NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F014742

Metagenome / Metatranscriptome Family F014742

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F014742
Family Type Metagenome / Metatranscriptome
Number of Sequences 260
Average Sequence Length 107 residues
Representative Sequence MKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Number of Associated Samples 206
Number of Associated Scaffolds 260

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 13.95 %
% of genes near scaffold ends (potentially truncated) 55.77 %
% of genes from short scaffolds (< 2000 bps) 99.23 %
Associated GOLD sequencing projects 195
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.231 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(20.769 % of family members)
Environment Ontology (ENVO) Unclassified
(51.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(69.615 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.36%    β-sheet: 0.00%    Coil/Unstructured: 49.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.23 %
UnclassifiedrootN/A0.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1099109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella526Open in IMG/M
3300001355|JGI20158J14315_10098370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1012Open in IMG/M
3300004112|Ga0065166_10326758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella630Open in IMG/M
3300004112|Ga0065166_10327611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300004112|Ga0065166_10516534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella507Open in IMG/M
3300004463|Ga0063356_102868851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M
3300005415|Ga0007743_1296192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300006356|Ga0075487_1293253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia877Open in IMG/M
3300006357|Ga0075502_1508404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea852Open in IMG/M
3300006401|Ga0075506_1592919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea730Open in IMG/M
3300006424|Ga0075497_1284893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella595Open in IMG/M
3300006803|Ga0075467_10286942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea880Open in IMG/M
3300006803|Ga0075467_10729834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300007232|Ga0075183_11024686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea659Open in IMG/M
3300007241|Ga0075170_1425809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella632Open in IMG/M
3300007253|Ga0075182_10854372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300007513|Ga0105019_1145908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1234Open in IMG/M
3300007545|Ga0102873_1123483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea781Open in IMG/M
3300007552|Ga0102818_1034782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella995Open in IMG/M
3300007552|Ga0102818_1079864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella646Open in IMG/M
3300007632|Ga0102894_1076303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea879Open in IMG/M
3300007644|Ga0102902_1157812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea673Open in IMG/M
3300007725|Ga0102951_1102401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella812Open in IMG/M
3300007860|Ga0105735_1123823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila560Open in IMG/M
3300007992|Ga0105748_10393521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila597Open in IMG/M
3300008114|Ga0114347_1253830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia536Open in IMG/M
3300008834|Ga0103882_10098650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300008835|Ga0103883_1019137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
3300008929|Ga0103732_1056078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella606Open in IMG/M
3300008929|Ga0103732_1073394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia532Open in IMG/M
3300008998|Ga0103502_10307849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300009054|Ga0102826_1061749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila905Open in IMG/M
3300009071|Ga0115566_10263594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1027Open in IMG/M
3300009071|Ga0115566_10528348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella666Open in IMG/M
3300009077|Ga0115552_1276318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea674Open in IMG/M
3300009086|Ga0102812_10494718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea668Open in IMG/M
3300009193|Ga0115551_1286307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila722Open in IMG/M
3300009263|Ga0103872_1011472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila928Open in IMG/M
3300009422|Ga0114998_10162942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1070Open in IMG/M
3300009432|Ga0115005_10729044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea796Open in IMG/M
3300009432|Ga0115005_10766362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila776Open in IMG/M
3300009433|Ga0115545_1096069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1077Open in IMG/M
3300009436|Ga0115008_10514648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila856Open in IMG/M
3300009440|Ga0115561_1235966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila686Open in IMG/M
3300009441|Ga0115007_10285951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1069Open in IMG/M
3300009441|Ga0115007_10305301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1033Open in IMG/M
3300009441|Ga0115007_11342529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila502Open in IMG/M
3300009476|Ga0115555_1243200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea733Open in IMG/M
3300009495|Ga0115571_1308944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella628Open in IMG/M
3300009497|Ga0115569_10155431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1092Open in IMG/M
3300009544|Ga0115006_11287130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella656Open in IMG/M
3300009544|Ga0115006_11450818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila619Open in IMG/M
3300009550|Ga0115013_10604536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella732Open in IMG/M
3300009599|Ga0115103_1264912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea783Open in IMG/M
3300009599|Ga0115103_1546921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea911Open in IMG/M
3300009599|Ga0115103_1821290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea986Open in IMG/M
3300009606|Ga0115102_10392767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea712Open in IMG/M
3300009606|Ga0115102_10589658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila931Open in IMG/M
3300009606|Ga0115102_10665967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1041Open in IMG/M
3300009606|Ga0115102_10730365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella627Open in IMG/M
3300009608|Ga0115100_10405293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300009608|Ga0115100_10692858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila954Open in IMG/M
3300009677|Ga0115104_10051696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300009677|Ga0115104_10161795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1013Open in IMG/M
3300009677|Ga0115104_10503208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea928Open in IMG/M
3300009677|Ga0115104_10848645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1041Open in IMG/M
3300009679|Ga0115105_11401772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila615Open in IMG/M
3300009785|Ga0115001_10418503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea835Open in IMG/M
3300010305|Ga0129320_103230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella596Open in IMG/M
3300010305|Ga0129320_131355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300010306|Ga0129322_1056953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea679Open in IMG/M
3300010970|Ga0137575_10034569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella808Open in IMG/M
3300010981|Ga0138316_11635035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella640Open in IMG/M
3300011009|Ga0129318_10156543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300012408|Ga0138265_1034680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea959Open in IMG/M
3300012408|Ga0138265_1213105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1004Open in IMG/M
3300012412|Ga0138266_1372268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella646Open in IMG/M
3300012414|Ga0138264_1240179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila638Open in IMG/M
3300012415|Ga0138263_1227684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea690Open in IMG/M
3300012415|Ga0138263_1618370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila674Open in IMG/M
3300012416|Ga0138259_1104487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea571Open in IMG/M
3300012417|Ga0138262_1556298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella689Open in IMG/M
3300012516|Ga0129325_1142932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea974Open in IMG/M
3300012518|Ga0129349_1301434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300012528|Ga0129352_10851040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M
3300012709|Ga0157608_1177607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300012723|Ga0157604_1038834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella702Open in IMG/M
3300012767|Ga0138267_1142071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila527Open in IMG/M
3300012782|Ga0138268_1470772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea572Open in IMG/M
3300012782|Ga0138268_1722416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea968Open in IMG/M
3300012952|Ga0163180_11246728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella609Open in IMG/M
3300012954|Ga0163111_10594822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1032Open in IMG/M
3300012954|Ga0163111_11314317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila710Open in IMG/M
3300012963|Ga0129340_1166876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea615Open in IMG/M
3300012967|Ga0129343_1094631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300013295|Ga0170791_13233385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella640Open in IMG/M
3300016758|Ga0182070_1191611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella564Open in IMG/M
3300016781|Ga0182063_1001669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella546Open in IMG/M
3300016787|Ga0182080_1503764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea636Open in IMG/M
3300017709|Ga0181387_1059398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea765Open in IMG/M
3300017818|Ga0181565_10674068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella658Open in IMG/M
3300017952|Ga0181583_10306576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1009Open in IMG/M
3300018025|Ga0187885_10275452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella765Open in IMG/M
3300018423|Ga0181593_10715764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila708Open in IMG/M
3300018599|Ga0188834_1010908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea931Open in IMG/M
3300018619|Ga0188877_1012305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea729Open in IMG/M
3300018628|Ga0193355_1024627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella572Open in IMG/M
3300018730|Ga0192967_1039271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea791Open in IMG/M
3300018762|Ga0192963_1076186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300018871|Ga0192978_1033635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella960Open in IMG/M
3300018871|Ga0192978_1054143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300018871|Ga0192978_1083009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella586Open in IMG/M
3300018874|Ga0192977_1051527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea837Open in IMG/M
3300018874|Ga0192977_1095494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella593Open in IMG/M
3300018947|Ga0193066_10132402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella729Open in IMG/M
3300018980|Ga0192961_10089251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella928Open in IMG/M
3300018989|Ga0193030_10190035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella675Open in IMG/M
3300018989|Ga0193030_10291569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella530Open in IMG/M
3300019010|Ga0193044_10177720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300019021|Ga0192982_10180001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea749Open in IMG/M
3300019027|Ga0192909_10022859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1086Open in IMG/M
3300019027|Ga0192909_10263572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella534Open in IMG/M
3300019031|Ga0193516_10106576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella954Open in IMG/M
3300019048|Ga0192981_10124505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1017Open in IMG/M
3300019048|Ga0192981_10270924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella643Open in IMG/M
3300019051|Ga0192826_10336994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300019123|Ga0192980_1029178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1050Open in IMG/M
3300019123|Ga0192980_1088528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila558Open in IMG/M
3300019131|Ga0193249_1147556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella503Open in IMG/M
3300019133|Ga0193089_1109199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella644Open in IMG/M
3300019133|Ga0193089_1117438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella613Open in IMG/M
3300019146|Ga0188881_10034337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella631Open in IMG/M
3300019149|Ga0188870_10051984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella994Open in IMG/M
3300019149|Ga0188870_10057712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella946Open in IMG/M
3300019201|Ga0180032_1034294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea800Open in IMG/M
3300020159|Ga0211734_10779448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1012Open in IMG/M
3300020165|Ga0206125_10247054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella680Open in IMG/M
3300020193|Ga0194131_10173110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1041Open in IMG/M
3300020221|Ga0194127_10770679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300020372|Ga0211683_10161853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella718Open in IMG/M
3300020566|Ga0208222_1063970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella633Open in IMG/M
3300020578|Ga0194129_10456885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea647Open in IMG/M
3300020595|Ga0206126_10154693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1090Open in IMG/M
3300021169|Ga0206687_1438718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300021169|Ga0206687_1765840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea613Open in IMG/M
3300021345|Ga0206688_10350322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea965Open in IMG/M
3300021345|Ga0206688_10986774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila505Open in IMG/M
3300021350|Ga0206692_1578318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300021350|Ga0206692_1749130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila636Open in IMG/M
3300021355|Ga0206690_10441289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella598Open in IMG/M
3300021359|Ga0206689_10064881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila663Open in IMG/M
3300021365|Ga0206123_10149825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1069Open in IMG/M
3300021376|Ga0194130_10355988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea792Open in IMG/M
3300021378|Ga0213861_10306684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea813Open in IMG/M
3300021847|Ga0210305_1114457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300021872|Ga0063132_114806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea913Open in IMG/M
3300021872|Ga0063132_146216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea576Open in IMG/M
3300021894|Ga0063099_1040363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila616Open in IMG/M
3300021913|Ga0063104_1088297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila510Open in IMG/M
3300021922|Ga0063869_1066019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea758Open in IMG/M
3300021941|Ga0063102_1010353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea642Open in IMG/M
3300021941|Ga0063102_1013188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila554Open in IMG/M
3300021941|Ga0063102_1052606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila568Open in IMG/M
3300021942|Ga0063098_1158292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila517Open in IMG/M
3300021950|Ga0063101_1000129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea929Open in IMG/M
3300021950|Ga0063101_1065840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella661Open in IMG/M
3300021950|Ga0063101_1090084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300021957|Ga0222717_10441243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea712Open in IMG/M
3300022905|Ga0255756_1296016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella519Open in IMG/M
3300023087|Ga0255774_10309389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300023110|Ga0255743_10388810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila692Open in IMG/M
3300023685|Ga0228686_1018858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea929Open in IMG/M
3300023706|Ga0232123_1076734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300024343|Ga0244777_10269980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1079Open in IMG/M
3300024563|Ga0255236_1158569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300025640|Ga0209198_1163822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea603Open in IMG/M
3300025680|Ga0209306_1122348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea757Open in IMG/M
3300025699|Ga0209715_1098652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1084Open in IMG/M
3300025880|Ga0209534_10429580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella562Open in IMG/M
3300025881|Ga0209309_10293201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300025890|Ga0209631_10372565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea668Open in IMG/M
3300025897|Ga0209425_10211652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1027Open in IMG/M
3300026468|Ga0247603_1075051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila691Open in IMG/M
3300026470|Ga0247599_1099475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300026495|Ga0247571_1058300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella876Open in IMG/M
3300026504|Ga0247587_1177852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella521Open in IMG/M
3300026513|Ga0247590_1151137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella595Open in IMG/M
3300027193|Ga0208800_1034511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella681Open in IMG/M
3300027203|Ga0208925_110456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella671Open in IMG/M
3300027320|Ga0208923_1056123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella699Open in IMG/M
3300027720|Ga0209617_10232313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea703Open in IMG/M
3300027720|Ga0209617_10378107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300027805|Ga0209229_10219350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella850Open in IMG/M
3300027810|Ga0209302_10172224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1049Open in IMG/M
3300027833|Ga0209092_10283632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella901Open in IMG/M
3300027833|Ga0209092_10309101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila853Open in IMG/M
3300027833|Ga0209092_10456192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella660Open in IMG/M
3300027849|Ga0209712_10542750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella649Open in IMG/M
3300028110|Ga0247584_1122321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella648Open in IMG/M
3300028134|Ga0256411_1110726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella929Open in IMG/M
3300028134|Ga0256411_1241634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila558Open in IMG/M
3300028137|Ga0256412_1109548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1007Open in IMG/M
3300028137|Ga0256412_1126889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea936Open in IMG/M
3300028279|Ga0228613_1090848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila718Open in IMG/M
3300028282|Ga0256413_1205479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
(restricted) 3300028559|Ga0247831_1248380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella624Open in IMG/M
3300028575|Ga0304731_10533438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella640Open in IMG/M
3300029955|Ga0311342_11284236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
3300030551|Ga0247638_1036588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella884Open in IMG/M
3300030621|Ga0247655_10030255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea975Open in IMG/M
3300030670|Ga0307401_10174457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella965Open in IMG/M
3300030670|Ga0307401_10484464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella563Open in IMG/M
3300030699|Ga0307398_10254615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea944Open in IMG/M
3300030699|Ga0307398_10281093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea900Open in IMG/M
3300030699|Ga0307398_10440135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300030702|Ga0307399_10288495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella779Open in IMG/M
3300030709|Ga0307400_10810380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300030743|Ga0265461_12364353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella621Open in IMG/M
3300030788|Ga0073964_11516973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea615Open in IMG/M
3300030799|Ga0074010_10335018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300030840|Ga0074020_10529043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella818Open in IMG/M
3300030979|Ga0068589_11535426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella593Open in IMG/M
3300031036|Ga0073978_1628492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea838Open in IMG/M
3300031051|Ga0074029_1497697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella533Open in IMG/M
3300031231|Ga0170824_116564986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella583Open in IMG/M
3300031522|Ga0307388_10853071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea613Open in IMG/M
3300031621|Ga0302114_10254185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella710Open in IMG/M
3300031622|Ga0302126_10295193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300031658|Ga0307984_1123462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella737Open in IMG/M
3300031674|Ga0307393_1108598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila608Open in IMG/M
3300031710|Ga0307386_10216021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea932Open in IMG/M
3300031717|Ga0307396_10447625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300031722|Ga0311351_10453080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella973Open in IMG/M
3300031734|Ga0307397_10241115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea809Open in IMG/M
3300031735|Ga0307394_10128606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea973Open in IMG/M
3300031735|Ga0307394_10321555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella616Open in IMG/M
3300031735|Ga0307394_10395139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella553Open in IMG/M
3300031738|Ga0307384_10379650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila656Open in IMG/M
3300031739|Ga0307383_10230386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea881Open in IMG/M
3300031739|Ga0307383_10250449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella847Open in IMG/M
3300032169|Ga0257195_10142253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella753Open in IMG/M
3300032470|Ga0314670_10238505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea928Open in IMG/M
3300032470|Ga0314670_10714449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella512Open in IMG/M
3300032481|Ga0314668_10253911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea905Open in IMG/M
3300032521|Ga0314680_10299262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila975Open in IMG/M
3300032521|Ga0314680_10588147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella703Open in IMG/M
3300032650|Ga0314673_10612520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella560Open in IMG/M
3300032651|Ga0314685_10452585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella709Open in IMG/M
3300032666|Ga0314678_10299404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella723Open in IMG/M
3300032708|Ga0314669_10140602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1170Open in IMG/M
3300032725|Ga0314702_1238552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella694Open in IMG/M
3300032739|Ga0315741_10905137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea779Open in IMG/M
3300032746|Ga0314701_10335684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila686Open in IMG/M
3300032754|Ga0314692_10535716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella627Open in IMG/M
3300032756|Ga0315742_10681535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella932Open in IMG/M
3300033572|Ga0307390_10772240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300034166|Ga0335016_0275439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1045Open in IMG/M
3300034280|Ga0334997_0295838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1045Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.77%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.38%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.38%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.62%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.23%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine4.23%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.46%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.54%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.54%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.15%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.15%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.15%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.15%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.77%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.77%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.77%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.38%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.38%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.38%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.38%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.38%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.38%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.38%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.38%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.38%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.38%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.38%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.38%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.38%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.38%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.38%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.38%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005415Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007232Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007241Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007253Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010305Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012723Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016758Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071403BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016787Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071411AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018619Metatranscriptome of marine microbial communities from Baltic Sea - GS855_ls4EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020372Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021847Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022905Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaGEnvironmentalOpen in IMG/M
3300023087Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024563Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027203Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030799Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031051Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032169Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_109910923300000736Freshwater And SedimentRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
JGI20158J14315_1009837023300001355Pelagic MarineMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAQAIDNETYKRAMTISDYNQGRSVSDLEVKDWSFGHPKNLRSESTW*
Ga0065166_1032675813300004112Freshwater LakeMTLRPNFIPRGCIKEIRTYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGK
Ga0065166_1032761123300004112Freshwater LakeMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSDLKLKT
Ga0065166_1051653413300004112Freshwater LakeENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCSSKKGADHCLNDKINVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKDRSVSDL*
Ga0063356_10286885113300004463Arabidopsis Thaliana RhizosphereMTLIPNFIPRGCYREIRKYQMCADSKGADACLNEKISIMEVCPDHVLDSLKEKKKWYLRAEVIDNETYKRAMSVGEYNKGRSVSDLKLKTWEYGKGGRLRSDSTW*
Ga0007743_129619213300005415Freshwater LakeMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTA
Ga0075487_129325313300006356AqueousMMQSKYMVLKPNMIPRGCYREIRKYNACAISNGRDNCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLNIKDWTFGHPNNLRSDSTW*
Ga0075502_150840423300006357AqueousMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVSDLKLKTWDYGKTANLRSDSLW*
Ga0075506_159291913300006401AqueousMTLQPNQIPRGCYREIRKYQACASAAGKEACLNEKISIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMTIGDYNKGKSIADLDIKNWSFGLPRNLRSESTW*
Ga0075497_128489323300006424AqueousPDRKNKTLGHKSGSMCQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNKSRSVSDL*
Ga0075467_1028694223300006803AqueousMKLTGERIPRGCYKEIRNYKQCAAKNSEETCFNDKISIMEVCPDHVLEGLREQKKWYLRAEVIDNETYKRAMVVGDYNKGRSVTDLKLKTWAYGKAKNLRSDSNW*
Ga0075467_1072983423300006803AqueousDDWYPDRKGKTLGHKNGGACNPNMKNSKFMTLQPNMIPKGCYREIRKYQACAANSGKEACLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKNRSVSDLHIKDWSYGHPKNMRSDSTW*
Ga0075183_1102468623300007232Wastewater EffluentGHKNGGFGDNTRRQSKYMALRFDQIPRGCQRQIQYFQRCTQEKGEGNCFQQKIDIMEVCPDHVLEGLREKKKHMLRAEVIDNQTYRRAMEVSDYNRGRSVSDL*
Ga0075170_142580913300007241Wastewater EffluentMTLTPSFIPRGCYKEIRKYQLCSSKNGKEACLNDKLSIMEVCPEHVLEGLREKKKWHLRAEVIDNDTYKRAMQVSDYNRGRSVTDLKLKTWEHGKAGYLRSDTYWQDDR
Ga0075182_1085437213300007253Wastewater EffluentFDQIPRGCQRQIQYFQRCTQEKGEGNCFQQKIDIMEVCPDHVLEGLREKKKHMLRAEVIDNQTYRRAMEVSDYNRGRSVSDL*
Ga0105019_114590813300007513MarineMNSKYMVLKPNFIPKGCYREIRKYNACATASGKENCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLDIKDWSFGSPKNLRGDSTW*
Ga0102873_112348323300007545EstuarineMKNSKFMTLQPNMIPKGCYREIRKYQACAANSGKEACLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKGRNVSDLEIKDWSFGHPKNMRSDSTWQDDRYDPIKYPHPHRYDNVNF
Ga0102818_103478223300007552EstuarineLNGIQSKYLALKPSEIPRGCYREIRKYQTCAKDQGSEQCANEKISIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMTVSDYNKGRSVTDLEVKDWSYGHPKNMRSDSTW*
Ga0102818_107986423300007552EstuarineLKPSEIPKGCYREIRKYQSCAADKGTGNCSNEKISIMEVCPDHVLEGLRERRKWFMRAEAIDNATYKRAMSVSDYNKNRSVSDLELKDWSFGHPRNLRSDSVW*
Ga0102894_107630323300007632EstuarineMKNSKFMTLQPNMIPKGCYREIRKYQACAANSGKEACLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKGRNVSDLELRPPEEHEV*
Ga0102902_115781223300007644EstuarineMKNSKFMTLQPNMIPKGCYREIRKYQACAANSGKEACLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKGRNVSDLEIKD
Ga0102951_110240123300007725WaterMKNSKYMTLVPQMIPRGCYREIRKFQSCQSSGKDAAVCQDQKLNIMEVCPDHILEGLREKKKWFARAETIDNETYRRAMQVSDYNRNRSVSQLTLKTWEFGD*
Ga0105735_112382313300007860Estuary WaterMNIPKGCFREIRNYHLAKNNSSPEASFQEKINIMEVCPDHVLEALREKKKHYLRAEAIDNETYKRAMSVSDFNKGRSVSELKLKTWDYGKHLRTDTYF*
Ga0105748_1039352113300007992Estuary WaterMKNSKFMTLQPNYIPKGCYREIRKYQACSSASGQDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLKIKDWSYGHPKNLRTDTTWEDDRYNPRKYPHPHRYDNV
Ga0114347_125383013300008114Freshwater, PlanktonMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSLWQDD
Ga0103882_1009865023300008834Surface Ocean WaterMKNSKYMTLVPNWIPRGCYREIRKFQMCSARNPDNAAEVCLNDKISIMEVCPEHILEALREKKKHMLRAEVIDNETYRRAMQVGEYARNRSVSDLTLKTWAHGKTLRTETAYSDSRYNPTEYSH
Ga0103883_101913723300008835Surface Ocean WaterMKNSKYMTLVPNWIPRGCYREIRKFQMCSARNPDNAAEVCLNDKISIMEVCPEHILEALREKKKHMLRAEVIDNETYRRAMQVGEYNRNRSVSDLTLKTWAHGKTLRTETAY*
Ga0103732_105607823300008929Ice Edge, Mcmurdo Sound, AntarcticaKFMTLQPQFIPKGCYREIRKYQAAQSLEAKISIMEVCPDHVLEGLREKRKWYLRAQTIDNQTYKRAMTIADYNKGRSVADLEIKDWSYGNPKNLRSDSTW*
Ga0103732_107339413300008929Ice Edge, Mcmurdo Sound, AntarcticaMRTSKYMTLRPSYIPRGCYKEIRKYQQCAEKEGAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWDYGKAKNLRSDSIW*
Ga0103502_1030784923300008998MarineMKNSKYMTLQHNMIPKGCLREIRRFQACAGDASQSAAACQDKKLSIMEVCPNHILEGLAEKKKWYARAEVIDNETYRRAMEVSDFNR
Ga0102826_106174913300009054EstuarineMKQSKFMALQPQFIPKGCYREIRKYQACTAEAGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115566_1026359423300009071Pelagic MarineMKQSKYMTLQPNFIPKGCFREIQKYQACAASSGKEACFNDKISIMEVCPDHVLEGLREKRKWMLRAEAIDNQTYKRAMTVSSYNMGRSVSDLDVKSWEHGHPKNMRSDSTW*
Ga0115566_1052834833300009071Pelagic MarineKFMTLQPQFIPKGCYREIRKYQAAQTLEAKISIMEVCPDHVLEGLREKRKWYLRAQTIDNQTYKRAMTIADYNKGRSVADLEIKDWSYGNPKNLRSDSTW*
Ga0115552_127631823300009077Pelagic MarineMKQSKYMTLQPNFIPKGCFREIQKYQACAASSGKEACFNDKISIMEVCPDHVLEGLREKRKWMLRAEAIDNQTYKRAMTVSSYNMGRSVSDLDVKSWEH
Ga0102812_1049471813300009086EstuarineMKNSKFMTLQPNMIPKGCYREIRKYQACAANSGKEACLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKGRNVSDL
Ga0115551_128630713300009193Pelagic MarineMKNSKFMTLQPNYIPKGCYREIRKYQACSSASGQDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLEIKDWSYGHP
Ga0103872_101147213300009263Surface Ocean WaterMKNSKFMTLQPNYIPKGCYREIRKYQACSSANGQEACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLEIKDWSYGHPKNLRTDTSWEDDRYNPRKYPHPHRYDNVNFPE*
Ga0114998_1016294233300009422MarineMKQSKFMTLQPQFIPKGCYREIRKYQAAQTLEAKISIMEVCPDHVLEGLREKRKWYLRAQTIDNQTYKRAMTIADYNKGRSVADLEIKDWSYGNPKNLRADSTW*
Ga0115005_1072904413300009432MarineMALQPQFIPKGCYREIRKYQACTAEAGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRTESTW*
Ga0115005_1076636213300009432MarineMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115545_109606923300009433Pelagic MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNKSRSVSDL*
Ga0115008_1051464813300009436MarineMVLKPNFIPKGCYREIRKYNVCATANGKDNCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLEIKDWTFGHPKNLRSDSTW*
Ga0115561_123596613300009440Pelagic MarineMKNSKFMTLQPNYIPKGCYREIRKYQACSSASGQDACFNEKISIMEVCPDHVLEGPREKRKWFLRAEAIDNKTYKRAMTVSDNNKGKSVS
Ga0115007_1028595113300009441MarineMKQSKFMALQPQFIPKGCYREIRKYQACTAGASKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115007_1030530113300009441MarineMTLHPTFIPRGCYKEIRKYQQCANKTNKEACLPEKISIMEVCPEHTLEQLREKKKWWLRAQSIDNETYKRAMTVSDFNRGRSVSDLQLKTWAFGKTLRSESTYEDDRYHPVSNKHNHRYDN*
Ga0115007_1134252913300009441MarineMVLKPNFIPKGCYREIRKYNACATANGKDNCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLEIKDWTF
Ga0115555_124320013300009476Pelagic MarineMKQSKFMTLQPNFIPKGCYREIRKYQACTAAAEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVSELDIKNWAYGHPRN
Ga0115571_130894423300009495Pelagic MarineMTLQPNFIPKGCYREIRKYQACAASAGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVADLDIKNWAYGHPKNLRSGTTWEDDRYNPRKYPHPHRYD
Ga0115569_1015543133300009497Pelagic MarineMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQSCAATAGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNEGKSVSDLEIKNWAYGHPKNLRTETTW*
Ga0115006_1128713023300009544MarineMTLQPNFIPKGCYREIRKYQACAASAGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYHKGRSVADLDIKNWAYGHPKNLRSGTTWEDDRYNPRKYPHPHRYDNVNFPDQE
Ga0115006_1145081813300009544MarinePKGCYREIRKYQACTAGASKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115013_1060453623300009550MarineMQSKYMVLKPNFIPRGCYREIRKYNACAGSNGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLNIKDWTFG
Ga0115103_126491223300009599MarineMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNETYRRAMSVGEYNKTRSVSDLTLKTWAHGKTLRTESAY*
Ga0115103_154692113300009599MarineMKQTKFMALQPNFIPRGCYREIRKYQSCAAENSDSCVNEKISIMEVCPDHVLEALREKRKWYLRAEAIDNQTYKRAMKVSDYNKGRSVADLECKDWSYGHPKNLRSTSTW*
Ga0115103_182129023300009599MarineMKNSKYMTLVPNFIPRGCYKEIRKYQMCAANANGDASVCVNDKVSIMEVCPEHILEGLREKKKWMLRAEVIDNETYKRAMTVGDYNRNRSVSDLEMKTWEHGKNLRSDSTW*
Ga0115102_1039276723300009606MarineMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQISDYNKGRSVQDLDIKSWAYGHPKNLRSGTTWEDDRYNPQKYPHPHR
Ga0115102_1058965813300009606MarineMKQSKFMALQPQFIPKGCYREIRKYQACTAGASKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTIGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115102_1066596723300009606MarineMQSKYMVLKPNMIPRGCYREIRKYNACASSNGRDNCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLNIKDWTFGHPNNLRSDSTW*
Ga0115102_1073036513300009606MarineYMTLVPNFIPRGCYREIRKFQMCSAKNSGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNRNRSVSDLELKTWAHGKTLRTESAW*
Ga0115100_1040529313300009608MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNSGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNRNRSVSDL*
Ga0115100_1069285813300009608MarineMKQSKFMALQPQFIPKGCYREIRKYQACTAGANKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTIGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115104_1005169623300009677MarineMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMQVSDFNKNRSVSDLTLKTWEHGKAKNLRSDSLWQDDRYNPTKYS
Ga0115104_1016179523300009677MarineMMQSKYMVLKPNFIPRGCYREIRKYNACAGSNGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNCGRSVSDLDIKDWTFGHPNNLRSDSTW*
Ga0115104_1050320823300009677MarineMNPNMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115104_1084864513300009677MarineMVLKPNMIPRGCYREIRKYNACSSANGKDNCVNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNNGRSVSDLEIKDWTFGHPKNLRSDSTW*
Ga0115105_1140177213300009679MarineIPKGCYREIRKYQGCATSKGAAECLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNETYKRAMTVGDYNKGRSVSDVDMKDWSYGHPKNLRSDSTW*
Ga0115001_1041850323300009785MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNSGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNKNRSVTDLELKTWAHGKTLRTESAW*
Ga0129320_10323023300010305AqueousMKNSKFMTLRPNFIPRGCYKEIRSYQLCVAKSSADACFADKISIMEVCPDHVLELLREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLQLKTW
Ga0129320_13135513300010305AqueousMKESKYMTLRPNYIPRGCYKEIRKYQICAAKSSAEHCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSSFNKGRSVTDLKLKTWDWGKTANLRSDSFW*
Ga0129322_105695323300010306AqueousMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQISDYNKGRSVQDLDIKSWAYGHPKNLRSGTTWEDDRYNP
Ga0137575_1003456913300010970Pond Fresh WaterMGMIATSSSAFGFLRMDLSGSWWLSIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVTDLKLKTWEYGKGANLRSDSVW*
Ga0138316_1163503513300010981MarineMKQSKFMALQPQFIPKGCYREIRKYQTCAAASGKDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNKGRSVSDLEIKDWSFGHPKNM
Ga0129318_1015654323300011009Freshwater To Marine Saline GradientMPRGCYKEVRSYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSD
Ga0138265_103468023300012408Polar MarineMKQSKFMALQPQYIPKGCYREIRKYQACAAGSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMVVGDYNKGKSVSDLDVKDWSFGHPRNLRTDSTW*
Ga0138265_121310523300012408Polar MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNKEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLSLKTWAHGKTLRTESGY*
Ga0138266_137226813300012412Polar MarinePNFIPRGCYREIRKFQMCSAKNAGNKEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLSLKTWAHGKTLRTESGY*
Ga0138264_124017913300012414Polar MarineMKQSKFMALQPQYIPKGCYREIRKYQACAAGSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMVVGDYNKGKSVSDLDVKDWSFGHPRN
Ga0138263_122768413300012415Polar MarineHDDWLPDRKNKTLGHKNGSQINPNMKQSKFMTLQPQFIPKGCYREIRKYQAAQSLEAKISIMEVCPDHVLEGLREKRKWYFRAQTIDNQTYKRAMTIADYNKGRSVADLEIKDWSYGNPKNLRSDSTW*
Ga0138263_161837013300012415Polar MarineMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVSDLDIKSWAYGHPKNLRTGTTW*
Ga0138259_110448713300012416Polar MarineMKQSKFMTLQPQFIPKGCYREIRKYQAAQSLEAKISIMEVCPDHVLEGLREKRKWYLRAQTIDNQTYKRAMTIADYNKGRSVAD
Ga0138262_155629813300012417Polar MarineMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGDYNKGRSVSDLDVKDWSFGHPRNLRTESTW*
Ga0129325_114293223300012516AqueousMKQSKYMTLQPNFIPKGCFREIQKYQACASANGKEACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSSYNMGRSVSDLDVKSWEYGHPKNMRSDSTW*
Ga0129349_130143413300012518AqueousMKQSKFMTLQPNFIPKGCYREIRKYQACAASAGKDSCFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVSDLEIKNWAYGHPKNL
Ga0129352_1085104023300012528AqueousMSLKPDFAPRGCAKEIRKYQQCASEKGASSCFNEKIDIMEVCPDHVLEGLREKKKWTLRAEMIDNDTYKRAMQVSDFNVGRSVSDLKLKTWEYGKSCNLRGDG
Ga0157608_117760713300012709FreshwaterMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTW
Ga0157604_103883413300012723FreshwaterMCVAKSSADACFTEKISIMEVCPDHVLEGLREKKKWYLCAEMIDNDTYKRAMTVSDFNKHRSVSDLKLKTWDYGKTANLRSDSIW*
Ga0138267_114207113300012767Polar MarineNMKQSKFMALQPQYIPKGCYREIRKYQACAAGSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMVVGDYNKGKSVSDLDVKDWSFGHPRSLRTDSTW*
Ga0138268_147077213300012782Polar MarineRKYQACAAGSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGDYNKGRSVSDLDVKDWSFGHPRNLRTESTW*
Ga0138268_172241623300012782Polar MarineMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSEYNAGKSVSDLEIKNWAYGHPKNLRS*
Ga0163180_1124672813300012952SeawaterMVLKPNFIPKGCYREIRKYNACATASGKENCMSEKISIMEVCPEHVLEGLREKRKWFLRAEAIDNQTYKRAMEVSDYNRGKSVSDLDIKDWSYGHPKNLRSESTW*
Ga0163111_1059482223300012954Surface SeawaterMTLQPNYIPKGCYREIRKYQACAASAGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGKSVSDLEIKSWAYGHPKNLRT*
Ga0163111_1131431713300012954Surface SeawaterMVQPNMKQSKFMTLQPNFIPKGCYREIRKYQACAASQGKDACFNDKLGIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGRSVSDLDIKNWAYGHPKNLRSGTTWEDDRYNPRKYPHP
Ga0129340_116687623300012963AqueousMTLQPNFIPKGCYREIRKYQACAASAGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVSDLEIKNWAYGHPKNLRSG
Ga0129343_109463123300012967AqueousMTLQPNFIPKGCYREIRKYQACAASAGKDSCFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVSDLEIKNWAYGHPKNLRSGTTWEDDRYNPRKY
Ga0170791_1323338513300013295FreshwaterLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
Ga0182057_139053713300016732Salt MarshAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0182070_119161123300016758Salt MarshCYREIRKYQACTAEKNKDACFNEKISIMEVCPQHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNRGRSVSDLTIKDWSFGDPTNLRSESTW
Ga0182063_100166913300016781Salt MarshNMKQSKFMALQPQYIPRGCYREIRKYQACSASNGRQNCMNEKISIMEVCPDHVLEGLRERRKWSLRAESIDNETYKRAMTVGDYNKGRSVSDLHIKDWSFGSARNLRSDSTW
Ga0182080_150376423300016787Salt MarshMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACASASGADSCFNEKISIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMTVSDYNKGRSVGDLDVKDWSYGHPRNLRTDTTWEDD
Ga0181387_105939823300017709SeawaterMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMKVSDFNMERSVSDLKLKTWDYGKTANLRSDSLWQDDKYDPTK
Ga0181565_1067406823300017818Salt MarshTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0181583_1030657623300017952Salt MarshMKSSKYMTLRPNMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMEVSDFNKNRSVSDL
Ga0187885_1027545213300018025PeatlandMKFSKYMTLIPNFIPRGCYKEIRKFQLCSSRRGADNCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLTLKTWEHGKGGNLRSDTVW
Ga0181593_1071576413300018423Salt MarshRKGKTLGHKNGGMCNPNMKNSKFMTLQLNMIPRGCYREIRKYQSCAANNGKDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKDWSFGHPRNLRSDSAW
Ga0188834_101090823300018599Freshwater LakeMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVSDLKLKTWDYGKTANLRSDSLW
Ga0188877_101230513300018619Freshwater LakeMCNPNMKNSKFMTLQPNMIPKGCYREIRKYQACAANSGKEACLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKGRNVSDLEIKDWSFGHPKNMRSDSTWQD
Ga0193355_102462713300018628MarineQYQKCVDQNGKDKCFADKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKRAMQVSDFNKDRSVSDLKLKTWDHGKTANMRSDSLW
Ga0192967_103927123300018730MarineMTLQPNYIPKGCYREIRKYQECAASSGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGKSVADLEIKSWSYGHPKNLRTTTTW
Ga0192963_107618623300018762MarineMTLVPQQIPRGCYREIRKFQACNSANGAANQVCKDQKLSIMEVCPDHVLEGLREKKKWFARAETIDNETYRRAMQVSDYNRGRSVSDLSLKTWTFGENLRSDSYYEDNRYDPM
Ga0192978_103363513300018871MarineMTQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNSGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNRNRSVSDLDLKTWAHGKSLRTESAY
Ga0192978_105414313300018871MarineMALQPQFIPKGCYREIRKYQACTAESGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGGYNKGRSVSDLDVKDWSFGHPRNLRSDSTW
Ga0192978_108300923300018871MarineMALQPNYIPRGCYREIRKYQACSTANGKAACLNEKISIMEVCPDHVLEGLRERRKWTLRAEAIDNETYKRAMQVASYNQGRSVSDLKIKDWSHGSAANMRGENTW
Ga0192977_105152723300018874MarineMALQPQYIPKGCYREIRKYQSCAGAQGKDKCFNEKISIMEVCPDHILEGLRERRKWYLRAEAIDNETYKRAMTVGDYNRGRSVTDLDVKDWSFGHPRNLRSESTW
Ga0192977_109549413300018874MarineMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSEYNAGKSVSDLEIKNWAYGHPKNLRS
Ga0193066_1013240213300018947MarineKQGGMNQPNMKNSKYMTLIPNFMPRGCYREVRKYQECAATVGKEFEKCVQQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMQPQIRHPVPG
Ga0192961_1008925123300018980MarineMKQSKFMALQPQMIPKGCYREIRKYQSCTANSGKDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNQGRSVSDLDVKDWSFGHPKNLRSESTW
Ga0193030_1019003513300018989MarineMGMVLRPNYIPKGCYREIRAYQACANSKGKDQCMNEKISIMEVCPDHVLEALREKRKWFLRAEAIDNETYKRAMTVGDYNKGKSVSDLTIRDWSHGDPRNMRSDSTW
Ga0193030_1029156923300018989MarineLKPNFIPKGCYREIRKYNACATASGKENCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMAVSDYNKGKSVSDLEIKDWSFGHPTKLRSDSTW
Ga0193044_1017772023300019010MarineMTLQPNYIPKGCYREIRKYQACAASEGKEACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGKSVSDLEIKSWAYGHPKNLRT
Ga0192982_1018000123300019021MarineMKQSKFMALQPQYIPKGCYREIRKYQACAAGSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMVVGDYNKGKSVSDLDVKDWSFGHPRNLRTDSTW
Ga0192909_1002285913300019027MarineMVLRPNYIPKGCYREIRAYQACANSKGKDQCMNEKISIMEVCPDHVLEALREKRKWFLRAEAIDNETYKRAMTVGDYNKGKSVSDLTIRDWSYGDPRSMRSDSTW
Ga0192909_1026357223300019027MarineMTLRANQIPRGCYKQILQYQKCVAKDGDACFEKKIDIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNKSRSVSDLKLKTWDYGKTANMRSDSLW
Ga0193516_1010657613300019031MarineMTLRPNNIPKGCFREIKNYQNCSAGKGKDNCFNEKLSIMEVCPDHILEGLREKRKWFLRAEAIDNETYKRAMTVSDYNKGRSVSDLNIKDWSYGHPHNLHSDSVW
Ga0192981_1012450523300019048MarineMTLVPNFIPRGCYKEIRKYQMCAANANGDAQACVNDKVSIMEVCPEHILEGLREKKKWMLRAEVIDNETYKRAMAVGDYNRNRSVSDLDLKTWEHGKNLRSDSTW
Ga0192981_1027092423300019048MarineNMKQSKFMALQPQYIPKGCYREIRKYQSCAGAQGKDKCFNEKISIMEVCPDHILEGLRERRKWYLRAEAIDNETYKRAMTVGDYNRGRSVTDLDVKDWSFGHPRNLRSESTW
Ga0192826_1033699413300019051MarineMMQSKYMVLKPNMIPRGCYREIRKYNACASANGKDNCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLHIKDWTFGHPNNMRSDSTW
Ga0192980_102917823300019123MarineMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGDYNKGRSVSDLDVKDWSFGHPRNLRTESTW
Ga0192980_108852813300019123MarineANPNMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0193249_114755613300019131MarineFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNEGKSVSDLEIKNWAYGHPKNLRS
Ga0193089_110919913300019133MarineMIPRGCYKEIRNYQKCVDNSSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVTDLKLKTWDYGKTANLKSDSLW
Ga0193089_111743823300019133MarineLQPQFIPKGCYREIRKYQAAQTLEAKISIMEVCPDHVLEGLREKRKWYLRAQTIDNQTYKRAMTIADYNKGRSVADLEIKDWSYGHPKNMRADSTW
Ga0188881_1003433713300019146Freshwater LakeRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVSDLKLKTWDYGKTANLRSDSLW
Ga0188870_1005198413300019149Freshwater LakeMMQSKYMVLKPNMIPRGCYREIRKYNACASSNGRDNCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLNIKDWTFGHPNNLRSDSTW
Ga0188870_1005771223300019149Freshwater LakeMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAQAIDNETYKRAMTISDYNQGRSVSDLEVKDWSFGHPKNLRSESTW
Ga0180032_103429423300019201EstuarineMCVAKSSADACFTEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLKLKTWDYGKTANLRSDSIW
Ga0211734_1077944823300020159FreshwaterMTLRPNYIPRGCYKEIRKYQMCAAKNSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDFNKGRSVSDLKLK
Ga0206125_1024705413300020165SeawaterNMKQSKFMALQPQFIPKGCYREIRKYQACTAEAGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRTESTW
Ga0194131_1017311033300020193Freshwater LakeMKSSKFMTLRPNFIPRGCYKEIRKYQQCAAKSGSEACFGDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVSDL
Ga0194127_1077067923300020221Freshwater LakeMTLRPNFIPRGCYKEIRKYQQCAAKSGSEACFGDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVSDL
Ga0211683_1016185323300020372MarineMCQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNKEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLHLKTWAHGKTLRTESGY
Ga0208222_106397023300020566FreshwaterGCFREIRQYHLCKDKSNPEACFQEKINIMEVCPDHILEGLREKKKHFLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKTWDYGKHLRSDSYY
Ga0194129_1045688513300020578Freshwater LakeMKSSKFMTLRPNFIPRGCYKEIRKYQQCAAKSGSEACFGDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDYNRGRSVSDL
Ga0206126_1015469313300020595SeawaterMKQSKFMALQPQFIPKGCYREIRKYQACTAEAGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRTESTW
Ga0206687_143871813300021169SeawaterMTLKHNMIPRGCYKEIRTYQHCVARTGSKDECFSDKISIMEVCPDHVLEALREKKKWFLRAEMIDNDTYKRAMQVSDFNKDRSVSD
Ga0206687_176584023300021169SeawaterMTLVPNFIPRGCYKEIRKYQMCAANANGDAQACVNDKVSIMEVCPEHILEGLREKKKWMLRAEVIDNETYKRAMTVGDNNRNRSVSDLDLKT
Ga0206688_1035032223300021345SeawaterLNMKQSKFLVLQGHQIPRGCYREIRKYQNCAANDGAAKCNNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNQTYKRAMTVSDYNKGRSVSDIDMKDWSFGHPRNMRSDSTW
Ga0206688_1098677413300021345SeawaterMKQSKFMALQPQFIPKGCYREIRKYQACTAEAGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDV
Ga0206692_157831813300021350SeawaterMTLQPNFIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVADLD
Ga0206692_174913013300021350SeawaterMNPNMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRN
Ga0206690_1044128913300021355SeawaterIPRGCYREIRRYQSCASQNGANACNNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNQTYKRAMTVGDYNKGRSVSDLEMKDWSFGLPRNLKEQTAW
Ga0206689_1006488113300021359SeawaterMKQSKFMGLKPEYIPRGCYREIRKYQSCSAAKGKDNCFNEKISIMEVCPDHVLEGLRERRKWFLRAEAIDNETYKRAMSVSDYNKGRSTLDLDVKDWSFGHPSNLRSDSTW
Ga0206123_1014982523300021365SeawaterMTQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNKSRSVSDL
Ga0194130_1035598823300021376Freshwater LakeMTLRPNFIPRGCYKEIRKYQQCAAKSGSEACFGDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMSVSDYNRGRSVSDL
Ga0213861_1030668423300021378SeawaterMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQISDYNKGRSVQDLDIKSWAYGHPKNLRSGTTWEDDRYNPQKYPH
Ga0210305_111445723300021847EstuarineMNIPKGCFREIRNYHLAKNNSSPEASFQEKINIMEVCPDHVLEALREKKKHYLRAEAIDNETYKRAMSVSDFNKGRSVSELKLK
Ga0063132_11480613300021872MarineMQNSKYMVLKPNFIPKGCYREIRKYNACATANGKEQCMNERISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNAGRSVSDLEIKDWSYGHPNNLRSDSTW
Ga0063132_14621613300021872MarineMDRGNYKYMTIQRTPIPRGCYREIRKYQSCAQAEGKQNCFNEKISIMEVCPDHVLEMLRERRKWMLRAEAIDNQTYKRAMKVSDFNKGRSVGDLECKSWDWGHPTNLRTQTTW
Ga0063099_104036313300021894MarineGVKNGGQANPNMKQSKFMALQPQFIPKGCYREIRKYQACTAGASKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0063104_108829713300021913MarineYREIRKYQACTAEASKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0063869_106601923300021922MarineMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGKSVSDLEIKSWSYGHPKNLRTTTTW
Ga0063102_101035323300021941MarineMALQPQFIPKGCYREIRKYQACTAEAGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRTESTW
Ga0063102_101318813300021941MarineRKYQACTASSGKDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0063102_105260613300021941MarineGGQANPNMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0063098_115829213300021942MarineHKNGSMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKEACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSQYNEGKTVSDLEIKNWAYGHPKNLRTETT
Ga0063101_100012913300021950MarineMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0063101_106584013300021950MarineTGSMTQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNSGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNKNRSVTDLELKTWAHGKTLRTESAW
Ga0063101_109008413300021950MarineSLGSKRGGIKSGNTGVSKYMQIQGDLVPRGCYREIQKYQSCTADKAKSECLNQKISIMEVCPTHVLEGLRERRKWWLRAETIDNASYKRAMEVSEYNKGRAVTDLEIKDWSYGHPSNLRSDTVW
Ga0222717_1044124313300021957Estuarine WaterMIPRGCYKEIRNYQKCVDANSKEACFADKISIMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMQVSDFNKNRSVSDLTLKTWEHGKAKNLRSDSLWQD
Ga0255756_129601623300022905Salt MarshQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0255774_1030938923300023087Salt MarshMKNSKFMTLQPNYIPKGCYREIRKYQACSSASGQDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLEIKDWSYGHPKNLRTDTTWE
Ga0255743_1038881013300023110Salt MarshMKNSKFMTLQPNYIPKGCYREIRKYQACSSASGQDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDL
Ga0228686_101885823300023685SeawaterMNPNMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0232123_107673423300023706Salt MarshMKNSKFMTLQPNYIPKGCYREIRKYQACSSASGQDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNKGKSVSDLEIKDWSYGHPKNLRTDTT
Ga0244777_1026998023300024343EstuarineMTLRPNFIPRGCYKEIRSYQMCKSKASEDACFADKISIMEVCPDHVLDALREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSFW
Ga0255236_115856923300024563FreshwaterKYMALRYDQIPRGCQRQIQYFQRCTQEKGEGNCFQQKIDIMEVCPDHVLEGLREKKKHMLRAEVIDNQTYRRAMEVSDYNRGRSVSDL
Ga0209198_116382213300025640Pelagic MarineMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVADL
Ga0209306_112234813300025680Pelagic MarineMTQPNMKQSKFMTLQPNFIPKGCYREIRKYQACTAAAEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVSELDIKNWAYGHPRNLRTGTTWE
Ga0209715_109865233300025699Pelagic MarineMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQSCAATAGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNEGKSVSDLEIKNWAYGHPKNLRTETTW
Ga0209534_1042958013300025880Pelagic MarineNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNKSRSVSDL
Ga0209309_1029320113300025881Pelagic MarineMTQPNMKQSKFMTLQPNFIPKGCYREIRKYQACTAAAEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAETIDNQTYKRAMQVSEYNKGRSVSELDIKNWAYGHPRNL
Ga0209631_1037256523300025890Pelagic MarineMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVSDLK
Ga0209425_1021165223300025897Pelagic MarineMKQSKYMTLQPNFIPKGCFREIQKYQACAASSGKEACFNDKISIMEVCPDHVLEGLREKRKWMLRAEAIDNQTYKRAMTVSSYNMGRSVSDLDVKSWEHGHPKNMRSDSTW
Ga0247603_107505113300026468SeawaterMNPNMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSDSTW
Ga0247599_109947513300026470SeawaterMKQSKFMTLQSSMIPRGCYREIQKYQACIAEKNKATCLNQKISIMEVCPDHILEALREKRKWTLRAEAIDNETYKRAMTVGDYNQGKSVSDLTIREWSYGSPKNMRSDSTWEDDRYDPTKFPHPHRYDN
Ga0247571_105830023300026495SeawaterMMQSKYMVLKPNFIPRGCYREIRKYNACAGSNGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNCGRSVSDLDIKDWTFGHPNNLRSDSTW
Ga0247587_117785223300026504SeawaterYNACAGSNGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNCGRSVSDLDIKDWTFGHPNNLRSDSTW
Ga0247590_115113723300026513SeawaterMMQSKYMVLKPNFIPRGCYREIRKYNACAGSTGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLNIKDWTFGHPNNMRSDSTW
Ga0208800_103451113300027193EstuarineTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSFW
Ga0208925_11045613300027203EstuarinePNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSFW
Ga0208923_105612323300027320EstuarineLKNGGQCNLNMKQSKFMTLKPSEIPKGCYREIRKYQSCAADKGTGNCSNEKISIMEVCPDHVLEGLRERRKWFMRAEAIDNATYKRAMSVSDYNKNRSVSDLELKDWSFGHPRNLRSDSV
Ga0209617_1023231313300027720Freshwater And SedimentMTLRPNFMPRGCYKEVRAYQMCVAKSSADACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDS
Ga0209617_1037810713300027720Freshwater And SedimentMTLRPNFIPRGCIKEIRSYHLCKAKTGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKL
Ga0209229_1021935023300027805Freshwater And SedimentMTLIPNFIPRGCYKEIRKFQLCSSKKGADHCLNDKINVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKDRSVSDL
Ga0209302_1017222423300027810MarineMTLHPTFIPRGCYKEIRKYQQCANKTNKEACLPEKISIMEVCPEHTLEQLREKKKWWLRAQSIDNETYKRAMTVSDFNRGRSVSDLQLKTWAFGKTLRSESTYEDDRYHPVSNKHNHRYD
Ga0209092_1028363223300027833MarineMVLKPNFIPKGCYREIRKYNVCATANGKDNCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLEIKDWTFGHPKNLRSDSTW
Ga0209092_1030910113300027833MarineMKQSKFMALQPQFIPKGCYREIRKYQACTAGASKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0209092_1045619223300027833MarineMTLVPNFMPRGCYKEVRKYQMCAAKENKEACLADKISIMEVCPDHVLEGLREKKKWYLRAESIDNETYKRAMTVGDYNRGRSVSNLNM
Ga0209712_1054275023300027849MarineFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0247584_112232113300028110SeawaterMMQSKYMVLKPNMIPRGCYREIRKYNSCASSNGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNCGRSVSDLDIKDWTFGHPNNLRSDSTW
Ga0256411_111072623300028134SeawaterMMQSKYMVLKPNFIPRGCYREIRKYNACAGSTGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNCGRSVSDLDIKDWTFGHPNNLRSDSTW
Ga0256411_124163413300028134SeawaterMQSKYMVLKPNMIPRGCYREIRKYNSCASSNGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLNIKDWTFGHPNNMRSDSTW
Ga0256412_110954813300028137SeawaterMMQSKYMVLKPNMIPRGCYREIRKYNSCASSNGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNNGRSVSDLNIKDWTFGHPNNMRSDSTW
Ga0256412_112688923300028137SeawaterMTLQPNYIPKGCYREIRKYQACAASAGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGKSVSDLEIKSWSYGHPKNLRT
Ga0228613_109084813300028279SeawaterGVKNGGQMNPNMKQSKFMALQPQFIPKGCYREIRKYQACTASSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0256413_120547923300028282SeawaterMKQSKFMTLQSSMIPRGCYREIQKYQACIAEKNKATCLNQKISIMEVCPDHILEALREKRKWTLRAEAIDNETYKRAMTVGDYNQGKSVSDLTIREWSYGSPKNMRSDSTWEDDRYDPTKFPHPHRYDNVNF
(restricted) Ga0247831_124838013300028559FreshwaterRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVTDLKLKTWEYGKGANLRSDSVW
Ga0304731_1053343813300028575MarineMALQPQFIPKGCYREIRKYQTCAAASGKDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNKGRSVSDLEIKDWSFGHPKNM
Ga0311342_1128423613300029955BogMTLIPSFIPRGCYREIRKYQLCAAAAGSAKDEVCFNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMVVGDYNKGRSVSDLTLKTWDYGKAGNL
Ga0247638_103658813300030551SoilMTLQPNFIPRGCWKEIRKYQLCAAKSSKEACIPEKISIMEVCPDHILEGLREKKKWFLRAEVIDNETYKRAMSVGDYNRGKSVSDLKLKTWEYGKGGNLKSDSLW
Ga0247655_1003025513300030621SoilLTLVPSVIPKGCYREILKYRRCENTKGEEACLNDKISIMEVCPDHVLEGLREKKKWTLRAEVIDNDTYRRAMEVSDYNKGRSVSDLKLKTWEHGMAHSLHSGTTW
Ga0307401_1017445713300030670MarineMVLKPNFIPKGCYIEIRKYNACATAAGKEACMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMGVSEYNKGRSVSDLEIKDWSYGHAKNLRSDSTW
Ga0307401_1048446413300030670MarineNFIPKGCYREIRKYNACATAAGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAETIDNSTYKRAMTVSDYNKGRSVSDLEIKDWSFGHASNMRSDSTW
Ga0307398_1025461523300030699MarineLNKKQSKYLVLQPTMIPRGCYREIRKYQSCANDVGAAKCNNEKISIMEVCPDHVLEGLREKRKWYLRAEAIDNSTYKRAMTVSDYNKGRSVSDIEMKDWSYGHPRNLRSETTW
Ga0307398_1028109323300030699MarineMKNSKYMTLRPTMIPRGCYKEIRSYQNCVASSNKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNAHRSVSDLKLKTWDHGKTANMRSDSLW
Ga0307398_1044013513300030699MarineMTLKGNEIPRGCYKEIRNYQACTDQNSKEACFADKISIMEVCPDHILEALREKKKWFLRAEMIDNDTYKRAMTVSDFNKHRSVSDLKMKTWDYGKTANLRSDSLW
Ga0307399_1028849523300030702MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNSGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNRNRSVSDLDLKTWAHGKSLRTESAY
Ga0307400_1081038023300030709MarineMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSEYNAGKSVSDLEIKNWAYGHPKNLRS
Ga0265461_1236435313300030743SoilAKTLGVKNGGQMQGNMKQSKYMTLRPNFLPRGCQREIRKYQLCSAKQGKDACINDKISIMEVCPDHVLEGLKERKKWYLRAEVIDNETYKRAMSVGEYNKGRSVSDLVLKTWEYGKGNNLRSDTLW
Ga0073967_1091269513300030750MarineMIPRGCYKEIRKYQACAANSSSEACVNEKISIMEVCPNHVLEGLREKKKWYLRAESIDNETYKRAMTVSDYNRGRSVSDL
Ga0073964_1151697323300030788MarineMSLKPDFAPRGCAKEIRKYQKCASEKGASSCFNEKIDIMEVCPDHVLEGLREKKKWTLRAEMIDNDTYKRAMQVSDFNVGRSVSDLKLKTWEYGKSCNLRGDGLYQD
Ga0074010_1033501823300030799SoilMKNGGFCENNMKLSKYMTLIPNFIPRGCYKEIRKYQLCAEKANPEACFNEKIDIMEVCPDHVLEGLREKKKWYLRAEVIDNQTYKRAMSVGDYNKGRSVTDLELK
Ga0074020_1052904313300030840SoilMTLQPNWIPKGCMREIRKYQICAGSKGEDVCFNDKISIMEVCPDHILEDLREKKKWYLRAEVIDNETYKRAMTVGEYNKGRSVSDLKLKVWEDGLQKNMRTDSYF
Ga0068589_1153542623300030979SoilREIRKYQICAGSKGEQSCFNDKISIMEVCPDHVLEDLREKKKWYLRAEVIDNETYKRAMTIGEYNKGRSVSDLKLKTWEDGTAKNMRSDSHWQDDRYNPKSYPHPHRYDN
Ga0073978_162849223300031036MarineMKNSKYMTLVPNWIPRGCYREIRKFQMCSARNPDNAAEVCLNDKISIMEVCPEHILEALREKKKHMLRAEVIDNETYRRAMQVGEYNRNRSVSDLTLKTWAHGKTLRTETAY
Ga0074029_149769723300031051SoilIPKGCMREIRKYQICAGSKGEDACFNDKISIMEVCPDHILEDLREKKKWYLRAEVIDNETYKRAMTVGEYNKGRSVSDLKLKVWEDGLQKNMRTDSYF
Ga0170824_11656498613300031231Forest SoilFSDQSRRNSKGLTLVPSVIPKGCYREILKYRRCENTKGEDACLNDKISIMEVCPDHVLEGLREKKKWTLRAEVIDNDTYRRAMEVSDYNKGRSVSDLKLKTWEHGMAHSLHSGTTW
Ga0307388_1085307123300031522MarineMMQSKYMALKWEQIPRGCYREIRKYQSCAAEKGKENCLNDKISIMEVCPDHILESLREKRKWYLRAESIDNQTYKRAMEVAPYNQGRSVSDLTIKDWSY
Ga0302114_1025418513300031621MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNSGNAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGDYNKNRSVTDLELKTWAHGKTLRTESA
Ga0302126_1029519313300031622MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAENAAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGEYNKNRSVSDLHLKTWAH
Ga0307984_112346223300031658MarineLGHKSGSMCQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNKEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLSLKTWAHGKTLRTESGY
Ga0307393_110859813300031674MarineMKQSKFMALQPQFIPKGCYREIRKYQACTAESGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLEVKDW
Ga0307386_1021602123300031710MarineMALQPQTIPKGCYREIRKYQGCSSAKGAAECLNEKISIMEVCPDHVLEGLREKRKWYLRAQAIDNETYKRAMTVSGYNKGKSVSDLEIKDWGYGHPKNLRADSTW
Ga0307396_1044762513300031717MarineHKSGGFCDPTQKTTKFMTLKGNEIPRGCYKEIRNYQACTDQNSKEACFADKISIMEVCPDHILEALREKKKWFLRAEMIDNDTYKRAMTVSDFNKHRSVSDLKMKTWDYGKTANLRSDSL
Ga0311351_1045308013300031722FenLQHNFIPRGCYREIRKYQLCAAKSSKEACINDKISIMEVCPDHVLEGLREKKKHYLRAEVIDNETYKRAMQVSDYNKDRSVSDLKLKTWDYGKGGNLRSDSLW
Ga0307397_1024111523300031734MarineMALQPNYIPRGCYREIRKYQACSAANGKTACLNEKISIMEVCPDHVLEGLRERRKWNLRAEAIDNETYKRAMQVASYNEGRSVSDLKIKDWSHGSAVNMRSESTW
Ga0307394_1012860623300031735MarineMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAGNKEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLSLKTWAHGKTLRTESGY
Ga0307394_1032155513300031735MarineIPRGCYKEIRKYKMCQANKSTEECVNEKISIMEVCPDHILEGLREKRKWSLRAESIDNETYKRAMKVGDYNRGRSVSDLHLKTWDHG
Ga0307394_1039513913300031735MarineGCYKEIRNYQACTDQNSKEACFADKISIMEVCPDHILEALREKKKWFLRAEMIDNDTYKRAMTVSDFNKHRSVSDLKMKTWDYGKTANLRSDSLW
Ga0307384_1037965013300031738MarineLGHKNGGQTQPNMMQSKYMVLKPNMIPRGCYREIRKYNACAGTSGKENCLNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNTGRSVNDLEIKDWTFGHPNNLRSESTW
Ga0307383_1023038613300031739MarineMRTSKYMTLRPSYIPRGCYKEIRKYQQCAEKEGADACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWDYGKAKNLRSDSIW
Ga0307383_1025044923300031739MarineMTLRPNYIPKGCFREIKKYQDCSAASGKDNCFNEKLSIMEVCPDHILEGLREKRKWILRAEAIDNQTYKRAMTVSDYNSGRSVSDLTIKDWSYGHSSNMRSDSTW
Ga0257195_1014225313300032169Host-AssociatedDRKGKSLGFKNGGFCDNSMKVSKYMTLIPSFIPRGCYREIRKYQLCAAAAGSAKDEVCFNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMVVGDYNKGRSVSDLTLKTWDYGKAGNLRSDSLW
Ga0314670_1023850523300032470SeawaterMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVADLDIKNWAYGHPKNLRTGTTW
Ga0314670_1071444913300032470SeawaterDRKNKTLGHKSGSMCQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAENAAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGEYNKNRSVSDLHLKTWAHGKTLRTESAY
Ga0314668_1025391123300032481SeawaterMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVADLDIKNWAYGHPKNLRTGTTW
Ga0314680_1029926213300032521SeawaterMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVADLDIKNWAYGHPKNLRTGTTW
Ga0314680_1058814713300032521SeawaterMGLQYDMIPRGCYREIHKFQQCAANKGNEACVNDKISIMEVCPEHILEALREKRKWMLRAQAIDNETYKRAMTVSDFNKGKSVSDLHIKDWSYGHAKNMRSDSTWEDDRYDPLKYSHPHR
Ga0314673_1061252023300032650SeawaterLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGKSVSDLEIKSWAYGHPKNLRT
Ga0314685_1045258513300032651SeawaterKTLGHKSGSMCQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAENAAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGEYNKNRSVSDLHLKTWAHGKTLRTESAY
Ga0314678_1029940413300032666SeawaterDDWYPDRKNKTLGHKSGSMCQPNMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAENAAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGEYNKNRSVSDLHLKTWAHGKTLRTESAY
Ga0314669_1014060233300032708SeawaterMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVSDLKLKTW
Ga0314702_123855223300032725SeawaterMKNSKYMTLVPNFIPRGCYREIRKFQMCSAKNAENAAEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMQVGEYNKNRSVSDLHLKTWAHGKTLRTESAY
Ga0315741_1090513713300032739Forest SoilDDWYPDRKGKSLGFKNGGFCDNSMKVSKYMTLIPSFIPRGCYREIRKYQLCAAAAGSAKDEVCFNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMVVGDYNKGRSVSDLTLKTWDYGKAGNLRSDSLW
Ga0314701_1033568413300032746SeawaterDDWYPDRKGKTLGHKNGSMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACAATEGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVADLDIKNWAYGHPKNLRTGTTW
Ga0314692_1053571623300032754SeawaterMGLQYDMIPRGCYREIHKFQQCAANKGNEACVNDKISIMEVCPEHILEALREKRKWMLRAQAIDNETYKRAMTVSDFNKGKSVSDLHIKDWSYGHA
Ga0315742_1068153513300032756Forest SoilMTLQPNWIPKGCMREIRKYQICAGSKGEDACFNDKISIMEVCPDHILEDLREKKKWYLRAEVIDNETYKRAMTVGEYNKGRSVSDLKLKVWEDGLQKNMRTDSYF
Ga0307390_1077224013300033572MarineMTLQPNYIPKGCYREIRKYQECAATSGKDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKGKSVSDLEIKSWSYGHPKNLRTTTT
Ga0335016_0275439_391_6723300034166FreshwaterMHKDYVYITLQPNFIPRGCAREIRSYQGCKEQKSPEACFQEKVNIMEVCPDFVLEGLREKKKHLLRAEAIDNEAYKRAMTVSDYNKGRSVSDL
Ga0334997_0295838_374_6553300034280FreshwaterMHKDYVYITLQPNFIPRGCAREIRSYQGCKEQKSPEACFQEKVNIMEVCPDFVLEGLREKKKHLLRAEAIDNETYKRAMTVSDYNKGRSVSDL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.