Metagenome / Metatranscriptome Family F014733

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F014733
Family Type	Metagenome / Metatranscriptome
Number of Sequences	260
Average Sequence Length	37 residues
Representative Sequence	MFEIWDGDLFLYTVDTEYEADEQAEAGFTVKVIQD
Number of Associated Samples	147
Number of Associated Scaffolds	260

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	90.66 %
% of genes near scaffold ends (potentially truncated)	9.62 %
% of genes from short scaffolds (< 2000 bps)	67.69 %
Associated GOLD sequencing projects	133
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (51.154 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (25.000 % of family members)
Environment Ontology (ENVO)	Unclassified (71.154 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (82.308 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 14.29% β-sheet: 23.81% Coil/Unstructured: 61.90%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.65
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 260 Family Scaffolds
PF04851	ResIII	14.62
PF00004	AAA	5.38
PF13186	SPASM	2.69
PF01145	Band_7	1.54
PF04055	Radical_SAM	1.54
PF00154	RecA	1.54
PF13394	Fer4_14	1.54
PF04724	Glyco_transf_17	0.77
PF03401	TctC	0.38
PF01541	GIY-YIG	0.38
PF06094	GGACT	0.38
PF02775	TPP_enzyme_C	0.38
PF00383	dCMP_cyt_deam_1	0.38
PF02801	Ketoacyl-synt_C	0.38
PF16363	GDP_Man_Dehyd	0.38
PF05050	Methyltransf_21	0.38
PF14559	TPR_19	0.38
PF11750	DUF3307	0.38
PF01075	Glyco_transf_9	0.38
PF01521	Fe-S_biosyn	0.38
PF03796	DnaB_C	0.38
PF13671	AAA_33	0.38
PF03721	UDPG_MGDP_dh_N	0.38
PF07230	Portal_Gp20	0.38
PF00685	Sulfotransfer_1	0.38
PF03851	UvdE	0.38
PF00782	DSPc	0.38

COG ID	Name	Functional Category	% Frequency in 260 Family Scaffolds
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	1.54
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.38
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	0.38
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	0.38
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.38
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.38
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.38
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	0.38
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.38
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	0.38
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.38
COG4294	UV DNA damage repair endonuclease	Replication, recombination and repair [L]	0.38
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	0.38

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
All Organisms	root	All Organisms	48.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
Viruses	superkingdom	All Organisms → Viruses	36.15 %
cellular organisms	root	All Organisms → cellular organisms	12.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	32.69 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	32.69 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.31 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	4.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	32.69 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7.31 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	4.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	32.69 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4.62 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	31.54 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	4.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.38 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31.54 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	4.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %
Lautropia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia	0.38 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31.54 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	4.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %
unclassified Lautropia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia	0.38 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31.54 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	4.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %
Lautropia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp.	0.38 %
Maribacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31.54 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	4.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %
unclassified Maribacter	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter	0.38 %
Lautropia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp.	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.15 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31.54 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	4.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.46 %
Maribacter sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.	0.38 %
Lautropia sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp.	0.38 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000553\|TBL_comb47_HYPODRAFT_10029346	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3949	Open in IMG/M
3300001282\|B570J14230_10054047	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1321	Open in IMG/M
3300001842\|RCM30_1050895	Not Available	834	Open in IMG/M
3300001848\|RCM47_1083091	Not Available	815	Open in IMG/M
3300001848\|RCM47_1120830	Not Available	606	Open in IMG/M
3300001948\|GOS2228_1045932	Not Available	1592	Open in IMG/M
3300002092\|JGI24218J26658_1034977	Not Available	598	Open in IMG/M
3300002408\|B570J29032_109652869	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.	997	Open in IMG/M
3300005527\|Ga0068876_10001171	Not Available	20698	Open in IMG/M
3300005580\|Ga0049083_10220541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	642	Open in IMG/M
3300005581\|Ga0049081_10007050	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4251	Open in IMG/M
3300005581\|Ga0049081_10080583	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1222	Open in IMG/M
3300005582\|Ga0049080_10016233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2590	Open in IMG/M
3300005582\|Ga0049080_10071783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1186	Open in IMG/M
3300005582\|Ga0049080_10268739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	554	Open in IMG/M
3300005584\|Ga0049082_10191099	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	703	Open in IMG/M
3300005662\|Ga0078894_10093986	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2636	Open in IMG/M
3300005662\|Ga0078894_10098425	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2578	Open in IMG/M
3300005662\|Ga0078894_10248508	All Organisms → Viruses → Predicted Viral	1613	Open in IMG/M
3300005662\|Ga0078894_10514277	Not Available	1074	Open in IMG/M
3300005662\|Ga0078894_10530040	Not Available	1055	Open in IMG/M
3300005662\|Ga0078894_10877358	Not Available	780	Open in IMG/M
3300005662\|Ga0078894_11331852	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	602	Open in IMG/M
3300005662\|Ga0078894_11335607	Not Available	601	Open in IMG/M
3300005662\|Ga0078894_11458437	Not Available	569	Open in IMG/M
3300005662\|Ga0078894_11585712	Not Available	541	Open in IMG/M
3300006071\|Ga0007876_1058448	All Organisms → Viruses → Predicted Viral	1034	Open in IMG/M
3300006120\|Ga0007867_1000447	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14406	Open in IMG/M
3300006484\|Ga0070744_10138472	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300006805\|Ga0075464_10005130	Not Available	6184	Open in IMG/M
3300006805\|Ga0075464_10328823	Not Available	922	Open in IMG/M
3300006805\|Ga0075464_10393926	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	841	Open in IMG/M
3300007516\|Ga0105050_10405335	Not Available	817	Open in IMG/M
3300007519\|Ga0105055_10111295	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2839	Open in IMG/M
3300007735\|Ga0104988_10984	Not Available	58973	Open in IMG/M
3300008055\|Ga0108970_10176933	Not Available	1011	Open in IMG/M
3300008055\|Ga0108970_10995911	Not Available	908	Open in IMG/M
3300008107\|Ga0114340_1083935	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1309	Open in IMG/M
3300008110\|Ga0114343_1049555	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1631	Open in IMG/M
3300008113\|Ga0114346_1156264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	967	Open in IMG/M
3300008267\|Ga0114364_1007060	Not Available	5497	Open in IMG/M
3300008267\|Ga0114364_1007915	Not Available	5121	Open in IMG/M
3300008267\|Ga0114364_1096586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	929	Open in IMG/M
3300008267\|Ga0114364_1104522	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300008448\|Ga0114876_1024926	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3022	Open in IMG/M
3300008996\|Ga0102831_1170572	Not Available	721	Open in IMG/M
3300009068\|Ga0114973_10004143	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10125	Open in IMG/M
3300009068\|Ga0114973_10010221	Not Available	6098	Open in IMG/M
3300009068\|Ga0114973_10027638	Not Available	3456	Open in IMG/M
3300009068\|Ga0114973_10213470	Not Available	1050	Open in IMG/M
3300009068\|Ga0114973_10511595	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	621	Open in IMG/M
3300009081\|Ga0105098_10588092	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	578	Open in IMG/M
3300009082\|Ga0105099_10260872	Not Available	1007	Open in IMG/M
3300009151\|Ga0114962_10008935	Not Available	7491	Open in IMG/M
3300009151\|Ga0114962_10011085	Not Available	6631	Open in IMG/M
3300009151\|Ga0114962_10204476	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1151	Open in IMG/M
3300009152\|Ga0114980_10429606	Not Available	756	Open in IMG/M
3300009152\|Ga0114980_10719909	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	558	Open in IMG/M
3300009154\|Ga0114963_10000016	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	98763	Open in IMG/M
3300009154\|Ga0114963_10006714	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7867	Open in IMG/M
3300009154\|Ga0114963_10499951	Not Available	647	Open in IMG/M
3300009155\|Ga0114968_10053205	Not Available	2600	Open in IMG/M
3300009155\|Ga0114968_10081400	Not Available	2011	Open in IMG/M
3300009158\|Ga0114977_10001247	Not Available	16572	Open in IMG/M
3300009158\|Ga0114977_10109855	Not Available	1667	Open in IMG/M
3300009158\|Ga0114977_10240150	Not Available	1049	Open in IMG/M
3300009158\|Ga0114977_10257029	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1007	Open in IMG/M
3300009158\|Ga0114977_10426798	Not Available	735	Open in IMG/M
3300009158\|Ga0114977_10656520	Not Available	561	Open in IMG/M
3300009159\|Ga0114978_10004048	Not Available	11912	Open in IMG/M
3300009159\|Ga0114978_10004695	Not Available	11012	Open in IMG/M
3300009159\|Ga0114978_10098184	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1937	Open in IMG/M
3300009159\|Ga0114978_10155357	Not Available	1471	Open in IMG/M
3300009159\|Ga0114978_10854352	Not Available	510	Open in IMG/M
3300009163\|Ga0114970_10172114	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1289	Open in IMG/M
3300009164\|Ga0114975_10090024	Not Available	1781	Open in IMG/M
3300009164\|Ga0114975_10459795	Not Available	689	Open in IMG/M
3300009180\|Ga0114979_10010440	Not Available	6021	Open in IMG/M
3300009182\|Ga0114959_10322862	Not Available	766	Open in IMG/M
3300009183\|Ga0114974_10024325	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4243	Open in IMG/M
3300009184\|Ga0114976_10006931	Not Available	7036	Open in IMG/M
3300009184\|Ga0114976_10100784	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1649	Open in IMG/M
3300009185\|Ga0114971_10469148	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	707	Open in IMG/M
3300009685\|Ga0116142_10277496	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	833	Open in IMG/M
3300010157\|Ga0114964_10540567	Not Available	547	Open in IMG/M
3300010157\|Ga0114964_10549427	Not Available	542	Open in IMG/M
3300010158\|Ga0114960_10366874	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	709	Open in IMG/M
3300010160\|Ga0114967_10008066	Not Available	8106	Open in IMG/M
3300010354\|Ga0129333_10090162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2836	Open in IMG/M
3300010354\|Ga0129333_10198560	Not Available	1825	Open in IMG/M
3300010354\|Ga0129333_11701279	Not Available	513	Open in IMG/M
3300010388\|Ga0136551_1002204	All Organisms → Viruses → Predicted Viral	4821	Open in IMG/M
3300010885\|Ga0133913_10161014	Not Available	6000	Open in IMG/M
3300010885\|Ga0133913_10351606	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3899	Open in IMG/M
3300010885\|Ga0133913_10446313	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3415	Open in IMG/M
3300010885\|Ga0133913_10665018	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2729	Open in IMG/M
3300010885\|Ga0133913_10697896	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2655	Open in IMG/M
3300010885\|Ga0133913_11402424	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1777	Open in IMG/M
3300010885\|Ga0133913_12733375	Not Available	1192	Open in IMG/M
3300011010\|Ga0139557_1059439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	644	Open in IMG/M
3300011011\|Ga0139556_1043837	Not Available	661	Open in IMG/M
3300011184\|Ga0136709_1046005	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	605	Open in IMG/M
3300011335\|Ga0153698_1004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	113802	Open in IMG/M
3300011335\|Ga0153698_1008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	74146	Open in IMG/M
3300012006\|Ga0119955_1019555	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2375	Open in IMG/M
3300012346\|Ga0157141_1001449	Not Available	5342	Open in IMG/M
3300012346\|Ga0157141_1044050	Not Available	553	Open in IMG/M
3300012347\|Ga0157142_1000373	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15956	Open in IMG/M
3300012347\|Ga0157142_1002436	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3876	Open in IMG/M
3300012347\|Ga0157142_1029493	Not Available	812	Open in IMG/M
3300012665\|Ga0157210_1000035	Not Available	72598	Open in IMG/M
3300012665\|Ga0157210_1039231	Not Available	732	Open in IMG/M
3300012667\|Ga0157208_10006453	All Organisms → Viruses → Predicted Viral	1800	Open in IMG/M
3300012667\|Ga0157208_10027323	Not Available	766	Open in IMG/M
3300013004\|Ga0164293_10018791	Not Available	5772	Open in IMG/M
3300013005\|Ga0164292_10362369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	976	Open in IMG/M
3300013006\|Ga0164294_10006403	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10081	Open in IMG/M
3300013006\|Ga0164294_10049152	Not Available	3281	Open in IMG/M
3300013006\|Ga0164294_10399138	Not Available	943	Open in IMG/M
3300013006\|Ga0164294_10697244	Not Available	686	Open in IMG/M
3300013006\|Ga0164294_10718406	Not Available	674	Open in IMG/M
3300013014\|Ga0164295_10091657	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2255	Open in IMG/M
3300013014\|Ga0164295_10579549	Not Available	863	Open in IMG/M
3300013014\|Ga0164295_11165352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	598	Open in IMG/M
3300013093\|Ga0164296_1083825	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1378	Open in IMG/M
3300013093\|Ga0164296_1119099	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1083	Open in IMG/M
3300013093\|Ga0164296_1135311	Not Available	995	Open in IMG/M
3300013093\|Ga0164296_1240835	Not Available	687	Open in IMG/M
3300013094\|Ga0164297_10160989	Not Available	892	Open in IMG/M
3300013285\|Ga0136642_1091064	Not Available	792	Open in IMG/M
3300013286\|Ga0136641_1040051	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1386	Open in IMG/M
3300015050\|Ga0181338_1017141	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1148	Open in IMG/M
3300015050\|Ga0181338_1047584	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	630	Open in IMG/M
3300017707\|Ga0181363_1046800	Not Available	782	Open in IMG/M
3300017722\|Ga0181347_1206776	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300017723\|Ga0181362_1006883	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2432	Open in IMG/M
3300017736\|Ga0181365_1102295	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	693	Open in IMG/M
3300017754\|Ga0181344_1012019	All Organisms → Viruses → Predicted Viral	2764	Open in IMG/M
3300017754\|Ga0181344_1036368	Not Available	1495	Open in IMG/M
3300017754\|Ga0181344_1165948	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	627	Open in IMG/M
3300017754\|Ga0181344_1222936	Not Available	525	Open in IMG/M
3300017761\|Ga0181356_1052597	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1400	Open in IMG/M
3300017777\|Ga0181357_1198713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	717	Open in IMG/M
3300017778\|Ga0181349_1049369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1654	Open in IMG/M
3300017778\|Ga0181349_1076843	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1275	Open in IMG/M
3300017778\|Ga0181349_1122943	Not Available	954	Open in IMG/M
3300017778\|Ga0181349_1162708	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	794	Open in IMG/M
3300017778\|Ga0181349_1206352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	676	Open in IMG/M
3300017778\|Ga0181349_1239177	Not Available	611	Open in IMG/M
3300017784\|Ga0181348_1309609	Not Available	526	Open in IMG/M
3300019093\|Ga0187843_10019317	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3554	Open in IMG/M
3300019093\|Ga0187843_10074434	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1568	Open in IMG/M
3300019784\|Ga0181359_1026384	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2227	Open in IMG/M
3300019784\|Ga0181359_1078615	Not Available	1239	Open in IMG/M
3300019784\|Ga0181359_1152182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	792	Open in IMG/M
3300019784\|Ga0181359_1176382	Not Available	710	Open in IMG/M
3300019784\|Ga0181359_1194179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	659	Open in IMG/M
3300019784\|Ga0181359_1203056	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	637	Open in IMG/M
3300019784\|Ga0181359_1222517	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	592	Open in IMG/M
3300020048\|Ga0207193_1000051	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	177422	Open in IMG/M
3300020048\|Ga0207193_1062604	Not Available	3730	Open in IMG/M
3300020141\|Ga0211732_1344204	Not Available	1071	Open in IMG/M
3300020151\|Ga0211736_10920155	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1831	Open in IMG/M
3300020159\|Ga0211734_10943863	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	880	Open in IMG/M
3300020159\|Ga0211734_11029492	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1061	Open in IMG/M
3300020159\|Ga0211734_11098452	Not Available	10059	Open in IMG/M
3300020162\|Ga0211735_11497399	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	586	Open in IMG/M
3300020172\|Ga0211729_11010049	Not Available	1076	Open in IMG/M
3300020205\|Ga0211731_10293048	Not Available	1463	Open in IMG/M
3300020726\|Ga0214220_1033271	Not Available	700	Open in IMG/M
3300021135\|Ga0214247_1010753	Not Available	1909	Open in IMG/M
3300021438\|Ga0213920_1103897	Not Available	539	Open in IMG/M
3300021952\|Ga0213921_1010020	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1769	Open in IMG/M
3300021961\|Ga0222714_10303315	Not Available	875	Open in IMG/M
3300021962\|Ga0222713_10007536	Not Available	10181	Open in IMG/M
3300022179\|Ga0181353_1051106	Not Available	1082	Open in IMG/M
3300022190\|Ga0181354_1096247	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	967	Open in IMG/M
3300022190\|Ga0181354_1140299	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763	Open in IMG/M
3300022407\|Ga0181351_1000047	Not Available	31860	Open in IMG/M
3300022407\|Ga0181351_1011400	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3617	Open in IMG/M
3300022407\|Ga0181351_1060184	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1563	Open in IMG/M
3300022407\|Ga0181351_1083287	Not Available	1270	Open in IMG/M
3300022407\|Ga0181351_1141762	Not Available	876	Open in IMG/M
3300022407\|Ga0181351_1276429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	507	Open in IMG/M
3300022591\|Ga0236341_1023711	All Organisms → Viruses → Predicted Viral	1824	Open in IMG/M
3300022602\|Ga0248169_101499	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32199	Open in IMG/M
3300022602\|Ga0248169_101971	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	26665	Open in IMG/M
3300022748\|Ga0228702_1037120	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1410	Open in IMG/M
3300023174\|Ga0214921_10017579	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7926	Open in IMG/M
3300023174\|Ga0214921_10030268	Not Available	5332	Open in IMG/M
3300023174\|Ga0214921_10040593	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4303	Open in IMG/M
3300023179\|Ga0214923_10000618	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	52797	Open in IMG/M
3300023179\|Ga0214923_10630718	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	502	Open in IMG/M
3300023311\|Ga0256681_10542250	Not Available	2010	Open in IMG/M
3300023311\|Ga0256681_10680360	Not Available	568	Open in IMG/M
3300023311\|Ga0256681_11676512	Not Available	752	Open in IMG/M
3300024346\|Ga0244775_10348689	Not Available	1222	Open in IMG/M
3300024346\|Ga0244775_10687121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp.	825	Open in IMG/M
3300025358\|Ga0208504_1016001	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1043	Open in IMG/M
3300025372\|Ga0207957_1009697	Not Available	1349	Open in IMG/M
3300025407\|Ga0208378_1026945	All Organisms → Viruses → Predicted Viral	1016	Open in IMG/M
3300025455\|Ga0208376_1039770	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	973	Open in IMG/M
3300025578\|Ga0208864_1101683	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	673	Open in IMG/M
3300025896\|Ga0208916_10190816	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	886	Open in IMG/M
3300027608\|Ga0208974_1043699	Not Available	1308	Open in IMG/M
3300027608\|Ga0208974_1147623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	599	Open in IMG/M
3300027656\|Ga0209357_1170637	Not Available	569	Open in IMG/M
3300027708\|Ga0209188_1251468	Not Available	610	Open in IMG/M
3300027710\|Ga0209599_10023606	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1715	Open in IMG/M
3300027712\|Ga0209499_1072673	Not Available	1354	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1000242	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	102625	Open in IMG/M
3300027732\|Ga0209442_1172022	Not Available	820	Open in IMG/M
3300027733\|Ga0209297_1076101	Not Available	1471	Open in IMG/M
3300027734\|Ga0209087_1040504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2178	Open in IMG/M
3300027736\|Ga0209190_1008388	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6339	Open in IMG/M
3300027736\|Ga0209190_1012325	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5056	Open in IMG/M
3300027736\|Ga0209190_1208023	Not Available	801	Open in IMG/M
3300027736\|Ga0209190_1359353	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	535	Open in IMG/M
3300027741\|Ga0209085_1004019	Not Available	7964	Open in IMG/M
3300027747\|Ga0209189_1003869	Not Available	9947	Open in IMG/M
3300027754\|Ga0209596_1102012	Not Available	1351	Open in IMG/M
3300027754\|Ga0209596_1228894	Not Available	775	Open in IMG/M
3300027759\|Ga0209296_1034469	Not Available	2758	Open in IMG/M
3300027763\|Ga0209088_10019004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3579	Open in IMG/M
3300027763\|Ga0209088_10217067	Not Available	810	Open in IMG/M
3300027782\|Ga0209500_10000316	Not Available	42981	Open in IMG/M
3300027782\|Ga0209500_10196298	Not Available	914	Open in IMG/M
3300027832\|Ga0209491_10253269	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1429	Open in IMG/M
3300027893\|Ga0209636_11307572	Not Available	501	Open in IMG/M
3300027963\|Ga0209400_1004749	Not Available	9493	Open in IMG/M
3300027969\|Ga0209191_1334062	Not Available	551	Open in IMG/M
3300027976\|Ga0209702_10288267	Not Available	670	Open in IMG/M
3300028113\|Ga0255234_1119089	Not Available	696	Open in IMG/M
3300031759\|Ga0316219_1097690	Not Available	1129	Open in IMG/M
3300031759\|Ga0316219_1227207	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	660	Open in IMG/M
3300031786\|Ga0315908_10490518	Not Available	1026	Open in IMG/M
3300031787\|Ga0315900_11099754	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300031857\|Ga0315909_10076445	Not Available	2975	Open in IMG/M
3300031951\|Ga0315904_10096352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3122	Open in IMG/M
3300032092\|Ga0315905_10274228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1628	Open in IMG/M
3300033992\|Ga0334992_0149470	All Organisms → Viruses → Predicted Viral	1203	Open in IMG/M
3300033993\|Ga0334994_0161740	Not Available	1248	Open in IMG/M
3300034061\|Ga0334987_0025126	Not Available	5285	Open in IMG/M
3300034061\|Ga0334987_0448783	Not Available	801	Open in IMG/M
3300034061\|Ga0334987_0506153	Not Available	735	Open in IMG/M
3300034062\|Ga0334995_0018694	Not Available	6233	Open in IMG/M
3300034071\|Ga0335028_0108052	Not Available	1814	Open in IMG/M
3300034082\|Ga0335020_0002809	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11763	Open in IMG/M
3300034082\|Ga0335020_0019100	Not Available	3910	Open in IMG/M
3300034082\|Ga0335020_0079777	All Organisms → Viruses → Predicted Viral	1683	Open in IMG/M
3300034082\|Ga0335020_0551530	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	543	Open in IMG/M
3300034092\|Ga0335010_0449463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	691	Open in IMG/M
3300034093\|Ga0335012_0137300	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1340	Open in IMG/M
3300034102\|Ga0335029_0027867	Not Available	4268	Open in IMG/M
3300034102\|Ga0335029_0370260	Not Available	876	Open in IMG/M
3300034104\|Ga0335031_0212239	Not Available	1305	Open in IMG/M
3300034106\|Ga0335036_0289230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1093	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.85%
Host-Associated	Host-Associated	0.77%
Engineered	Engineered	0.38%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.46%
Plants	Host-Associated → Plants	0.77%
Terrestrial	Environmental → Terrestrial	0.38%
Wastewater	Engineered → Wastewater	0.38%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	92.69%
Marine	Environmental → Aquatic → Marine	5.77%
Leaf	Host-Associated → Plants → Leaf	0.77%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.38%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.38%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	51.54%
Lentic	Environmental → Aquatic → Freshwater → Lentic	27.69%
Lotic	Environmental → Aquatic → Freshwater → Lotic	6.54%
Coastal	Environmental → Aquatic → Marine → Coastal	2.69%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.31%
Ice	Environmental → Aquatic → Freshwater → Ice	1.92%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.92%
Creek	Environmental → Aquatic → Freshwater → Creek	1.15%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.77%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.77%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.77%
River	Environmental → Aquatic → Freshwater → River	0.38%
Pond	Environmental → Aquatic → Freshwater → Pond	0.38%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.38%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.38%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.38%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	50.77%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	25.38%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	6.54%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.69%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.31%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	1.92%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.92%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	1.54%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	1.15%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.77%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.77%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.77%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.38%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.38%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.38%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.38%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	0.38%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.38%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.38%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.38%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.38%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	25.00%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	18.46%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	15.38%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	7.31%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	5.38%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.46%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	3.08%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	2.69%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	1.92%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.92%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	1.54%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.54%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	1.15%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	1.15%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	1.15%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	1.15%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.77%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.77%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.77%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.77%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.38%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.38%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.38%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.38%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.38%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.38%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	0.38%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	0.38%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.38%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.38%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.38%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.38%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000553	Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)	Environmental	Open in IMG/M
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001842	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b	Environmental	Open in IMG/M
3300001848	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a	Environmental	Open in IMG/M
3300001948	Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012	Environmental	Open in IMG/M
3300002092	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300006071	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09	Environmental	Open in IMG/M
3300006120	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300007516	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01	Environmental	Open in IMG/M
3300007519	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03	Environmental	Open in IMG/M
3300007735	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300009685	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG	Engineered	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010388	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300011011	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m	Environmental	Open in IMG/M
3300011184	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG	Environmental	Open in IMG/M
3300011335	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman	Environmental	Open in IMG/M
3300012006	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B	Environmental	Open in IMG/M
3300012346	Freshwater microbial communities from Emily Creek, Ontario, Canada - S29	Environmental	Open in IMG/M
3300012347	Freshwater microbial communities from Fish Creek, Ontario, Canada - S48	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013014	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG	Environmental	Open in IMG/M
3300013093	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG	Environmental	Open in IMG/M
3300013094	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG	Environmental	Open in IMG/M
3300013285	Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y	Environmental	Open in IMG/M
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300019093	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020726	Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion	Environmental	Open in IMG/M
3300021135	Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion	Environmental	Open in IMG/M
3300021438	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG	Environmental	Open in IMG/M
3300021952	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022591	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2	Environmental	Open in IMG/M
3300022602	Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion	Environmental	Open in IMG/M
3300022748	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300023311	Combined Assembly of Gp0281739, Gp0281740, Gp0281741	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300025358	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)	Environmental	Open in IMG/M
3300025372	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)	Environmental	Open in IMG/M
3300025407	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes)	Environmental	Open in IMG/M
3300025455	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes)	Environmental	Open in IMG/M
3300025578	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes)	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027656	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027712	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027832	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)	Environmental	Open in IMG/M
3300027893	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027976	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)	Environmental	Open in IMG/M
3300028113	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031759	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
TBL_comb47_HYPODRAFT_1002934614	3300000553	Freshwater	MFEVYDGDLLLYTVDTEYEADEAREAGFTVRNFWSE*
B570J14230_100540473	3300001282	Freshwater	MYEIWDGDLFLFTVDDSDEADLQMEAGFTVREVSARA*
RCM30_10508954	3300001842	Marine Plankton	MYQIWDGDLYLYSVDTEYEANEQAEAGFTVKKVNYA*
RCM47_10830912	3300001848	Marine Plankton	MYEIWDGDLFLYSVDTDYEADEAAEAGFCIVKGGDYGR*
RCM47_11208302	3300001848	Marine Plankton	MFEIWDGDLFLFSVDTVYEAGDVREAGFRVKALYLS*
GOS2228_10459327	3300001948	Marine	MFEIWDGDLYLYSVDTRYEADEQEEAGFTVKSLEYYGA*
JGI24218J26658_10349771	3300002092	Lentic	MFEIWDGDLFLYTVDSTYEADEARDTGFLVVPISQE*
B570J29032_1096528693	3300002408	Freshwater	MFEIWDGDLYLYTVDTQYEADEQMEAGFTVKSMEYYGA*
Ga0068876_1000117123	3300005527	Freshwater Lake	MYEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0049083_102205412	3300005580	Freshwater Lentic	MMESKMFEIWDGELFLYAVDTEYEADEQKAAGFTVKVIQD*
Ga0049081_100070507	3300005581	Freshwater Lentic	MFEIWDGDLYLFSVDTQYEADEQAEAGFTVKSLEYYGA*
Ga0049081_100805831	3300005581	Freshwater Lentic	MFEIWDGELFLYAVDTEYEADEQKAAGFTVKVIQD*
Ga0049080_100162333	3300005582	Freshwater Lentic	MMELKMFEIWDGELFLYAVDTEYEADEQKAAGFTVKVIRV*
Ga0049080_100717834	3300005582	Freshwater Lentic	MFEIWDGELFLYAVDTEYEADEQKAAGFTVKIIQD*
Ga0049080_102687394	3300005582	Freshwater Lentic	MFEIWDGDLFLYTVDTEYEADEQAEAGFTVKVIQD*
Ga0049082_101910991	3300005584	Freshwater Lentic	HNMFEIWDGDLFLYAVDTKYEADEQAEAGFTVKEVKQ*
Ga0078894_100939861	3300005662	Freshwater Lake	MYEIWDGDLYLFSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0078894_100984251	3300005662	Freshwater Lake	MYEIWDDDLYLYSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0078894_102485082	3300005662	Freshwater Lake	MIYEIWDGDLFLYSVDSEYEADEQREAGFTIKIRRAA*
Ga0078894_105142772	3300005662	Freshwater Lake	MFEIWDGDLLLYVVDSTYEADEAEETGFRVVPITQE*
Ga0078894_105300402	3300005662	Freshwater Lake	MFEIWDGDLFLYSVDSEYEADEANEAGFTVKQSVKK*
Ga0078894_108773581	3300005662	Freshwater Lake	MFAIWDGDVYLYSVDTEYEADEAAEAGFQVVPNGLG*
Ga0078894_113318523	3300005662	Freshwater Lake	MFEIWDGDLYLFSVDTEYEADEQREAGFTVKCLAYYGV*
Ga0078894_113356072	3300005662	Freshwater Lake	MYEIWEGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0078894_114584372	3300005662	Freshwater Lake	MFEIWDGDLYPYSVDSREEADEQQEAGFTIKSLEYYGA*
Ga0078894_115857121	3300005662	Freshwater Lake	MYQIWDGDLYLYSVETKYEADEAKESGFKIVKVRKVI*
Ga0007876_10584481	3300006071	Freshwater	MFEVYDGDLLLYTVDTEYEADEAREAGFTVVRFDQ*
Ga0007867_10004473	3300006120	Freshwater	MFEVYDGDLLLYTVDTEYEADEAREAGFKVVRFDQ*
Ga0070744_101384722	3300006484	Estuarine	MIYEIWDGDLFLYSVESEYEADEQKLAGFTIKIRRAA*
Ga0075464_100051306	3300006805	Aqueous	MFQIWDGDLFLYAVDTIYEADEQEEAGFTIKVVENK*
Ga0075464_103288233	3300006805	Aqueous	MFEIWDGDLFLYTVDSTYEADEARDTGFRVVKIR*
Ga0075464_103939263	3300006805	Aqueous	MFEIWDGDLYLYSVDTQYEADEQEEAGFTVKSLEYYGA*
Ga0105050_104053353	3300007516	Freshwater	MFEIYDGDLMLFVVYTQYEADEHYEMGFRVVRINQ*
Ga0105055_101112954	3300007519	Freshwater	MFEIWDGDLYLYSVDTKYEADEAHGAGFTIKTTKAA*
Ga0104988_1098426	3300007735	Freshwater	MYQVWDGDLFLYSVDTIEEANEARESGFTVKSTEYYGA*
Ga0108970_101769332	3300008055	Estuary	MYEIWDGDLYLFSVDTEYEADEQREAGFAVKCLEYYGA*
Ga0108970_109959112	3300008055	Estuary	MFEIWDGDLFLYTVDNKYQADEAEEIGFRIVQIQ*
Ga0114340_10839352	3300008107	Freshwater, Plankton	MYEIWDGDLFLYAVDTLYEADEQREAGFTVKEINK*
Ga0114343_10495551	3300008110	Freshwater, Plankton	MFEIWDGDLYLFSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0114346_11562643	3300008113	Freshwater, Plankton	MFEIWDGELFLYAVDTEYEADEHEAAGFTVKEINR*
Ga0114364_10070608	3300008267	Freshwater, Plankton	MFEIWDGDLMLYTVDTKYEADEAVESGFEVRTVGVPQ*
Ga0114364_10079158	3300008267	Freshwater, Plankton	MFEIWDGDLFLYAVDTKYEADEQAEAGFTVKEVKQ*
Ga0114364_10965862	3300008267	Freshwater, Plankton	MFEIWDGELFLYAVDTEYEADEHEAAGFTVKVIQD*
Ga0114364_11045222	3300008267	Freshwater, Plankton	MFEIWDGELFLYAVDTEYEADEQAEAGFTVKVIQV*
Ga0114876_10249262	3300008448	Freshwater Lake	MFEIWEGDLYLYSVDTREEADEQREAGFTVKSLEYYGA*
Ga0102831_11705722	3300008996	Estuarine	MFEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0114973_1000414311	3300009068	Freshwater Lake	MYEIWDGELFLYAVDTKYEADEAAEAGFQIQTRIE*
Ga0114973_100102215	3300009068	Freshwater Lake	MFEIWNDDLFLYIVDTQYQADEMAAEGFRVVRIS*
Ga0114973_100276382	3300009068	Freshwater Lake	MFEIWDGDLFLYAVDNQYQADEAEEIGFTVVKIQ*
Ga0114973_102134703	3300009068	Freshwater Lake	MYEVWDGDLYLFSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0114973_105115952	3300009068	Freshwater Lake	MFEIWEGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA*
Ga0105098_105880923	3300009081	Freshwater Sediment	MFEIWDGDLFLYSVDTEYEADEADEAGFTVKLSVAE*
Ga0105099_102608722	3300009082	Freshwater Sediment	MFEIWDGDLFLYRVATRYEADEAKQAGFTVKMVAVA*
Ga0114962_100089358	3300009151	Freshwater Lake	MFEIWNDDLFLYTVDTQYQADEMAAEGFRVVRIA*
Ga0114962_100110855	3300009151	Freshwater Lake	MFEIWDGDLFLYTVDDQYQADEARDTGFRVVPIAQE*
Ga0114962_102044762	3300009151	Freshwater Lake	MFEIWNDDLFLYTVDNQYQADEMAAEGFRVVRIA*
Ga0114980_104296062	3300009152	Freshwater Lake	MFEIWDGDLLLYVVDTKYEADEADEIGFRVVPISKE*
Ga0114980_107199091	3300009152	Freshwater Lake	MFEIWDGDLYLYSVDTEYEADEQREAGFIVKCLEYYGA*
Ga0114963_1000001685	3300009154	Freshwater Lake	MYEIWDGDLFLYAVDTEYEADEAAEAGFQIQRSAM*
Ga0114963_100067148	3300009154	Freshwater Lake	MYEIYEGDLYLYSVDTQYEADEQAEAGFTVKSLEYYGA*
Ga0114963_104999511	3300009154	Freshwater Lake	MFEIWDEDLFLYTVDNQYQADEMAAEGFRVVRIA*
Ga0114968_100532053	3300009155	Freshwater Lake	MYEIWDNDMFLYAVDTKYEADEAEEAGFQIQIRTK*
Ga0114968_100814002	3300009155	Freshwater Lake	MFEIWNDDLFLYTVDNQYQADEMAAEGFRVVKIS*
Ga0114977_1000124712	3300009158	Freshwater Lake	MFEIWDGDLFLYTVDSTYEADEAEQTGFRVVKIR*
Ga0114977_101098553	3300009158	Freshwater Lake	MFEIWDGDLFLYIVDTTYEADEAEDTGFRVVPITQE*
Ga0114977_102401502	3300009158	Freshwater Lake	MFEIWNDGLFLYTVDNQYQADEMAAEGFRVVRIA*
Ga0114977_102570292	3300009158	Freshwater Lake	MFEIWDGDLFLYAVDTKYEADEAEDSGFRVVKIS*
Ga0114977_104267982	3300009158	Freshwater Lake	MFEIWDGDLFLYTVDSEYEADEAKEIGFQIVKIS*
Ga0114977_106565202	3300009158	Freshwater Lake	MYEIWDGDVFLYAVDTKYEADEADEAGFQIVKIS*
Ga0114978_1000404816	3300009159	Freshwater Lake	MFEIWDGDLFLYTVDTEYEADEQAEAGFTIKVIQD*
Ga0114978_100046956	3300009159	Freshwater Lake	MYEIWDGDLYLYSVDTQEEADEQKAAGFTVKSMEYYGA*
Ga0114978_100981844	3300009159	Freshwater Lake	MFEIWDGDLYLYSVSTEYEADEQREAGFTIKCLEYYGA*
Ga0114978_101553572	3300009159	Freshwater Lake	MYEIWEGDLYLYSVDTEYEADEQREAGFIVKCLEYYGA*
Ga0114978_108543522	3300009159	Freshwater Lake	MYEIWDGDIFLYAVDTKYEADEAAEAGFQILTITD*
Ga0114970_101721142	3300009163	Freshwater Lake	MFEIWDGDLFLYAVDTEYEADEQAEAGFTVKEVEQ*
Ga0114975_100900242	3300009164	Freshwater Lake	MFEIWDGDLFLYTVDTKYEADEADETGFLVVPIAQE*
Ga0114975_104597951	3300009164	Freshwater Lake	MFEIWDGDLFLYTVDSTYEADEAEETGFRVVPIAQE*
Ga0114979_100104402	3300009180	Freshwater Lake	MFEIWDGDLFLYTVDTEYEADEAAETGFRIVKIR*
Ga0114959_103228621	3300009182	Freshwater Lake	MFEIWNEDLFLYTVDNQYQADEMAAEGFRVVRIA*
Ga0114974_100243257	3300009183	Freshwater Lake	MFEIWDGELFLYAVDTEYEADEHETAGFTVKVIRD*
Ga0114976_1000693115	3300009184	Freshwater Lake	MFEIWDGELFLYAADTEYEADEHETAGFTVKVIRD*
Ga0114976_101007843	3300009184	Freshwater Lake	MFEIWDGDLFLYAVDTKYEADEAEEIGFRVVKIR*
Ga0114971_104691483	3300009185	Freshwater Lake	MYEIWDGDLYLFSVDTKYEADEQREAGFTIKCLEYYGA*
Ga0116142_102774962	3300009685	Anaerobic Digestor Sludge	MYEIWDGDLFLYRVDTQYEADEADEAGFTVREIDRS*
Ga0114964_105405672	3300010157	Freshwater Lake	MFEIWNDYLFLYTVDTQYQADEMAAEGFRVVRIA*
Ga0114964_105494271	3300010157	Freshwater Lake	MYEIWDGDMFLYAVDTKYEADEAVEAGFQILININ*
Ga0114960_103668742	3300010158	Freshwater Lake	MYQVWEGDLFLYSVDTEYEADEQREAGFTIKIMA*
Ga0114967_100080664	3300010160	Freshwater Lake	MFEIWDGDLLLYTVDTKYEADEQAAAGFEIKQINPQYVIV*
Ga0129333_100901625	3300010354	Freshwater To Marine Saline Gradient	MYEVWDGDLFLYSVDTEYEADEQREAGFRVVKHRTK*
Ga0129333_101985604	3300010354	Freshwater To Marine Saline Gradient	MYQVWDGDLFLYSVDSAYEADEAREAGFKVISLEYYGA*
Ga0129333_117012791	3300010354	Freshwater To Marine Saline Gradient	MYQVWDGDLFLYDVDTEYEADEAREAGFQVVSKEYYGA*
Ga0136551_10022041	3300010388	Pond Fresh Water	NMYEIWDGDLYLYTVDSEYEADEQREAGFTVKSLEYYGA*
Ga0133913_101610148	3300010885	Freshwater Lake	MFEIWNDDLFLYTVDNQYQADEMAAEGFRVVQIA*
Ga0133913_103516063	3300010885	Freshwater Lake	MFEIWDGDLFLYTVDSTYEADEAEDSGFRVVPIVKQ*
Ga0133913_104463133	3300010885	Freshwater Lake	MFEIWDGDLYLYSVDTQHEADEQAEAGFTIKSLEYYGA*
Ga0133913_106650184	3300010885	Freshwater Lake	MFEIWDGDLFLYTVDSTYEADEAEETGFRVVPISQE*
Ga0133913_106978961	3300010885	Freshwater Lake	NPQEPNMYEIWDGDLYLFSVDTKYEADEQREAGFTIKCLEYYGA*
Ga0133913_114024241	3300010885	Freshwater Lake	MFEIWNDDLFLYTVDDQYHADEMAAEGFRVVKIA*
Ga0133913_127333752	3300010885	Freshwater Lake	MYEIWDGELFLYAVDTKYEADEAVEAGFQIHTRTE*
Ga0139557_10594393	3300011010	Freshwater	MFEIWDGELFLYAVDTEYEADEHEAAGFTVKEISR*
Ga0139556_10438372	3300011011	Freshwater	MFEIWDGDLFLYTVDDQYQADEAEETGFRVVPISQDSKVMA*
Ga0136709_10460052	3300011184	Freshwater	MFEIWDGDMYLYSVDTQAEADEHSEQGFTVKSLEYYGA*
Ga0153698_100428	3300011335	Freshwater	MYEIWDGELFLYAVDTKYEADEAVEAGFQIQIRTN*
Ga0153698_100865	3300011335	Freshwater	MFEIWDGDLFLYTVDSTYEADEAEEIGFRVVKIK*
Ga0119955_10195554	3300012006	Freshwater	MFEIWDGDLYLFSVDTEYEADEQRKAGFTVKCLEYYGA*
Ga0157141_100144912	3300012346	Freshwater	EIWDGDLYLYSVDTKYEADEQEEAGFTVKSLEYYGA*
Ga0157141_10146681	3300012346	Freshwater	MYQVWDGDLFLYTVDTQYEADEQVEAGFTIKSLEYYGA*
Ga0157141_10440501	3300012346	Freshwater	MFEIWDGDLYLYSVDTKYEADEQEEAGFTVKSLEYYGA*
Ga0157142_100026433	3300012347	Freshwater	MYQVWDGDLFLFNVETADEAFEQSEAGFQIELAEYYGA*
Ga0157142_10003733	3300012347	Freshwater	MFEIWEGDLYLYSVDTQYEADEQAEAGFTVKSLEYYGA*
Ga0157142_10024364	3300012347	Freshwater	MFEVWDGDLFLFTVDTHAEAQEQIEEGFTIKSLEYYGA*
Ga0157142_10294934	3300012347	Freshwater	MFEIWDGDLYLYSVDTRDEADEQEEAGFTVKSLEYYGA*
Ga0157210_100003589	3300012665	Freshwater	MYQVWDGDLYLYSVETKYEAEEAKESGFKVLKVRKVI*
Ga0157210_10392314	3300012665	Freshwater	MFEIWDGDLFLYAVDTEYEADEQAEAGFTIKVIQD*
Ga0157208_100040082	3300012667	Freshwater	MYQVWDGDLFLFIVETADEAFEQSEAGFQIELAEYYGA*
Ga0157208_100064533	3300012667	Freshwater	MFEIWEGDLYLYSVDTKYEADEQEEAGFTVKSLEYYGA*
Ga0157208_100273231	3300012667	Freshwater	MFEIWDGDLYLYSVDTRDEADEQEEAGFTIKSLEYYGA*
Ga0164293_1001879111	3300013004	Freshwater	MYEIWDGELFLYAVDTVYEADEQAEAGFTVKEINLN*
Ga0164292_103623692	3300013005	Freshwater	MFEIWDGDLFLYAVDTQYEADEQAEAGFIVKEINK*
Ga0164294_1000640314	3300013006	Freshwater	MCMFEIWDGDLFLYAVDTKYEADEAQEIGFTVVKIQ*
Ga0164294_100491522	3300013006	Freshwater	MFEIWDGDLYLYSVDTREEADEQEEAGFIVKTLEYYGA*
Ga0164294_103991382	3300013006	Freshwater	MFEIWDGDLFLYTVDSTYEADEAEATGFRVVPISQE*
Ga0164294_106972443	3300013006	Freshwater	MFEIWDGDLFLYAVDNQYQADEAKEIGFRVVKVQ*
Ga0164294_107184062	3300013006	Freshwater	MFEIWDGDLFLYTVDNKYQADEAEEIGFRIVKIS*
Ga0164295_100916572	3300013014	Freshwater	MFEIWDGDLFLYAVDTKYEADEAQEIGFTVVKIQ*
Ga0164295_105795491	3300013014	Freshwater	MFEIWDSDLFLYAVDNQYQADEAKEIGFRVVKVQ*
Ga0164295_111653523	3300013014	Freshwater	YEIWDGDLYLFSVDTECEADEQREAGFTVKCLEYYGA*
Ga0164296_10838255	3300013093	Freshwater	MFEVWDGDLLLYTVDTEYEADEAYEAGFTVVRFDQ*
Ga0164296_11190992	3300013093	Freshwater	MFEVYDGDLLLYTVDTEYEADEAYEAGFTVVRFDQ*
Ga0164296_11353112	3300013093	Freshwater	MFEVWEGDLLLYTVDTEYEADEAREAGFTVRNFWSE*
Ga0164296_12408351	3300013093	Freshwater	MMFEVYDGDLLLYTVDTVYEADEAREAGFKVVRFDQ*
Ga0164297_101609893	3300013094	Freshwater	MFEVYDGDLLLYTVDTVYEADEAREAGFKVVRFDQ*
Ga0136642_10910641	3300013285	Freshwater	MYQIWDGDLFLYSVDTEYEADEQGEAGFTIKIVGRA*
Ga0136641_10400512	3300013286	Freshwater	MFEIWNDDLFLYAVDNQYQADEMAAEGFRVVRIA*
Ga0181338_10171413	3300015050	Freshwater Lake	KFEIWDGDLFLYTVDNKYQADEAEEIGFRIVQIQ*
Ga0181338_10475841	3300015050	Freshwater Lake	EIWDGDLFLYTVDSTYEADEAEETGFRVVPISQE*
Ga0181363_10468002	3300017707	Freshwater Lake	MFAIWDGDVYLYSVDTEYEADEAAEAGFQVVPNGLG
Ga0181347_12067761	3300017722	Freshwater Lake	GNDMFEIWDGDLFLYTVDNKYQADEAEDSGFRIVQIS
Ga0181362_10068833	3300017723	Freshwater Lake	MFEIWDGDLFLYTVDTEYEADEQAEAGFTIKVIQV
Ga0181365_11022952	3300017736	Freshwater Lake	MFEIWDGDLYLFSVDTEYEADEQREAGFTVKCLEYYGA
Ga0181344_10120192	3300017754	Freshwater Lake	MFEIWDGDLLLYVVDSTYEADEAEETGFRVVPITQE
Ga0181344_10363682	3300017754	Freshwater Lake	MFEIWDGDLYLYSVDTKYEADEQEEAGFTVKSLEYYGA
Ga0181344_11659482	3300017754	Freshwater Lake	MFEIWDGDLYLYSVGTEYEADEQREAGFTVKCLEYYGA
Ga0181344_12229361	3300017754	Freshwater Lake	MYQIWDGDLYLYSVETKYEADEAKESGFKVLKVKKVS
Ga0181356_10525971	3300017761	Freshwater Lake	MCMFEIWDGDLFLYTVDNKYQADEAEEIGFRIVKIS
Ga0181357_11987133	3300017777	Freshwater Lake	MMESKMFEIWDGELFLYAVDTEYEADEHEAAGFTVKIIQD
Ga0181349_10493691	3300017778	Freshwater Lake	RWLNMYEIWDGDLFLYAVDTLYEADEQREAGFTVKEINK
Ga0181349_10768431	3300017778	Freshwater Lake	PNMYEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0181349_11229432	3300017778	Freshwater Lake	MYEIWDGDLFLYAVDTKYEADEAEEAGFQIRDNSK
Ga0181349_11627082	3300017778	Freshwater Lake	MMESKMFEIWDGELFLYAVDTEYEADEQKAAGFTVKVIQD
Ga0181349_12063523	3300017778	Freshwater Lake	MMELKMFEIWDGELFLYAVDTEYEADEQAEAGFTVKVIQD
Ga0181349_12391771	3300017778	Freshwater Lake	MMELKMFEIWDGELFLYAVDTEYEADEHEAVGFTVKLIQD
Ga0181348_13096092	3300017784	Freshwater Lake	MMELKMFEIWDGDLFLYTVDTEYEADEQAEAGFTIKVIQV
Ga0187843_100193173	3300019093	Freshwater	MFEIWDGDLYLYSVDTREEADEQEEAGFIVKTLEYYGA
Ga0187843_100744341	3300019093	Freshwater	NDMFEIWDGDLFLYTVDSTYEADEAEETGFRVVPISQE
Ga0181359_10263846	3300019784	Freshwater Lake	MFEIWDGDLLLYTVDTEYEADEQAEAGFTVKVIQV
Ga0181359_10786154	3300019784	Freshwater Lake	MFEIWDGDLFLYTVDTEYEADEQAEAGFTVKVIQV
Ga0181359_11521821	3300019784	Freshwater Lake	MMELKMFEIWDGELFLYAVDTEYEADEQKAAGFTVKVIQD
Ga0181359_11763822	3300019784	Freshwater Lake	MFEIWDGELFLYAVDTEYEADEQKAAGFTVKVIQD
Ga0181359_11941793	3300019784	Freshwater Lake	MFEIWDGELFLYAVDTEYEADEHEAAGFTVKIIQD
Ga0181359_12030563	3300019784	Freshwater Lake	MFEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0181359_12225172	3300019784	Freshwater Lake	MYEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0207193_1000051170	3300020048	Freshwater Lake Sediment	MFEIWDGDLFLYAVDTEYEADEATEAGFTIRSVVAD
Ga0207193_10626047	3300020048	Freshwater Lake Sediment	MFEIWDGELFLYTVDTEYEADEQAEAGFEIRQVCK
Ga0211732_13442042	3300020141	Freshwater	MFEIWDGDLFLYTVDTKYEADEQAEAGFEIKQIDTQ
Ga0211736_109201553	3300020151	Freshwater	MYEIWEGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0211734_109438631	3300020159	Freshwater	NPQEPNMYEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0211734_110294923	3300020159	Freshwater	MFEIWDGDLYLYSVDTEYEADEQREAGFTVKSLEYYGA
Ga0211734_1109845214	3300020159	Freshwater	MYQIWDGDLYLYSVETKYEADEAKESGFKIVKVRKVI
Ga0211735_114973991	3300020162	Freshwater	MYEIWDGDLYLYSVDTECEADEQREAGFTVKCLEYYGA
Ga0211729_110100492	3300020172	Freshwater	MYEIWDGDLYLYSVDTEYEADEQREAGFTVKYLEYYGA
Ga0211731_102930482	3300020205	Freshwater	MFEIWDGDLFLYTVDTKYEADEQAESGFEIKQIDPQE
Ga0214220_10332712	3300020726	Freshwater	MFEVYDGDLLLYTVDTEYEADEAREAGFTVRNFWSE
Ga0214247_10107533	3300021135	Freshwater	MFEVYDGDLLLYTVDTEYEADEAREAGFTVVRFDQ
Ga0213920_11038972	3300021438	Freshwater	MFEIYDGDMLLFTVDTQYEADEAAESGFTVKELHHA
Ga0213921_10100205	3300021952	Freshwater	MYQVWDGDLFLYSVETTYEADEAREAGFKVISLEYYGA
Ga0222714_103033152	3300021961	Estuarine Water	MYQVWDGDLYLYSVESQYEADEAQEAGFTVKSLEYYGA
Ga0222713_100075363	3300021962	Estuarine Water	MYEIWDDDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0181353_10511064	3300022179	Freshwater Lake	MFEIWDGDLFLYSVESEYEADEANEAGFTVKQSVKK
Ga0181354_10962472	3300022190	Freshwater Lake	MFEIWDGDLFLYTVDSTYEADEAEETGFRVVPISQE
Ga0181354_11402994	3300022190	Freshwater Lake	MFEIWDGDLLLYTVDTEYEADEQAEAGFTIKVIQV
Ga0181351_100004714	3300022407	Freshwater Lake	MYEIWDGDLFLYAVDTLYEADEQAEAGFTVRAVGPK
Ga0181351_10114008	3300022407	Freshwater Lake	MFEIWDGDLFLYAVDTKYEADEQAEAGFTVKEVKQ
Ga0181351_10601841	3300022407	Freshwater Lake	WLNMYEIWDGDLFLYAVDTLYEADEQREAGFTVKEINK
Ga0181351_10832873	3300022407	Freshwater Lake	MELKMFEIWDGELFLYAVDTEYEADEHEAAGFTVKEISR
Ga0181351_11417622	3300022407	Freshwater Lake	MMELKMFEIWDGDLFLYTVDTEYEADEQAEAGFTVKVIQV
Ga0181351_12764291	3300022407	Freshwater Lake	MFEIWDGDLFLYAVDTEYEADEQKAAGFTVKVIQD
Ga0236341_10237117	3300022591	Freshwater	MFEVYDGDLLLYTVDTVYEADEAREAGFKVVRFDQ
Ga0248169_10149934	3300022602	Freshwater	MFEVYDGDLLLYTVDTEYEADEAREAGFKVVRFDQ
Ga0248169_10197135	3300022602	Freshwater	MFEVWEGDLLLYTVDTEYEADEAYEAGFTVVRFDQ
Ga0228702_10371202	3300022748	Freshwater	MYEVWDGDLFLYAVDTEYEAYEAVEEGFTVKEKVIEYYGA
Ga0214921_1001757913	3300023174	Freshwater	MFEIWDGDLYLFSVDTEYEADEQRKAGFTVKCLEYYGA
Ga0214921_100302686	3300023174	Freshwater	MFEIWDGDLYLYSVDTREEADEQEKAGFTVKTLEYYGA
Ga0214921_100405936	3300023174	Freshwater	MYEIWDGDLYLFSVDTEYEADEHRESGFTVKCLEYYGA
Ga0214923_1000061840	3300023179	Freshwater	MYEIWDGDLFLYSVDTKYEADEAEEAGFQIRDKSK
Ga0214923_106307182	3300023179	Freshwater	IWEGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0256681_105422502	3300023311	Freshwater	MFEIWDGDLFLYAVDTQYEADEQAEAGFTVKSLEYYGA
Ga0256681_106803602	3300023311	Freshwater	MMFEVYDGDLLLYTVDTEYEADEAREAGFTVRNFWSE
Ga0256681_116765123	3300023311	Freshwater	MFEIWEGDMYLYSVDTQPEADEHTEQGFTVKSLEYYGA
Ga0244775_103486893	3300024346	Estuarine	MFEIWDGELFLYAVDTVYEADEQAEAGFTVKEINHN
Ga0244775_106871212	3300024346	Estuarine	MIYEIWDGDLFLYSVESEYEADEQKLAGFTIKIRRAA
Ga0208504_10160014	3300025358	Freshwater	NMMFEVYDGDLLLYTVDTEYEADEAREAGFKVVRFDQ
Ga0207957_10096974	3300025372	Freshwater	MFEVYDGDLLLYIVDTEYEADEAREAGFTVRNFWSE
Ga0208378_10269451	3300025407	Freshwater	RNMMFEVYDGDLLLYTVDTEYEADEAREAGFTVVRFDQ
Ga0208376_10397703	3300025455	Freshwater	MYEIWDGDLFLYTVDTEYEADEAAEAGFQIQRNTK
Ga0208864_11016831	3300025578	Freshwater	TMFEIWDGDLFLYTVDDQYQADEAEDTGFRVVPIAQE
Ga0208916_101908162	3300025896	Aqueous	MFEIWDGDLYLYSVDTQYEADEQEEAGFTVKSLEYYGA
Ga0208974_10436993	3300027608	Freshwater Lentic	MFEIWDGDLYLFSVDTQYEADEQAEAGFTVKSLEYYGA
Ga0208974_11476232	3300027608	Freshwater Lentic	MFEIWDGELFLYAVDTEYEADEQKAAGFTVKVIRV
Ga0209357_11706372	3300027656	Freshwater Lake	MELKMFEIWDGDLFLYAVDTLYEADEQAEAGFTVRAVGPK
Ga0209188_12514681	3300027708	Freshwater Lake	MYEIYEGDLYLYSVDTQYEADEQAEAGFTVKSLEYYGA
Ga0209599_100236062	3300027710	Deep Subsurface	MFEIWDGDLFLYSVDTEYEADEADEAGFTVKLSVAE
Ga0209499_10726732	3300027712	Freshwater Lake	MYEIWDGDLFLYAVDTEYEADEAAEAGFQIQRSAM
(restricted) Ga0247836_100024282	3300027728	Freshwater	MYEIWDGDMFLYAVNTEYEADEAAEAGFQIQINAK
Ga0209442_11720221	3300027732	Freshwater Lake	MFEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGAXHGKIYS
Ga0209297_10761013	3300027733	Freshwater Lake	MFEIWDGDLFLYIVDTTYEADEAEDTGFRVVPITQE
Ga0209087_10405046	3300027734	Freshwater Lake	MFEIWDGDLFLYTVDTEYEADEQAEAGFTIKVIQD
Ga0209190_10083882	3300027736	Freshwater Lake	MYEVWDGDLYLFSVDTEYEADEQREAGFTVKCLEYYGA
Ga0209190_10123256	3300027736	Freshwater Lake	MFEIWEGDLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0209190_12080232	3300027736	Freshwater Lake	MYEIWDGELFLYAVDTKYEADEAAEAGFQIQTRIE
Ga0209190_13593532	3300027736	Freshwater Lake	MFEIWDGDLFLYAVDTEYEADEQAEAGFTVKEVEQ
Ga0209085_10040192	3300027741	Freshwater Lake	MFEIWDGDLFLYTVDDQYQADEARDTGFRVVPIAQE
Ga0209189_100386911	3300027747	Freshwater Lake	MFEIWDGDLFLYTVDSTYEADEAEDSGFRVVPIVKQ
Ga0209596_11020123	3300027754	Freshwater Lake	MYEIWDNDMFLYAVDTKYEADEAEEAGFQIQIRTK
Ga0209596_12288942	3300027754	Freshwater Lake	MFEIWDGDLLLYTVDTKYEADEQAAAGFEIKQINPQYVIV
Ga0209296_10344692	3300027759	Freshwater Lake	MFEIWDGELFLYAVDTEYEADEHETAGFTVKVIRD
Ga0209088_100190041	3300027763	Freshwater Lake	MFEIWDGDLLLYVVDTKYEADEADEIGFRVVPISKE
Ga0209088_102170672	3300027763	Freshwater Lake	MYEIWDGDLYLYSVDTQEEADEQKAAGFTVKSMEYYGA
Ga0209500_1000031614	3300027782	Freshwater Lake	MYQVWDGDLYLYSVETEYEADEQAEAGFTVVGEPK
Ga0209500_101962982	3300027782	Freshwater Lake	MFEIWDGDLYLYSVSTEYEADEQREAGFTIKCLEYYGA
Ga0209491_102532692	3300027832	Freshwater	MFEIWDGDLYLYSVDTKYEADEAHGAGFTIKTTKAA
Ga0209636_113075722	3300027893	Marine Sediment	MYEVWDGDLFLFAVDTEFEAHEAIEEGFTVKEKTIV
Ga0209400_10047499	3300027963	Freshwater Lake	MCMFEIWDGDLFLYTVDNKYQADEAEEIGFRIVQIQ
Ga0209191_13340621	3300027969	Freshwater Lake	MFEIWDGDLFLYTVDTKYEADEADETGFLVVPIAQE
Ga0209702_102882671	3300027976	Freshwater	MFEIYDGDLMLFVVYTQYEADEHYEMGFRVVRINQ
Ga0255234_11190892	3300028113	Freshwater	MYEIWDGDLYLFSVDTEYEADVQREAGFTVKCLEYYGA
Ga0316219_10976902	3300031759	Freshwater	MFEVWEGDLLLYTVDTEYEADEAREAGFTVRNFWSE
Ga0316219_12272072	3300031759	Freshwater	MFEVYDGDLLLYTVDTEYEADEAYEAGFTVVRFDQ
Ga0315908_104905182	3300031786	Freshwater	MYEIWDGDLFLYAVDTLYEADEQREAGFTVKEINK
Ga0315900_110997542	3300031787	Freshwater	MYEIWDGNLYLYSVDTEYEADEQREAGFTVKCLEYYGA
Ga0315909_100764453	3300031857	Freshwater	MYQVWDGDLYLYSVDTQYEADEAQEAGFVVKSLEYYGA
Ga0315904_100963522	3300031951	Freshwater	MYEIWDGDLYLFSVDTEYEADEQREAGFTVKCLEYYGA
Ga0315905_102742283	3300032092	Freshwater	MFEIWDGELFLYAVDTEYEADEHEAAGFTVKEINR
Ga0334992_0149470_3_113	3300033992	Freshwater	MYEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYG
Ga0334994_0161740_1005_1115	3300033993	Freshwater	MYEIWDGELFLYAVDTVYEADEQAEAGFTVKEINLN
Ga0334987_0025126_1742_1855	3300034061	Freshwater	MFEIWDGNLMLYTVDTKYEADEAVESGFEVRTVGVLQ
Ga0334987_0448783_318_425	3300034061	Freshwater	MYEIWDGDLFLYHVDTQYEADEAGFTVKQHSTASE
Ga0334987_0506153_483_596	3300034061	Freshwater	MFEIWDGDLFLYAVDTKYEADEAVESGFEVRAVSHND
Ga0334995_0018694_4315_4431	3300034062	Freshwater	MFEIWDGDLYLYTVDTQYEADEQMEAGFTVKSMEYYGA
Ga0335028_0108052_88_201	3300034071	Freshwater	MFEIWDGNLMLYTVDTKYEADEAVESGFEVRTVGVPQ
Ga0335020_0002809_11395_11511	3300034082	Freshwater	MFEIWDGDLYLYSVETKYEADEQQEAGFTVKSLEYYGA
Ga0335020_0019100_3515_3631	3300034082	Freshwater	MYEIWDGDLYLYSVDTEYEADEQREAGFTVKCLEYYGT
Ga0335020_0079777_882_992	3300034082	Freshwater	MFEIYDGDLFLFSVDTEYEADEAREAGFTVNSLVEE
Ga0335020_0551530_1_111	3300034082	Freshwater	MIYEVWDEDLFLYSVDTEYEADEQKLAGFTIKIRRAA
Ga0335010_0449463_546_668	3300034092	Freshwater	MMELKMFEIWDGDLFLYTVDTEYEADEQAEAGFTVKVIQD
Ga0335012_0137300_613_729	3300034093	Freshwater	MFEIWDGDLYLYSVETKYEADEQAEAGFTVKSLEYYGA
Ga0335029_0027867_3706_3813	3300034102	Freshwater	MFEIWDGDLFLYAVDTVYEADEHEANGFTVKEIKQ
Ga0335029_0370260_146_256	3300034102	Freshwater	MYEIWDGNLFLYAVDTEYEADEQREAGFTVKVIALN
Ga0335031_0212239_3_107	3300034104	Freshwater	MYEIWDGDLYLYSVDTEYEADEQREAGFTVKYLEY
Ga0335036_0289230_892_999	3300034106	Freshwater	MFEIWDGDLFLYTVDTEYEADEQAEAGFEIRQVCK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters