_10052399All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300017930|Ga0187825_10142949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300017930|Ga0187825_10295316Not Available603Open in IMG/M
3300017959|Ga0187779_10989648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300017961|Ga0187778_10676457Not Available697Open in IMG/M
3300017965|Ga0190266_10546508All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300017994|Ga0187822_10268867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300018012|Ga0187810_10246509All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300018016|Ga0187880_1013349All Organisms → cellular organisms → Bacteria → Acidobacteria5234Open in IMG/M
3300018029|Ga0187787_10229603Not Available668Open in IMG/M
3300018064|Ga0187773_10538081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300018076|Ga0184609_10537965All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300018083|Ga0184628_10154113Not Available1196Open in IMG/M
3300018086|Ga0187769_10611751All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium823Open in IMG/M
3300018433|Ga0066667_10079117All Organisms → cellular organisms → Bacteria2111Open in IMG/M
3300018468|Ga0066662_10170578All Organisms → cellular organisms → Bacteria1676Open in IMG/M
3300018469|Ga0190270_10636324All Organisms → cellular organisms → Bacteria → Acidobacteria1046Open in IMG/M
3300018469|Ga0190270_11632398All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300018469|Ga0190270_13114738All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300018476|Ga0190274_10916020Not Available945Open in IMG/M
3300018476|Ga0190274_11189337All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300018476|Ga0190274_13808547Not Available510Open in IMG/M
3300018481|Ga0190271_10322682All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300019377|Ga0190264_10785418All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300021073|Ga0210378_10387420All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300021477|Ga0210398_11092201Not Available634Open in IMG/M
3300021953|Ga0213880_10238748All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium520Open in IMG/M
3300022756|Ga0222622_10355885All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300022906|Ga0247766_1095250All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300023102|Ga0247754_1094701All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300023250|Ga0224544_1007256All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300024182|Ga0247669_1021336All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300024284|Ga0247671_1019174All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300025324|Ga0209640_10274616All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300025862|Ga0209483_1202476All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300025901|Ga0207688_10706532Not Available638Open in IMG/M
3300025910|Ga0207684_10319089All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300025912|Ga0207707_10468106All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1077Open in IMG/M
3300025916|Ga0207663_10452795All Organisms → cellular organisms → Bacteria → Acidobacteria990Open in IMG/M
3300025920|Ga0207649_10933247All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025923|Ga0207681_11209892All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300025926|Ga0207659_11655448Not Available546Open in IMG/M
3300025934|Ga0207686_10224606All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300025934|Ga0207686_11189667All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300025937|Ga0207669_10363449All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300025937|Ga0207669_11689309Not Available541Open in IMG/M
3300025941|Ga0207711_12033028All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300025960|Ga0207651_10382150Not Available1193Open in IMG/M
3300025986|Ga0207658_11499224Not Available617Open in IMG/M
3300026075|Ga0207708_11407057All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300026088|Ga0207641_12240358Not Available546Open in IMG/M
3300026089|Ga0207648_11656465All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300026095|Ga0207676_11152055Not Available768Open in IMG/M
3300026142|Ga0207698_11951798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300026300|Ga0209027_1312204Not Available507Open in IMG/M
3300026301|Ga0209238_1040981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1689Open in IMG/M
3300026306|Ga0209468_1196914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300026317|Ga0209154_1065193All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300026523|Ga0209808_1052251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1860Open in IMG/M
3300026529|Ga0209806_1141037All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300026542|Ga0209805_1033473All Organisms → cellular organisms → Bacteria2622Open in IMG/M
3300026552|Ga0209577_10809306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300027080|Ga0208237_1047428Not Available642Open in IMG/M
3300027839|Ga0209403_10420422All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300027873|Ga0209814_10360967All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300027874|Ga0209465_10070435All Organisms → cellular organisms → Bacteria1694Open in IMG/M
3300027886|Ga0209486_11183546All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300027903|Ga0209488_10404867All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300028381|Ga0268264_12535839Not Available518Open in IMG/M
3300028536|Ga0137415_10346792All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300028802|Ga0307503_10466170All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300028824|Ga0307310_10179419All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300029993|Ga0302304_10378748Not Available514Open in IMG/M
3300030620|Ga0302046_11489683All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031198|Ga0307500_10220979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300031231|Ga0170824_102714171Not Available598Open in IMG/M
3300031238|Ga0265332_10077401All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1413Open in IMG/M
3300031366|Ga0307506_10288465All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium638Open in IMG/M
3300031573|Ga0310915_10631438Not Available758Open in IMG/M
3300031640|Ga0318555_10239578All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300031708|Ga0310686_113801022All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300031713|Ga0318496_10077311All Organisms → cellular organisms → Bacteria → Acidobacteria1760Open in IMG/M
3300031723|Ga0318493_10837423All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium519Open in IMG/M
3300031740|Ga0307468_100568365All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium918Open in IMG/M
3300031744|Ga0306918_10041434All Organisms → cellular organisms → Bacteria2997Open in IMG/M
3300031781|Ga0318547_10017024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3504Open in IMG/M
3300031782|Ga0318552_10136248All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300031793|Ga0318548_10165276All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300031854|Ga0310904_10069203All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300031858|Ga0310892_10221168All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300031858|Ga0310892_10678768All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300031880|Ga0318544_10074584All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300031894|Ga0318522_10094272All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300031896|Ga0318551_10261510All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300031908|Ga0310900_10671161All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031910|Ga0306923_12087728All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium572Open in IMG/M
3300031911|Ga0307412_11075630All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300031913|Ga0310891_10016491All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300031941|Ga0310912_10463370Not Available988Open in IMG/M
3300031943|Ga0310885_10273312All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300031944|Ga0310884_10044485All Organisms → cellular organisms → Bacteria1958Open in IMG/M
3300031946|Ga0310910_11287882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.565Open in IMG/M
3300032002|Ga0307416_100161814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2070Open in IMG/M
3300032012|Ga0310902_10223061All Organisms → cellular organisms → Bacteria → Proteobacteria1120Open in IMG/M
3300032013|Ga0310906_10346451All Organisms → cellular organisms → Bacteria → Acidobacteria965Open in IMG/M
3300032013|Ga0310906_10521737All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300032025|Ga0318507_10101277All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300032055|Ga0318575_10213862All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300032074|Ga0308173_11168317All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium719Open in IMG/M
3300032075|Ga0310890_10735045All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300032122|Ga0310895_10440269Not Available645Open in IMG/M
3300032157|Ga0315912_10378491All Organisms → cellular organisms → Bacteria → Acidobacteria1120Open in IMG/M
3300032157|Ga0315912_11502025Not Available531Open in IMG/M
3300032174|Ga0307470_11255136All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium605Open in IMG/M
3300032174|Ga0307470_11826670Not Available515Open in IMG/M
3300032180|Ga0307471_103924349Not Available526Open in IMG/M
3300032205|Ga0307472_101561047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300032261|Ga0306920_101596093All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300032515|Ga0348332_10055365Not Available693Open in IMG/M
3300032515|Ga0348332_11943663Not Available1093Open in IMG/M
3300032828|Ga0335080_11375453Not Available703Open in IMG/M
3300032895|Ga0335074_10211767All Organisms → cellular organisms → Bacteria → Acidobacteria2343Open in IMG/M
3300032898|Ga0335072_10359570All Organisms → cellular organisms → Bacteria1588Open in IMG/M
3300032954|Ga0335083_10357386All Organisms → cellular organisms → Bacteria → Proteobacteria1262Open in IMG/M
3300033004|Ga0335084_11802029All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium600Open in IMG/M
3300033413|Ga0316603_12071545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300034163|Ga0370515_0166163All Organisms → cellular organisms → Bacteria945Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.06%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.33%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.56%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.17%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.39%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.39%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.39%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.39%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.39%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.39%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.39%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.39%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.39%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.39%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.39%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.39%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.39%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.39%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.39%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.39%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.39%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.39%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.39%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.39%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.39%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.39%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000178Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced)EnvironmentalOpen in IMG/M
3300001151Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027839Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FW301_105495013300000178GroundwaterGIIPTPRPVISAAFGGRDKKTLFVLARGARDATGTEVANAAQVYAIPLVAQGYKGRAK*
JGI12713J13577_102232213300001151Forest SoilAFGGSDKKTLFILARGAGDANGQQIANAAQVYTIQMIAQGYKGRPK*
JGIcombinedJ26739_10150217513300002245Forest SoilFGGSDKKTLFILARGAGDANGQQIANAAQVYTIQMIAQGYKGRPK*
Ga0055472_1003310523300003998Natural And Restored WetlandsEKKTLFVLARGATDANGAQVANAAQVYAIELIAQGYRGRAK*
Ga0062589_10206543023300004156SoilPVISCAFGGNDKKTLFVLARGAQDAEGNEVANAAQVWSIRMIAQGYNGRAK*
Ga0062589_10277313723300004156SoilPRPVISCAFGGNDKKTLFVLARGAQDAEGHEVANAAQVWSIRTIAQGDKGRAK*
Ga0066398_1012971823300004268Tropical Forest SoilIPTPRGVISCAFGGRDKKTLFILARGAQDAEGNEAANAAQVWSIPMIAQGYKGRGK*
Ga0062592_10059218813300004480SoilVITAAFGGKDKKSLYILARGAEAADGTQVANAAQVWVIPMIAQGFKGRAK*
Ga0062594_10265934513300005093SoilVISVAFGAVDKKTLYVLARGAKSANGEEVANAAQVYAIQMVAQGFRGRAK*
Ga0066810_1019728123300005169SoilPTPRGVISVAFGGPGKKRLFVLARGAKDAAGNEVANAAQVYTIDMIAQGYRGRAK*
Ga0066680_1070566413300005174SoilGKNKKTLFVLARGAQDAEGNDVANAAQVWSIQMIAQGYKERAK*
Ga0065705_1093426113300005294Switchgrass RhizospherePTPRGVISCAFGGKDKKTLFVLARGGTDADGHEVANAAQVWSIPMIAQGYQRRAK*
Ga0065707_1009537653300005295Switchgrass RhizosphereITAAFGGKDKKMLYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK*
Ga0065707_1050508013300005295Switchgrass RhizosphereGVITAAFGGKDKKMLYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK*
Ga0070690_10134395623300005330Switchgrass RhizosphereLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK*
Ga0070671_10152685413300005355Switchgrass RhizosphereRGVITTAFGGKDKKQLFILARGAKDATGAEIANAAQVYTIQMIAAGYKGRAK*
Ga0070688_10066654323300005365Switchgrass RhizosphereKDKKTLYILARGATQADGTEVANAAQVWAIPMIAQGYKGRAK*
Ga0070701_1032696013300005438Corn, Switchgrass And Miscanthus RhizosphereFGGKDKKTFYILARGATDTAGTEVPNAAQVWSIQMQAQGYKNRAK*
Ga0070705_10011333433300005440Corn, Switchgrass And Miscanthus RhizosphereGKDKKTLYILARGATQADGTEVANAAQVWAIPMIAQGYKGRAK*
Ga0066681_1057231633300005451SoilRGVISCAFGGTDKKTLFVLARGAQDAEGNEVANAAQVWSIPTIAQGYKRRAK*
Ga0068867_10115025223300005459Miscanthus RhizosphereTCAFGGKDKKTMYILARGAKEANGEEVANAAQVWTIPMIAQGYKGRMK*
Ga0068867_10197656213300005459Miscanthus RhizosphereVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK*
Ga0070686_10085942813300005544Switchgrass RhizosphereAFGGKDKKTLYILARGATQADGTEVANAAQVWAIPMIAQGYKGRAK*
Ga0070686_10125651623300005544Switchgrass RhizosphereGPDGKNLGVIPTPRGVITGAFGGKDKKTFYILARGATDTAGTEIPNAAQVWAIQMQAQGYKNRAK*
Ga0070695_10039249123300005545Corn, Switchgrass And Miscanthus RhizosphereVISCAFGGNDKKTLFVLARGAQDAEGNEVANAAQVWSIRMIAQGYKGRAK*
Ga0066692_1098882213300005555SoilGVISCAFGGKDKKTLFVLARGAQDAEGNDVANAAQVWSIQMIAQGYKERAK*
Ga0066699_1007461013300005561SoilIPTPRGVISCAFGGKDKKTLFILARGAQDAEGNEVANAAQVWSIQMIAQGYKGRAK*
Ga0068857_10049974533300005577Corn RhizosphereYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK*
Ga0068857_10233791623300005577Corn RhizosphereDGKTLGVIPTPRPVITGAFGGKDKKTFYILARGATDTAGTEVPNAAQVWSIQMQAQGYKNRAK*
Ga0068854_10171250823300005578Corn RhizosphereTAFGGKDKKTLFILARGATDASGADVANAAQVYAIQMIAQGYKGRAK*
Ga0068859_10158737413300005617Switchgrass RhizosphereTPRGVITGAFGGKDKKTFYILARGATDANGTEVANAAQVWSIQLQAQGYKGRAK*
Ga0068866_1077317313300005718Miscanthus RhizosphereNLGVIPTPRGVITTAFGGKDRKTLFILARGGTSASGEEVANVAQVWTIPMVAQGYKGRAK
Ga0068861_10008203943300005719Switchgrass RhizospherePVISCAFGGNDKKTLFVLARGAQDAEGNEVANAAQVWSIRMIAQGDKGRAK*
Ga0068861_10251405913300005719Switchgrass RhizosphereRGIISSAFGGKDKKTLFALLRGGTDASGNEVANVAQVWSIPMVAQGYKGRAK*
Ga0066903_10003130213300005764Tropical Forest SoilTPRGVISCAFGGKDKKVLFVLARGAQDAEGNDVGNAAQVWSIEMTAQGYKGRAK*
Ga0066903_10360818123300005764Tropical Forest SoilKNKQTLFILARGATADDGTQVANAAQVWTMPMIAQGYKGRAK*
Ga0068851_1068794113300005834Corn RhizosphereVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQTQGYKGRAK*
Ga0068858_10147426623300005842Switchgrass RhizosphereAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKGRAK*
Ga0068862_10220579513300005844Switchgrass RhizosphereTLFALLRGGTDASGNEVANVAQVWSIPMVAQGYKGRAK*
Ga0070766_1091183413300005921SoilGPDKKTLYVLAQGAKDSQGKEVDNAAQVYSIPMIAQGFKKRAK*
Ga0066651_1005399743300006031SoilHLGVIPTPRGVISCAFGGRDKKTLFVLARGAQDAEGNEVANAAQVWSIQTIAQGHKGRAK
Ga0066652_10128218813300006046SoilVITGAFGGKDKKTFYILARGATDTAGNEVANAAQVWSIQMQAQGYKNRAK*
Ga0097621_10079769013300006237Miscanthus RhizosphereFGGKDRKTLFILARGGTSASGEEVANVAQVWTIPMVAQGYKGRAK*
Ga0068871_10094418813300006358Miscanthus RhizosphereLGVIPTPRGVITTAFGGKDRKTLFILARGGTSASGEEVANVAQVWTIPMVAQGYKGRAK*
Ga0079222_1037981413300006755Agricultural SoilKNLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWAIQMQAQGYKGRAK*
Ga0066659_1068883113300006797SoilLLRGGTDASGADQANVAQVWALQMTAEGYKGRAK*
Ga0075428_10270534113300006844Populus RhizosphereDKKTLFILARGAVAADGSDVANAAQVWSIPMIAQGFKGRAK*
Ga0075430_10068305823300006846Populus RhizosphereNKKTFFILARGATDADGNEVGNAAQVWSIPMVAQGYKGRAK*
Ga0075433_1064420913300006852Populus RhizosphereFGGKDKKMLYILARGAVAADGSEVANAAQVWVIPMLAQGYKGKAK*
Ga0075425_10246325723300006854Populus RhizosphereGGKDKKMLYILARGAVAADGSEVANAAQVWVIPTLAQGYKGKAK*
Ga0079217_1003130533300006876Agricultural SoilVIGPDGTYLGIIPTPRPVISTAFGGAGKKTLFVLARGATDANGSQVANAAQVYAIDLIAQGYSGRAK*
Ga0075429_10009037513300006880Populus RhizosphereKKTLFILARGAVAADGSDVANAAQVWSIPMIAQGFKGRAK*
Ga0068865_10025691323300006881Miscanthus RhizosphereKKTMYILARGAKEANGEEVANAAQVWTIPMIAQGYKGRMK*
Ga0068865_10133448613300006881Miscanthus RhizosphereTPRGVITTAFGGKDKKTLFVLARGAKDASGSEVANAAQVWAIQMIAQGYKGRAK*
Ga0075426_1113679613300006903Populus RhizospherePVISVAFGGANKSTLYVLARGATSAAGEETANAAQVYAIQTIAQGYKGRPK*
Ga0075424_10000923413300006904Populus RhizospherePVISVAFGGPGKKTLFVLARGARDATGNEVANAAQVYSIRMIAAGFRGRAK*
Ga0079216_1118872513300006918Agricultural SoilPRPVISTAFGGAEKKTLFVLARGATDANGSQVANAAQVYAIDLIAQGYSGRAK*
Ga0079218_1366367423300007004Agricultural SoilGKYLGIIPTPRPVISAAFGGKDKRTLFVLARGATDANGNQVANAAQVYAIQMLAQGYRGRAK*
Ga0075435_10007828543300007076Populus RhizosphereLRPAVNTWVPTPRPVISVAFGGPGKKTLFVLARGARDATGNEVANAAQVYSIRMIAAGFRGRAK*
Ga0075435_10073511413300007076Populus RhizosphereGVEVIDPTGKHLGVIPTPRGVITCAFGGNGKKTLFILARGGTTSKGEELANVAQVWTIPMEAQGFKGRAK*
Ga0075435_10155635823300007076Populus RhizosphereLARGAKSANGEEVANSAQVYAIQMVAQGFKGRAK*
Ga0099828_1150512823300009089Vadose Zone SoilFRGKDKKTLFVLARGAQDAEGNQVANAAQVWSIPMIAQGYKKRAK*
Ga0099827_1058344823300009090Vadose Zone SoilGGKDKKTLFILARGAQDAEGNEVANAAQVWSIPTIAQGYKGRAK*
Ga0105245_1327795913300009098Miscanthus RhizosphereTGAFGGKDKKTFYILARGATDTAGTEVPNAAQVWSIQMQAQGYKNRAK*
Ga0099792_1085018723300009143Vadose Zone SoilLARGAKDADGSEVANAAQVWTIPMIAQGYKGRAK*
Ga0114129_1037215053300009147Populus RhizosphereFGGKDKKTLFVLARGAQDAEGNEVANAAQVWSIPMIAQGYKGRAK*
Ga0114129_1077385113300009147Populus RhizosphereAAFGGKDKKMLYILARGATQADGTEVANAAQVWSIQMIAQGYKARAK*
Ga0114129_1279264323300009147Populus RhizosphereSVAYGAADKKTLYVLARGAKSATGEEVANAAQVYAVQMVAPGFKGRAK*
Ga0105243_1140343913300009148Miscanthus RhizosphereAFGGKDKKTFYILARGATDANGTEVPNAAQVWAIQMQAQGYKGRAK*
Ga0075423_1145527013300009162Populus RhizosphereRGVITAAFSGRDKKTLFILARGAVAADGSDVANAAQVWSIPMIAQGFKGRAK*
Ga0105100_1077144113300009166Freshwater SedimentYMKTLFILARGAVSADGTEVANAAQVWSIPMIAQGYRGRAK*
Ga0105242_1025849323300009176Miscanthus RhizosphereLARGAKSANGEEVANAAQVYAIQMVAQGYKGRAK*
Ga0105248_1031098233300009177Switchgrass RhizosphereKDKKTMYILARGAKEANGEEVANAAQVWTIPMIAQGYKGRMK*
Ga0116222_104548333300009521Peatlands SoilDKKTLFILARGAKDQQGNEVANAAQVYSISMLAQGFKKRAK*
Ga0116221_112503043300009523Peatlands SoilFGGPGKKTLFILARGAQASDGTQIANAAQVYSIPMIAHGYKGRPK*
Ga0105347_102576733300009609SoilVISAAFGGRDKKTLFVLARGATDANGTQVANAAQVYAIQTIAQGYAGRAK*
Ga0116215_117726843300009672Peatlands SoilLARGAQASDGTQIANAAQVYSIPMIAHGYKGRPK*
Ga0126308_1001466313300010040Serpentine SoilKKMLYILARGATQADGTEVANAAQVWAIQMIAQGYKGRAK*
Ga0126384_1069837523300010046Tropical Forest SoilLFILARGATADDGTQVANAAQVWTMPMIAQGYKGRAK*
Ga0126382_1098653013300010047Tropical Forest SoilGKTLGAIATPRGVITCAFGGKDKKTLFILARGAKDADGMEVANAAQVWTIPVIAQGFKGRAK*
Ga0126376_1286567613300010359Tropical Forest SoilNKQTLFILARGATADDGTQVANAAQVWTMPMIAQGYKGRAK*
Ga0126378_1185258813300010361Tropical Forest SoilKNKKTLYILARGGTTSKGEELANVAQVWTIPMEAQGFKGRAK*
Ga0126379_1162041323300010366Tropical Forest SoilGVEAIGRDGQHLGVIPTPRGVISCAFGGTDKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK*
Ga0134126_1101492613300010396Terrestrial SoilIPTPRGVITAAFCGKDRKTLFILARGGTSSTGEEVANVAQVWTIPMVAQGFKGRAK*
Ga0134124_1151217213300010397Terrestrial SoilAAFGGKDKKMLHILARGGVAADGSEVANAAQVWVIPMLAQGFKGRAK*
Ga0134124_1187729513300010397Terrestrial SoilMYILARGAKEANGEEVANAAQVWTIPLIAQGYKGRMK*
Ga0134124_1243958123300010397Terrestrial SoilGVIPTPRGVISCAFGGKDKKMLFVLARGATAADGREVANAAQVWSIPMIAQGYQRRAK*
Ga0134127_1143455823300010399Terrestrial SoilGKDKKTLFALLRGGTDASGNEVANVAQVWSIPMVAQGYKGRAK*
Ga0134127_1214777213300010399Terrestrial SoilKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK*
Ga0134122_1202943123300010400Terrestrial SoilGVIPTPRGVICCAFGGNDKKTLFVLARGAQDAEGNDVANAAQVWSIQTIAQGYKGRAK*
Ga0134121_1315402823300010401Terrestrial SoilGVIPTPRGVITGAFGGKDKKTFYILARGATDTAGTEVPNAAQVWSIQMQAAGYKGRAK*
Ga0105246_1241878523300011119Miscanthus RhizosphereAAFGGKDKKMLYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK*
Ga0150983_1588063913300011120Forest SoilLFVLARGAKDASGNEVANAAQVYTIKMIAQGYKGRAK*
Ga0137393_1067772823300011271Vadose Zone SoilISCAFGGRDKKRLFVLARGAQDAEGNQVANAAQVWSIPMIAQGYRGRAK*
Ga0137432_122859713300011439SoilRGVITAAFGGKDKKMLYILARGATDANGTEVANAAQVWAIQMIAQGFKGRAK*
Ga0137432_123585213300011439SoilRGVITAAFGGKDKKMLYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK*
Ga0137463_120980633300011444SoilPGKKRLFVLARGAKDAAGNEVANAAQVYTIDMIAQGYRGRAK*
Ga0137463_138182213300011444SoilIPTPRGVISVAFGGPGKKRLFALARGAKDAAGNEVANAAQVYTIDMIAQGYRGRAK*
Ga0137427_1006042023300011445SoilPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSITMQAAGYKNRAK*
Ga0137387_1095236923300012349Vadose Zone SoilFGGKDKKTLFILARGAKDATGTEVANAAQVYAIQTIAQGYKGRAK*
Ga0137375_1078553513300012360Vadose Zone SoilVLARGAQDAEGDEVANAAQVWSIPIRAQGYKGPAK*
Ga0137397_1026499733300012685Vadose Zone SoilLPTPRPVISVAFGGPGKRTLFVLARGARDAGGAEVANAAQVYSTDLIAQGYRGRPK*
Ga0137397_1124581213300012685Vadose Zone SoilTLFVLARGAKDAAGNEVANAAQVYAIPMVAAGYRGRAK*
Ga0157305_1025525113300012891SoilGRDGTHLGVIPTPRPVISCAFGGNDKNTLFVLARGAQDAEGNEVANAAQVWSIRMIAQGDKGRAK*
Ga0157284_1023994413300012893SoilDKKMLYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK*
Ga0157308_1012773613300012910SoilGQSVDVFAPDGKFLGSIRGPQGLHGTAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKKRAK*
Ga0137394_1009670043300012922Vadose Zone SoilGGNDKKTLFVLARGAQNAEGNEVANAAQVWSIPMVAQGYTGRAK*
Ga0137394_1105953313300012922Vadose Zone SoilTLFILERGAQDAEGNEVGNAAQVWSIPMIAQGDKGRAK*
Ga0137394_1133547613300012922Vadose Zone SoilLFVLARGAQDAEGNEVANAAQVWSIPMIAQGHKGRAK*
Ga0137394_1148969523300012922Vadose Zone SoilGRDKKTLFVLARGAQDAEGNEVANAAQVWSIPTIAQGYKGRAK*
Ga0153915_1334958613300012931Freshwater WetlandsSLYILARGAKDAQGNEVANAAQVYSIPMIAQGFKKRAK*
Ga0126375_1065652213300012948Tropical Forest SoilRDKKTLFVLARGAQNAQGNEVANAAQVWSIQMTAQGYKGRAK*
Ga0126369_1018302633300012971Tropical Forest SoilLFVLARGAQDGEGNEVANAAQVWSIQMVAQGYKGRAK*
Ga0134076_1026742623300012976Grasslands SoilLARGAQDAEGNEVANAAQVWSIQMIAQGYKERAK*
Ga0164304_1095683213300012986SoilILARGAKDANGEEVANAAQVWTIPMIAQGYKGRAK*
Ga0157378_1298465523300013297Miscanthus RhizosphereGVIPTPRGVISCAFGGRDKKTLFVLARGAQDADGNEVANAAQVWTIQMIAQGYKGRAK*
Ga0157380_1177117713300014326Switchgrass RhizosphereTLFVLARGAKDASGNEVANAAQVWAIQMIAQGYKGRAK*
Ga0182024_1080323723300014501PermafrostKTLYILAQGAKDAQGKEVDNAAQVYSIPMIAQGFKKRAK*
Ga0157377_1141566213300014745Miscanthus RhizosphereAFGGKDKKTFYILARGATDANGTEVPNATQVWSIPMQAQGFKGRAK*
Ga0137409_1020183233300015245Vadose Zone SoilDKKTLFVLARGAQDAEGNDLANAAQVWSIQMIAQGYKRRAK*
Ga0137409_1067072813300015245Vadose Zone SoilLFVLARGAEDAAGNQVANAAQVWTIEMIAQGYKSRAK*
Ga0137409_1093547123300015245Vadose Zone SoilVLARGAQDADGNEVANAAQVWSIQAIAQGYRRRPK*
Ga0132256_10060759613300015372Arabidopsis RhizosphereLARGATDANGTEVPNAAQVWSIQMQAAGYKGRAK*
Ga0132256_10269057313300015372Arabidopsis RhizosphereAFGGPGKKTLFVLARGARDASGGEVANAAQVYAITTIAKGYRGRPK*
Ga0132255_10257898513300015374Arabidopsis RhizosphereTLFVLARGAQDAEGNEVANAAQVWSIQTIAQGYKGRAK*
Ga0132255_10435894113300015374Arabidopsis RhizosphereDGKNLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAAGYKGRAK*
Ga0182041_1000119713300016294SoilKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK
Ga0182041_1153797413300016294SoilKDKKSLFILARGAVDASGNQVANAAQVYAIRMIAQGYRGRAK
Ga0163161_1057870313300017792Switchgrass RhizosphereTFYILARGATDANGTEVPNAAQVWAIQMQAQGYKGRAK
Ga0187806_107092013300017928Freshwater SedimentHTLFILARGAEDSTGQQIANAAQVYSIQMIAHGPSSRPK
Ga0187825_1005239933300017930Freshwater SedimentVSFGGANRKTLFILARGAVDSTGSQIANAAQVYSISMIAQGYKGRPK
Ga0187825_1014294913300017930Freshwater SedimentRKTLFVLARGAVDSSGNQIGNAAQVYSIPMIAQGFKGRPK
Ga0187825_1029531623300017930Freshwater SedimentPTPRPVISAAFSGHDKRTLYILARGATDQQGHEVANAAQVYSISMIARGFKKRAK
Ga0187779_1098964823300017959Tropical PeatlandGLHGTFFGGKDRKTLYILARGGTSSTGDEVANVAQVWTIPMVAQGYKGRAK
Ga0187778_1067645713300017961Tropical PeatlandPRDIISVSFGGADRRKLFILSRGAVGSDGSQGANAAQVYSIQMVAQGYAGRPK
Ga0190266_1054650823300017965SoilGVIPTPRGVITGAFGGRDKKTFYILARGATDANGTEIPNAAQVWSIPMQAQGYRARAK
Ga0187822_1026886733300017994Freshwater SedimentGKKTLFILARGAVDSDGKQIANAAQVYSIQMIAQGCKGRPK
Ga0187810_1024650913300018012Freshwater SedimentTLFALMRGAEDSTGQQIANAAQVYSIQMIANGPSSRPK
Ga0187880_101334973300018016PeatlandLLGVIPTPRPIISVAFGGHDRKTLFILARGAEDANGQQIANAAQVYSIQMIAQGYKSRPK
Ga0187787_1022960323300018029Tropical PeatlandLFILARGGTSSKGEEVANVAQVWTIQMEAEGYKGRAK
Ga0187773_1053808113300018064Tropical PeatlandVIPTPRGVITAAFGGKDRKTLFILARGGTSSTGEEVANVAQVWTIPMVAQGYKGRAK
Ga0184609_1053796513300018076Groundwater SedimentTLFVLARGAQDAEGNEVANAAQVWSIPMIAQGYQRRAK
Ga0184628_1015411323300018083Groundwater SedimentPDGKNLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIAMQAQGYKNRAK
Ga0187769_1061175113300018086Tropical PeatlandKTLFILARGAVGPDGNQVANAAQVYSIQMIAQGYQGRPK
Ga0066667_1007911723300018433Grasslands SoilFILARGAQDAEGNEVANAAQVWSIQMIAQGYKGRAK
Ga0066662_1017057833300018468Grasslands SoilILGRGAQDAEGNEVANAAQVWSIPMIAQGYKGRAK
Ga0190270_1063632413300018469SoilMISAAFGGTDKKTLFVLARGATDANGAQVANAAQVYAIDTIAQGYTGRAK
Ga0190270_1163239813300018469SoilKTLFVLARGATDADGQEVANAAQVWSIPMIAQGYKRRAK
Ga0190270_1311473813300018469SoilEVLGPDGKNLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYRDRAK
Ga0190274_1091602013300018476SoilVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKARAK
Ga0190274_1118933713300018476SoilNLGVIPTPRGVITGAFGGKDKKTFYILARGATDASGTEVPNAAQVWSIPMQAQGYKNRAK
Ga0190274_1380854723300018476SoilITGAFGGKDKKTFYILARGATDANGTEVANAAQVWSIQMQAQGYKKRAK
Ga0190271_1032268213300018481SoilPDGKNLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYRNRAK
Ga0190264_1078541823300019377SoilGGRDKKTFYILARGATDANGTEIPNAAQVWSIPMQAQGYRGRAK
Ga0210378_1038742013300021073Groundwater SedimentKMLFVLARGAQDAEGNEVANAAQVWSMPMIAQGYKGRAK
Ga0210398_1109220113300021477SoilILARGARDQAGNEVSNAAQVYTIQMIAQGFKKRAK
Ga0213880_1023874823300021953Exposed RockTGKNLGVIPTPRGVITAAFGGKDRKTLFILARGGTSSTGEEVANVAQIWSIPMVAQGYKGRLK
Ga0222622_1035588533300022756Groundwater SedimentPRGVISVAFGGPGKQRLFVLARGAKDAGGNEVANAAQVYTIDMIAQGYRGRAK
Ga0247766_109525023300022906Plant LitterLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVANAAQVWSIQMQAQGYKKRAK
Ga0247754_109470113300023102SoilRGVITGAFGGKDKKTFYILARGATDANGTEVANAAQVWSIQMQAQGYKKRAK
Ga0224544_100725633300023250SoilISVAFAGRDKMTLFILARGAKDPQGNEVANAAQVYSISMIAQGFKKRAK
Ga0247669_102133613300024182SoilKTLFVLARGAQDAEGAEVANAAQVWSIQMIAQGYKGRAK
Ga0247671_101917413300024284SoilLGVIPTPRGVISCAFGGKDRKTLFVLARGAQDAEGAEVANAAQVWSIQMIAQGYKGRAK
Ga0209640_1027461613300025324SoilVAFGGRDKKTLFVLARGAVDSAGAEVANAAQVYALQMVAAGYSGRAK
Ga0209483_120247613300025862Arctic Peat SoilFLSLPPNAVEIAPRGAISTAFGGKDKKTLFALLRGGTDAQGAEQGNVAQVWSIQMTATGYKGRAK
Ga0207688_1070653213300025901Corn, Switchgrass And Miscanthus RhizospherePRPVISAAFGGAGKKTLFVLARGARDAAGGEIADAAQVYAIDMSASGYRGRAK
Ga0207684_1031908923300025910Corn, Switchgrass And Miscanthus RhizosphereFGGKDKKTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYKERAK
Ga0207707_1046810613300025912Corn RhizosphereGKHLGVIPTPRAVITAAFGGKDRKTLFVLARGGTSSTGEEVANVAQVWTIPMVAQGFKGRAK
Ga0207663_1045279513300025916Corn, Switchgrass And Miscanthus RhizosphereRGVITCAFGGKDKKTLFILARGAMAADGTQVANAAQVWTIPMIAQGYKGRAK
Ga0207649_1093324723300025920Corn RhizosphereKTLYILARGATQADGTEVANAAQVWAIQMIAQGYKGRAK
Ga0207681_1120989213300025923Switchgrass RhizosphereSCACGGNDKKTLFVLARGAQDAEGNEVANAAQVWSIRMIAQGDKGRAK
Ga0207659_1165544823300025926Miscanthus RhizosphereGAFGGKDKKTFYILARGATDTAGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0207686_1022460613300025934Miscanthus RhizosphereITCAFGGKDKKTMYILARGAKEANGEEVANAAQVWTIPMIAQGYKGRMK
Ga0207686_1118966723300025934Miscanthus RhizosphereLGLIPTPRGVITTAFGGKDKKQLFILARGAKDATGAEIANAAQVYTIQMIAAGYKGRAK
Ga0207669_1036344913300025937Miscanthus RhizosphereITPRGVITCAFGGKDKKTMYILARGAKEANGEEVANAAQVWTIPMIAQGYKGRMK
Ga0207669_1168930923300025937Miscanthus RhizosphereILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0207711_1203302813300025941Switchgrass RhizosphereKDKKMLYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK
Ga0207651_1038215013300025960Switchgrass RhizosphereITGAFGGKDKKTFYILARGATDTAGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0207658_1149922423300025986Switchgrass RhizosphereFYILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0207708_1140705713300026075Corn, Switchgrass And Miscanthus RhizosphereFGGKDKKTLFVLARGATDASGAEVANAAQVWSIPLIAQGYKRRAK
Ga0207641_1224035813300026088Switchgrass RhizosphereKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKGRAK
Ga0207648_1165646513300026089Miscanthus RhizosphereGADGKNLGVIPTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0207676_1115205523300026095Switchgrass RhizosphereTGAFGGKDKKTFYILARGATDTAGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0207698_1195179813300026142Corn RhizosphereGKKTLFVLARGARDAAGGEIADAAQVYAIDMSASGYRGRAK
Ga0209027_131220413300026300Grasslands SoilTPRPVISVAFGGAGKSTLYVLARGATSAAGEEVANAAQVYAIQMIAQGYKGRPK
Ga0209238_104098133300026301Grasslands SoilIPTPRGVISCAFGGKDKKTLFVLARGAQDADGTDVANAAQVWAIQTIAQGYKGRAK
Ga0209468_119691413300026306SoilTDKKTLFLLARGAQDAEGNEVANAAQVWSIPMIAQGYKGRAK
Ga0209154_106519323300026317SoilVISCAFGGKDKKTLFILARGAQDAEGNEVANAAQLWSIQMIAQGYKGRAK
Ga0209808_105225133300026523SoilKTLFVLARGAQDADGTEVANAAQVWAIQTIAQGYKGRAK
Ga0209806_114103733300026529SoilHLGVIPAPRGVISCAFGGKDKKTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYKERAK
Ga0209805_103347313300026542SoilIPTPRGVISCAFGGKDKKTLFILARGAQDAEGNEVANAAQVWSIQMIAQGYKGRAK
Ga0209577_1080930613300026552SoilVLARGARDAAGSEIANAAQVYSIQTVARGYRGRPK
Ga0208237_104742813300027080Forest SoilGPGRQTLFILARGAQDSTGQQIANAAQVYSIQMVAHGFAGRPK
Ga0209403_1042042213300027839MarineNPGVQVIGPDGEYLGIIQTPRGVISLAFGGTDKRTLFVLARGAIDAEGNEVRNAAQVYSIPMTASGYRGRAK
Ga0209814_1036096713300027873Populus RhizosphereADKKTVYVLARGAKSANGEEVANSAQVYAIQMVAQGFKGRAK
Ga0209465_1007043533300027874Tropical Forest SoilAGVEVIDPSGKNLGVIPTPRGVITCAFGGKGKKTLFILARGGTTSKGEELANVAQVWTIPMETQGFKGRAK
Ga0209486_1118354613300027886Agricultural SoilPVISAAFGGPDKKTLFVLARGATDAGGSQVANAAQVYAIQMIAQGYPGRAK
Ga0209488_1040486733300027903Vadose Zone SoilKMLYILARGAKDANGEEVANAAQVYAIQMIAQGYKGRAK
Ga0268264_1253583923300028381Switchgrass RhizosphereGAFGGKDKKTFYILARGATDANGTEVPNAAQVWAIQMQAQGYKNRAK
Ga0137415_1034679213300028536Vadose Zone SoilGGKDKKTLFVLARGAQDAEGNDVANAAQVWSIQMIAQGYKERAK
Ga0307503_1046617023300028802SoilITCAFGGKDKKTMYILARGAKDANGEEVANAAQVWTIQMLAQGYKGRMK
Ga0307310_1017941923300028824SoilIPAPRGVISCAFGGKDKKTLFVLARGAQDAEGNEVSNAAQVWSIQMIAQGYKDRAK
Ga0302304_1037874813300029993PalsaKKTLYILAKGAKNAEGDEIANAAQVYSISMTAQGFTKRAK
Ga0302046_1148968313300030620SoilSGAFGGTDKRTLFVLARGATDANGNQVANAAQVYAIQMLAQGYRGRAK
Ga0307500_1022097913300031198SoilVISVAFGGAGKRTLFVLARGAKDAAGNEVANAAQVYAIPMVAAGYRGRAK
Ga0170824_10271417113300031231Forest SoilLFILARGAVAADGTQVANAAQVWTIPMVAQGYKGRAK
Ga0265332_1007740123300031238RhizosphereFVLLRGGTDAQGADVANVAQVWSLQMTTTGYKGRAK
Ga0307506_1028846523300031366SoilGVIPTPRGVITCAFGGKDKKTLFILARGAKDANGEEVANAAQVWTIQMIAQGYKGRAK
Ga0310915_1063143823300031573SoilDRKILFILARGAEDSDGKQIANAAQVYSIPMIAQGYRGRPK
Ga0318555_1023957823300031640SoilVISCAFGGQDKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK
Ga0310686_11380102213300031708SoilKNKSTLFVLARGAKDASGNEVANAAQVYAIQMIAQGYKGRAK
Ga0318496_1007731133300031713SoilPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK
Ga0318493_1083742313300031723SoilAFGGKDKKSLFILARGAVDASGNQVANAAQVYAIRMIAQGYRGRAK
Ga0307468_10056836513300031740Hardwood Forest SoilTGKLLGVIPTPRGVITTAFGGKDRKTLFILARGGTSASGEEVANVAQVWTIPMVAQGYKGRAK
Ga0306918_1004143413300031744SoilGRDGQHLGVIPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNQVANAAQVWSIQMIAQGYTGRAK
Ga0318547_1001702453300031781SoilTTGAGVEVIGRDGQHLGVIPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK
Ga0318552_1013624833300031782SoilVISCAFGGQDKRTLFVLARGAQDAEGNQVANAAQVWSIQMIAQGYTGRAK
Ga0318548_1016527623300031793SoilVIGRDGQHLGVIPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNQVANAAQVWSIQMIAQGYTGRAK
Ga0310904_1006920343300031854SoilMLYILARGATDANGTEVANAAQVWAIQMIAQGYKGRAK
Ga0310892_1022116833300031858SoilGVITAAFGGKDKKTLYILARGATQADGTEVANAAQVWAIQMIAQGYKGRAK
Ga0310892_1067876813300031858SoilGVITAAFGGKDKKMLYILARGAEAADGTQVANAAQVWVIPMVAQGFKGRAK
Ga0318544_1007458433300031880SoilGVEVIGRDGQHLGVIPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK
Ga0318522_1009427213300031894SoilGQHLGVIPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK
Ga0318551_1026151023300031896SoilIPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNEVANAAQVWSIQMIAQGYTGRAK
Ga0310900_1067116123300031908SoilIPTPRGVITTAFSGKDKKMLYILARGATDANGTEVANAAQVWSIQMIAQGYKKRAK
Ga0306923_1208772813300031910SoilSLFILARGAVDASGNQVANAAQVYAIRMIAQGYRGRAK
Ga0307412_1107563023300031911RhizosphereGAFGGPDKKTFFILARGATDADGNEVANAAQVWSIPMIAQGYKGRAK
Ga0310891_1001649113300031913SoilILARGATDANGTEVANAAQVWAIQMIAQGFKGRAK
Ga0310912_1046337013300031941SoilLFILARGAEDSDGKQIANAAQVYSIPMIAQGYRGRPK
Ga0310885_1027331223300031943SoilITAAFGGKDKKTLYILARGATQADGTEVANAAQVWAIQMIAQGYKGRAK
Ga0310884_1004448513300031944SoilVITGAFGGRDKKTFYILARGATDANGVEVPNAAQVWSIPMQAQGYRNRAK
Ga0310910_1128788223300031946SoilIPTPRGVITCAFGGKNKQTLFILARGATADDGTQVANAAQVWTMPMIAQGYKGRAK
Ga0307416_10016181413300032002RhizosphereLFVLARGATDANGNQVANAAQVYAIDLIAQGYTGRAK
Ga0310902_1022306113300032012SoilRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0310906_1034645113300032013SoilILARGAEAADGTQVANAAQVWVIPMVAQGFKGRAK
Ga0310906_1052173713300032013SoilVAFGGKDKKTLFVLARGATDANGREVANAAQVYAIQMIAQGYKGRAK
Ga0318507_1010127733300032025SoilIGRDGQHLGVIPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNQVANAAQVWSIQMIAQGYTGRAK
Ga0318575_1021386223300032055SoilPTPRGVISCAFGGQDKRTLFVLARGAQDAEGNQVANAAQVWSIQMIAQGYTGRAK
Ga0308173_1116831723300032074SoilAFGGKDRKTLFILARGGTTSKGEELANVAQVWTIPMEAQGYKGRPK
Ga0310890_1073504513300032075SoilRGVITTAFSGKDKKMLYILARGATDANGTEVANAAQVWSIQTIAQGYKGRAK
Ga0310895_1044026923300032122SoilTPRGVITGAFGGKDKKTFYILARGATDANGTEVPNAAQVWSIQMQAQGYKNRAK
Ga0315912_1037849113300032157SoilYVLARGAKDARGAEVANAAQVYGIPMVAEGYRGRPK
Ga0315912_1150202513300032157SoilGGKHKKTFYILARGATDANGTVVPHAAQVWSIQMQAQGYKGRAK
Ga0307470_1125513623300032174Hardwood Forest SoilTCAFGGKDKKTLFILARGAKDANGEEVANAAQVWTIQMIAQGYKGRAK
Ga0307470_1182667013300032174Hardwood Forest SoilGGKNKKTLFILARGGTTSKGEELANVAQVWTIPMEAQGFKGRAK
Ga0307471_10392434913300032180Hardwood Forest SoilFGGADKKTVYVLARGAKSANGEEVANSAQVYAIQMVAQGYKGRAK
Ga0307472_10156104713300032205Hardwood Forest SoilTLGVIQTPRGVITCAFGGKDKKTLFILARGAKDADGMEVANAAQVWTMPVIAQGYKGRAK
Ga0306920_10159609323300032261SoilILARGAMAADGTQVANAAQVWTIPMVAQGYKGRAK
Ga0348332_1005536523300032515Plant LitterILARGAEDANGQQIANAAQVYAIEMITQGYKGRPK
Ga0348332_1194366313300032515Plant LitterGSDKKTLYVLAQGAKDAQGKEVDNAAQVYSIPMIAQGFTKRAK
Ga0335080_1137545313300032828SoilSAAFSGKDKKTLYVLARGAKDQQGNQAANAAQVYAIQMVTAGFKKRAK
Ga0335074_1021176733300032895SoilVSFGGPKRQTLFILARGAEDSSGQQIANAAQVYSIQMIAHGPSTRPK
Ga0335072_1035957023300032898SoilSFGGPKRQTLFILARGAEDSSGQQIANAAQVYSIQMIAHGPSTRPK
Ga0335083_1035738633300032954SoilFSGKYKKTLYILARGAKDQSGAEVANAAQVYAIEMISQGFKKRAK
Ga0335084_1180202913300033004SoilAKDGKNLGVIPTPRGVITCAFGGKDRKTLFILARGGTSSGGEEVANVAQIWSIPMVAQGYKGRAK
Ga0316603_1207154513300033413SoilIPTPRGVITAAFGGKDKKMLYILARGAIDAEGNEVANAAQVYVIQMIAQGYKGRAK
Ga0370515_0166163_699_8423300034163Untreated Peat SoilVAFSGPNKKELYILARGAKDAQGNEVRNAAQVYSISMIAQGFKKRAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.