Basic Information | |
---|---|
Family ID | F014487 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 262 |
Average Sequence Length | 41 residues |
Representative Sequence | MPLLLLALLLCSCSPKPSDNNVLPRYSDMGAAEDAGKAK |
Number of Associated Samples | 121 |
Number of Associated Scaffolds | 262 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 45.56 % |
% of genes near scaffold ends (potentially truncated) | 30.92 % |
% of genes from short scaffolds (< 2000 bps) | 65.65 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (78.244 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (40.076 % of family members) |
Environment Ontology (ENVO) | Unclassified (74.809 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (82.443 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 262 Family Scaffolds |
---|---|---|
PF02557 | VanY | 4.58 |
PF13385 | Laminin_G_3 | 2.29 |
PF00535 | Glycos_transf_2 | 1.15 |
PF13884 | Peptidase_S74 | 1.15 |
PF14090 | HTH_39 | 0.76 |
PF01555 | N6_N4_Mtase | 0.76 |
PF06725 | 3D | 0.76 |
PF05136 | Phage_portal_2 | 0.76 |
PF00685 | Sulfotransfer_1 | 0.76 |
PF05876 | GpA_ATPase | 0.76 |
PF13481 | AAA_25 | 0.38 |
PF00149 | Metallophos | 0.38 |
PF01436 | NHL | 0.38 |
PF13578 | Methyltransf_24 | 0.38 |
PF13472 | Lipase_GDSL_2 | 0.38 |
PF03071 | GNT-I | 0.38 |
PF00145 | DNA_methylase | 0.38 |
PF05050 | Methyltransf_21 | 0.38 |
PF00676 | E1_dh | 0.38 |
PF09374 | PG_binding_3 | 0.38 |
PF00589 | Phage_integrase | 0.38 |
PF01075 | Glyco_transf_9 | 0.38 |
PF16778 | Phage_tail_APC | 0.38 |
PF12850 | Metallophos_2 | 0.38 |
PF11651 | P22_CoatProtein | 0.38 |
COG ID | Name | Functional Category | % Frequency in 262 Family Scaffolds |
---|---|---|---|
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 4.58 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.58 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.76 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.76 |
COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.76 |
COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.76 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.38 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.38 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.38 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 78.24 % |
All Organisms | root | All Organisms | 21.76 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 40.08% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 19.47% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.34% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.05% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.29% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.91% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.15% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.15% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.76% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.76% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.76% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.38% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.38% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.38% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.38% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.38% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.38% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.38% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.38% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020544 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
3300027157 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12547J11936_100094813 | 3300000736 | Freshwater And Sediment | MPLLLLTLFFCSCSPRHTDNNALPNYEMMQAAEDAGKTPSK* |
B570J29032_1095345662 | 3300002408 | Freshwater | MPLLLLALLFCSCSPKPVDHNNALPRYSDMGAAEDAGKAK* |
B570J40625_1000058714 | 3300002835 | Freshwater | MPLLLLALLLCSCSPRPVDHNNALPRYSDMSAAEDAMNAGKAK* |
B570J40625_1004254893 | 3300002835 | Freshwater | MPLLILTLFFCSCSPKPVDHNNVLPRYSDMGAAEDAGKVK* |
B570J40625_1007941851 | 3300002835 | Freshwater | MPLLLLALLLCSCSPKKHTENNALPDYGEMGAASEAGRVKSE* |
JGI25908J49247_100420952 | 3300003277 | Freshwater Lake | MPFLLLALCLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSLK* |
JGI25908J49247_101222752 | 3300003277 | Freshwater Lake | MPIIFIALLLCSCSPKHEDNNALPRYSDMGAASDAGKVKP* |
JGI25909J50240_10263571 | 3300003393 | Freshwater Lake | MPLLLLTLFLCSCSPKPADSNVLPRYSDMGAAEDAGNVK* |
JGI25909J50240_10849102 | 3300003393 | Freshwater Lake | MPLLFIALLLSSCSPKHEDNNALPRYSDMGAASDAGKVNP* |
JGI25907J50239_10617881 | 3300003394 | Freshwater Lake | LHLFTGELMPFLLLALCLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSLK* |
JGI25907J50239_11052743 | 3300003394 | Freshwater Lake | FYGFSMKYLIFTLCLCSCSPKQHDQRDVNVLPDYSDMSAAEDAGNVK* |
JGI25924J51412_10019802 | 3300003491 | Freshwater Lake | MRLILLAFLFSSCSPRPAENTGLPNYDMMQAAEDAGKAPSK* |
JGI25923J51411_10227411 | 3300003493 | Freshwater Lake | MPLLLLALLLCSCSPKQTDNTGLPRYSDMGAAEDAGNVK* |
Ga0049081_1000079715 | 3300005581 | Freshwater Lentic | MPLLLLALFFCSCSPKKHTENNALPDYGEMGAATDAGQVK* |
Ga0049081_100158034 | 3300005581 | Freshwater Lentic | MGTIIMPALFLALLLCSCSPRPVDHNNMLPRYSDMGAAEDAGKVK* |
Ga0049081_100952973 | 3300005581 | Freshwater Lentic | MPLLLFALLLCSCSPKHTDNNALPDYGEMGAAADAGQVK* |
Ga0073926_100216532 | 3300005943 | Sand | MPLLLLTLLLCSCSPKPADSNVLPRYSDMGAASDAGAVSSGNVK* |
Ga0073910_10013814 | 3300006005 | Sand | MPLLLLTLLLCSCSPKTDNTGLPNYEYGEMQAAEDAGRTPSK* |
Ga0075466_11481372 | 3300006029 | Aqueous | MPILLLTLFLCSCSPKHTDNNALPLYSDMGAAEDAGKVK* |
Ga0075464_100341223 | 3300006805 | Aqueous | MPLILLIALLFCSCSPKKHTENNALPDYGEMGAAAEAGRVKSE* |
Ga0075464_100345523 | 3300006805 | Aqueous | MPLLLITLLLCSCSPRPVDHNNMLPQYSDMGAAEDAGKAK* |
Ga0075464_101589503 | 3300006805 | Aqueous | MPLLLLTLLLCSCSPSKVDNNPLPVYSDMGAASDLGATKP* |
Ga0075464_101988122 | 3300006805 | Aqueous | MPLLLLALLLCSCSPKKHTDNNALPRYSDMSAASEAGQTPSK* |
Ga0079302_100004627 | 3300007165 | Deep Subsurface | MPLLLITLFLCSCSQRPAESTGLPNYDMMQAAEDAGKTPSK* |
Ga0104986_14515 | 3300007734 | Freshwater | MPIIFIALLLCSCSPKPANNNVLPRYSDMGAAEDAGNVK* |
Ga0104986_172418 | 3300007734 | Freshwater | MPILLLTLFLCSCSPRHTETDTQLPRYSDMSAAEDAMNAGKAK* |
Ga0104988_104604 | 3300007735 | Freshwater | MQLLIITLLICSCSPKPADNNVLPRYSDMGAAEDAGNVK* |
Ga0104988_106916 | 3300007735 | Freshwater | MPLLLIALLFCSCSPKKRSDNNALPDYGEMGAASEAGRTKSE* |
Ga0104988_1087441 | 3300007735 | Freshwater | MPLLLITLFLCSCSPRHTDNNPLPRYSDMSAAEDAGRAK* |
Ga0114363_11574162 | 3300008266 | Freshwater, Plankton | MPLLLLALLLCSCSPRPTNNTGLPDYSDMSAADDAGK |
Ga0114880_11626801 | 3300008450 | Freshwater Lake | MPLLLLALCLCSCSPKGTDKESLTVRYSDMSAAEDAGKTPSLK |
Ga0104242_10043223 | 3300008962 | Freshwater | MQFIKLVLICFALSSCSPKPADNNVLPRYSDMGAATDAGNVK* |
Ga0114973_100014149 | 3300009068 | Freshwater Lake | MPLLLLALFLCSCSPKHTDNNALPNYEMMQAAEDAGKTPSLK* |
Ga0114973_100998085 | 3300009068 | Freshwater Lake | MKIVLICLFVCSCCPKPEDNNNLLPRYSDMGAAEDAGKAK* |
Ga0114973_102259552 | 3300009068 | Freshwater Lake | MPLLLITLLLSSCSPRPAENTGLPQYSDMSAAEEAGRTPSK* |
Ga0114973_102355082 | 3300009068 | Freshwater Lake | MPLLLLTLLLCSCSPKKHTENNALPDYGEMGAAADAGQVK* |
Ga0114973_103882891 | 3300009068 | Freshwater Lake | MPLLLLTLLLCSCSPRPAENTGLPNYDMMQAAEDA |
Ga0114962_100011045 | 3300009151 | Freshwater Lake | MPLLLLALFLCSCSPKHTENNALPNYEMMQAAEDAGRTPSTK* |
Ga0114962_1000732512 | 3300009151 | Freshwater Lake | MPLLLLALFLCSCSPKRTDNNSLPNYEMMQAAEDAGKTPSTK* |
Ga0114980_100065212 | 3300009152 | Freshwater Lake | MIPVIFAGLLLCSCSPRQDNNVLPQYSDMGAAEDAGKAK* |
Ga0114980_100192743 | 3300009152 | Freshwater Lake | MPLVLLTLLLFSCSPRPAENTGLPRYSDMSAAEDAGKAK* |
Ga0114980_100385066 | 3300009152 | Freshwater Lake | MPVLLLAILLCSCSPKRDNNVLPRYSDMSAAEDAGKSR* |
Ga0114980_102568513 | 3300009152 | Freshwater Lake | MPLLLLTLLLCSCSPKKHTENNALPDYGEMGAAEEAGRVKSE* |
Ga0114963_1000045634 | 3300009154 | Freshwater Lake | MPILLIALLLGSCSPRHTDNNALPRYSDMSAAEDAGRVKSQ* |
Ga0114963_101882181 | 3300009154 | Freshwater Lake | STKMPFILIALLLSSCSPQPAESTGLPNYDMMQAAEDAGRTPSK* |
Ga0114968_100368143 | 3300009155 | Freshwater Lake | MKLLLVALFFCSCSPRHKDNNALPRYSDMGAAEDAGKVK* |
Ga0114977_100106684 | 3300009158 | Freshwater Lake | MKLIFLVLMLLCSCSQRPADNTGLPNYEMMQAAEDAGQTPSK* |
Ga0114977_100527484 | 3300009158 | Freshwater Lake | MPLLLLALLLCSCSPKKTDNTGLPRYSDMGAASDAGAVSSGNVK* |
Ga0114977_102269572 | 3300009158 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAASDAGAVSSGNVK* |
Ga0114978_105655783 | 3300009159 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAAEDAGAVSSGNVK* |
Ga0114981_104612372 | 3300009160 | Freshwater Lake | MPLLFIALLLSSCSPKHEDNNALPRYSDMGAATDAGKVKP* |
Ga0114966_103872143 | 3300009161 | Freshwater Lake | MPILFIALFLCSCSPKPADNNVLPRYSDMGAAEDAGNVK* |
Ga0114975_102555002 | 3300009164 | Freshwater Lake | MPLLLLALLLCSCSPKPVENTGLPNYDMMQAAEDAGQTPSK* |
Ga0114979_100477734 | 3300009180 | Freshwater Lake | MKLLLVVLLLCSCSPKRDNNVLPRYSDMSAAEDAGKAK* |
Ga0114979_100879036 | 3300009180 | Freshwater Lake | PLLLFAVFFCSCSPRTTENNPLPRYSDMSAAEDAGKAK* |
Ga0114969_102962131 | 3300009181 | Freshwater Lake | RFAIMPILFIALFLCSCSPKPADNNVLPRYSDMGAAEDAGNVK* |
Ga0114974_102855663 | 3300009183 | Freshwater Lake | MPLLLIALLLCSCSPKKTDNTGLPRYSDMGAAEDAGAVSSGNVK* |
Ga0114976_1000050444 | 3300009184 | Freshwater Lake | MPLLLLTALLCSCSPKKTDNTGLPRYSDMGAAEDAGNVK* |
Ga0114976_100990613 | 3300009184 | Freshwater Lake | MPLLLLTLLLCSCSPRPADNNVLPRYSDMGAAEDAGKVK* |
Ga0114976_104045074 | 3300009184 | Freshwater Lake | AFRRSVMKLLVVAILLCSCSPKRDNNVLPRYSDMGAASDAGKTPSK* |
Ga0114972_100099012 | 3300009187 | Freshwater Lake | MPLLLLALLLSSCSPRPAENTGLPNYDMMQAAEDAGKAK* |
Ga0114964_100238852 | 3300010157 | Freshwater Lake | MPILFLALLLCSCSPKHTENNVLPNYEMMQAAEDAGKTPSLK* |
Ga0133913_1002780215 | 3300010885 | Freshwater Lake | MNLLLLIALLLCSCSPKPADSNVLPRYSDMGAASDAGAVSSGNAK* |
Ga0133913_1014984810 | 3300010885 | Freshwater Lake | MPIPLIALFLCSCSPKPAKTDTQLPRYSDMGAAADAGQVK* |
Ga0133913_113226082 | 3300010885 | Freshwater Lake | MPLLLIALLLSSCSPRPVENTGLPNYEYGEMQAAEDAGRTPSK* |
Ga0133913_124087733 | 3300010885 | Freshwater Lake | MRLILLAVLLSSCSPRPVDNTGLPRYSDMSAAEDAGNA |
Ga0139557_10015278 | 3300011010 | Freshwater | MPLLLFALCLCSCSPKETVKESLPVGYSDMSAAEDAGKAPSK* |
Ga0139557_10239812 | 3300011010 | Freshwater | MPLLLLALCLCSCSPKETVRESLPVGYSDMSAAEDAGKTPSLK* |
Ga0151516_1015823 | 3300011116 | Freshwater | MKLLLVGFLLCSCSPRHTDNNALPRYSDMGAAEDAGKVK* |
Ga0151516_1059914 | 3300011116 | Freshwater | MPILLITLLLSSCSPKQQANTDLPRYSDMGAAEDAGKVK* |
Ga0153697_11488 | 3300011334 | Freshwater | MPLLFLALFFFSCSPKHAPSSGLPDYSDMGAAEDAGKTPSK* |
Ga0153698_105756 | 3300011335 | Freshwater | MPLLLIALLFCSCSPKQEDNNILPRYSEMGAAADAGAVSSGNVK* |
Ga0153805_10483822 | 3300012013 | Surface Ice | MPILLLTLLFCSCSPRKDNNVLPRYSDMSAAEDAGKIK* |
Ga0164293_108817552 | 3300013004 | Freshwater | MRLILLAFLISSCSPRMEDNNALPRYSDMGAAADAGQVK* |
Ga0164294_1001253119 | 3300013006 | Freshwater | MPLLLIALLLCSCSPRPAENTALPNYDMMQAAEDAGKAK* |
Ga0164294_102017563 | 3300013006 | Freshwater | MPFILITLLLCSCSPKPADSNVLPRYSDMGAAEDAGNVK* |
Ga0164295_105848412 | 3300013014 | Freshwater | MSLLLLTLLLCSCSPRPVDHNNPLPNYEMMQAAEDAGKTPSK* |
Ga0164295_110050842 | 3300013014 | Freshwater | LLFIALLLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSLK* |
Ga0177922_102705837 | 3300013372 | Freshwater | MPLLLLALCLCSCSPKPADSNVLPRYSDMGAAEDAGNVK* |
Ga0177922_104973582 | 3300013372 | Freshwater | MPLLLLALLLCSCSPKHTPSSGLPDYYGEMQAAEDAGK |
Ga0177922_108509731 | 3300013372 | Freshwater | MPLLLIALLLSSCSPKKHTENNALPDYGEMGAASEAGRVKSE* |
Ga0181364_10157342 | 3300017701 | Freshwater Lake | MPLLLVALLLCSCSPRPVENTGLPNYSDMSAAEDAGKAK |
Ga0181364_10207191 | 3300017701 | Freshwater Lake | MPLLLLIALLLRSCSPKPADSNVLPRYSDMGAATDAGNVK |
Ga0181364_10215551 | 3300017701 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAAEDAGN |
Ga0181364_10235725 | 3300017701 | Freshwater Lake | GTIIMPVLFLALLLSSCSPKKTDNTGLPDYSDMSAAEDAGKAK |
Ga0181364_10243442 | 3300017701 | Freshwater Lake | MPLLLLALCLCSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0181364_10468352 | 3300017701 | Freshwater Lake | MPLLLLALLLCSCSPKKTDNTGLPDYSDMSAAEDAGKAK |
Ga0181363_10025113 | 3300017707 | Freshwater Lake | MPLLILALLLCSCSPKTADNNVLPRYSDMGAATDAGNVK |
Ga0181350_10271633 | 3300017716 | Freshwater Lake | MPLLLLTLFLCSCSPKPADSNVLPRYSDMGAASDAGKTPSPTLNNKTPY |
Ga0181347_10596883 | 3300017722 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAASDAGAVSS |
Ga0181347_10655001 | 3300017722 | Freshwater Lake | MPLLLLALLLCSCSPKRTPSSGLPDYSDMGAASDAGKTPSPT |
Ga0181347_11841711 | 3300017722 | Freshwater Lake | MPILLLLTLLLCSCSPKRTPSSGLPDYSDMGAASDAGQTPS |
Ga0181347_11862053 | 3300017722 | Freshwater Lake | LTLLLCSCSPKNTDNNALPNYEMMQAAEDAGKTPSLK |
Ga0181362_10776041 | 3300017723 | Freshwater Lake | MPLLLLTLLLSSCSPKPADSIVLPRYSDMGAAEDAGN |
Ga0181362_10781782 | 3300017723 | Freshwater Lake | MPLLLIALLLCSCSPKPADSNVLPRYSDMGAASDAGQVKSGNV |
Ga0181362_10841412 | 3300017723 | Freshwater Lake | MPIIFIALLLCSCSPKHEDTTALPRYSDMEAASDAGK |
Ga0181365_10134453 | 3300017736 | Freshwater Lake | MPVLFLALLLSSCSPKKTDNTGLPDYSDMSAAEDAGKAK |
Ga0181365_10514103 | 3300017736 | Freshwater Lake | MPLLLITLLLCSCSPKPADSNVLPRYSDMGAAEDAGAASS |
Ga0181365_10584381 | 3300017736 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAASDAGQVKSGNVK |
Ga0181365_10962894 | 3300017736 | Freshwater Lake | ARIAMRLILLAFLLSSCSPRPANNTGLPNYEMMQAAEDAGKTPSK |
Ga0181365_11032792 | 3300017736 | Freshwater Lake | MPLLLLALCLCSCAPKHTENNVLPNYEYGEMQAAEDAGQTPSK |
Ga0181365_11059121 | 3300017736 | Freshwater Lake | MPLLLVALLLCSCSPKPTDNTLPNYSDMSAAEDAA |
Ga0181365_11219192 | 3300017736 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAASDAG |
Ga0181352_10351375 | 3300017747 | Freshwater Lake | MPLLLLTLLFCSCSPKPADHNNVLPRYSDMGAAEDAGKVK |
Ga0181352_11986771 | 3300017747 | Freshwater Lake | NSIMPLLLLTLCLCSCSPRHTDNNALPSYEMMQAAEDAGKVKSE |
Ga0181356_10581043 | 3300017761 | Freshwater Lake | MPLLLIALLLSSCSPKKTDNTGLPNYSDMSAAEDAGKAK |
Ga0181356_10800793 | 3300017761 | Freshwater Lake | MPILLLIALLLCSCSPRPVENTGLPNYSDMSAAEDAGKAK |
Ga0181356_11169452 | 3300017761 | Freshwater Lake | MPLLLLALCLCSCSPKHTPSSGLPDYSDMGAASDAGKTPSPTLNNK |
Ga0181356_11417011 | 3300017761 | Freshwater Lake | MRLILLAFLFSSCSPRPAENTGLPNYDMMQAAEDA |
Ga0181356_11603542 | 3300017761 | Freshwater Lake | MPLLLLTLLLCSCSPKHTPSSGLPDYSDMGAASDAGKTPSPTLNNKTPY |
Ga0181356_11626431 | 3300017761 | Freshwater Lake | MPLLLLTLLLSSCSPRPVDNTGLPNYDMMQAAEDA |
Ga0181358_10782054 | 3300017774 | Freshwater Lake | MPLLLLTLLFCSCSPKPADSNVLPRYSDMGAASDAGAVS |
Ga0181358_10851893 | 3300017774 | Freshwater Lake | MPLFFIALLLCSCSPKETIKESLTVRYSDMSAAEDAGK |
Ga0181358_10879033 | 3300017774 | Freshwater Lake | MPLILLTLFLCSCSPKHTENNVLPNYEYGEMQAASDAGKTPSPTLNKKTSY |
Ga0181358_11110023 | 3300017774 | Freshwater Lake | MFPDKMPLLLLALFLCSCSPKQHDKGNVNPLLDYNDMGAASDAGQTPSPTLNK |
Ga0181358_11870291 | 3300017774 | Freshwater Lake | MPLLIIALLLSSCSPRLADNTGLPDYSDMSAASEAGQTPSK |
Ga0181357_10414073 | 3300017777 | Freshwater Lake | MPLLLLTLLLSSCSPKQTDNTGLPRYSDMSAAFEA |
Ga0181357_10527714 | 3300017777 | Freshwater Lake | MPLLLLALLLCSCSPKETVKESLPVRYSDMSAAEDA |
Ga0181357_11253221 | 3300017777 | Freshwater Lake | MPILLIALLLSSCSPKQTDNTGLPNYSDMSAAEDAGKAKC |
Ga0181357_11329242 | 3300017777 | Freshwater Lake | MPLLFIAFLLSSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0181349_10584693 | 3300017778 | Freshwater Lake | MPLLLIALLLCSCSPKPADSNVLPRYSDMGAAADAGAVSSGNVK |
Ga0181349_10665512 | 3300017778 | Freshwater Lake | MPLLLLALLLCSCSPKHTPSSGLPDYSDMGAAADAGQTPSPTLNKKTSY |
Ga0181349_10758683 | 3300017778 | Freshwater Lake | MPLLLITLLLCSCSPKPADSNVLPRYSDMGAAEDAGAVSSGNVK |
Ga0181349_10772261 | 3300017778 | Freshwater Lake | MPLLILALLLCSCSPKPADNNVLPRYSDMGAATDAGNVK |
Ga0181349_10784473 | 3300017778 | Freshwater Lake | MPLLLLALLLSSCSPRPVDNTGLPNYDMMQAAFDAGQTPSK |
Ga0181349_11573201 | 3300017778 | Freshwater Lake | MPLLLLTILLCSCSPKSADSNVLPRYSDMGAASDAGAVSSG |
Ga0181349_11969691 | 3300017778 | Freshwater Lake | MPLLLLTLLLSSCSPKPADNTGLPDYSDMSAASEAGQTPSK |
Ga0181349_12256831 | 3300017778 | Freshwater Lake | MPLLLLALLLCSCSPKPADNNVLPRYSDMGAATDAGNVK |
Ga0181349_12787771 | 3300017778 | Freshwater Lake | MPLLLLALCLCSCSPKHTENNVLPNYDYGEMQAAEDAGKTPS |
Ga0181346_11249101 | 3300017780 | Freshwater Lake | MPLLLITLLLCSCSPKPADNNVLPRYSDMGAATDAGN |
Ga0181348_12370551 | 3300017784 | Freshwater Lake | MPLFFIALLLCSCSPKETVKESLTVRYSDMSAAEDAGKTPSTTLNKKT |
Ga0181348_12696751 | 3300017784 | Freshwater Lake | MPLLLLALLFCSCSPKPADNNVLPRYSDMGAAEDAGAVSSG |
Ga0181348_13074532 | 3300017784 | Freshwater Lake | MPLLLLALLLCSCSPKHTDNNALPNYEMMQAAEDAGQTPSK |
Ga0181355_10544751 | 3300017785 | Freshwater Lake | WPRIAMRLILLAFLFSSCSPRPAENTGLPNYDMMQAAEDAGKAPSK |
Ga0181355_10759021 | 3300017785 | Freshwater Lake | MPLLLITLLLCSCSPKKTDNTGLPRYSDMGAAEDAGNVK |
Ga0181355_12778052 | 3300017785 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAATDAGNVK |
Ga0187844_101253962 | 3300018868 | Freshwater | MPLLLIALLLCSCSPKKTDNTGLPNYEMMQAAEDAGKAK |
Ga0187844_101381304 | 3300018868 | Freshwater | MPLLLLALLLSSCSPRPAENTGLPNYDMMQAAEDAGKAK |
Ga0187843_100286242 | 3300019093 | Freshwater | MPLLFLALCLCSCSPKHTENNVLPNYEMMQAAEDAGKVPSQP |
Ga0181359_10026133 | 3300019784 | Freshwater Lake | MPLLLLALLLCSCSPKGTDKESLTVRYSDMSAAEDAGKTPSVK |
Ga0181359_10038053 | 3300019784 | Freshwater Lake | MPLLLLALCLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSLK |
Ga0181359_10042162 | 3300019784 | Freshwater Lake | MRLILLAFLFSSCSPRPAENTGLPNYDMMQAAEDAGKAPSK |
Ga0181359_10111693 | 3300019784 | Freshwater Lake | MPLLLLTLLLCSCSPKPADSNVLPRYSDMGAATDAGNVK |
Ga0181359_10116495 | 3300019784 | Freshwater Lake | MPLLLLALALCLCSCSPKGTDKESLTVRYSDMSAAEDAGKTPR |
Ga0181359_10397003 | 3300019784 | Freshwater Lake | MPLLLLALLLCSCSPKKTDNTGLPNYSDMSAAEDAGKAK |
Ga0181359_10654343 | 3300019784 | Freshwater Lake | MPLLLIALLLCSCSPRPAENTGLPNYDMMQAAEDAGQTPSK |
Ga0181359_10750942 | 3300019784 | Freshwater Lake | MPLLLITLLLCSCSPKETVKESLPVRYSDMSAAEDAGKTPSLK |
Ga0181359_10828742 | 3300019784 | Freshwater Lake | MPLLFIALLLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSLK |
Ga0181359_10868822 | 3300019784 | Freshwater Lake | MPILLLLTLLLCSCSPKRTPSSGLPDYSDMGAASDAGQTPSGTGQGIK |
Ga0181359_10892772 | 3300019784 | Freshwater Lake | MPLLLLALLLCSCSPKQTDNTGLPRYSDMGAAEDAGNVK |
Ga0181359_11214693 | 3300019784 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAASDAGQVKSGN |
Ga0181359_11237982 | 3300019784 | Freshwater Lake | MPLLLLLTLLLCSCSPKPADSNVLPRYSDMGAAADAGAVSSGNVK |
Ga0181359_11318331 | 3300019784 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAATDAGN |
Ga0181359_11443022 | 3300019784 | Freshwater Lake | MPLLIIALLLSSCSPKKTDNTGLPNYSDMSAAEDAGKAK |
Ga0181359_11562703 | 3300019784 | Freshwater Lake | MPLLLLTLLLCSCSPKRTENNVLPNYEYGEMQAAEDAGKTPSPTLNK |
Ga0181359_12028652 | 3300019784 | Freshwater Lake | MPIIFIALLLCSCSPKHEDNNALPRYSDMGAASDAGKVKP |
Ga0181359_12052742 | 3300019784 | Freshwater Lake | MPLLLLTLFLCSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0181359_12253742 | 3300019784 | Freshwater Lake | MRLILLAFLLSSCSPRPANNTGLPNYEMMQAAEDAGKTPSK |
Ga0181359_12322261 | 3300019784 | Freshwater Lake | MPLLLIALLLCSCSPRPVENTGLPDYSDMSAAEDAGKAK |
Ga0181359_12448591 | 3300019784 | Freshwater Lake | MPLLFFAALLCSCSPKAQDSKDMNVLPNYSDMGAAEDAGKAK |
Ga0207937_10104563 | 3300020544 | Freshwater | MPLLLLALLFCSCSPKPVDHNNALPRYSDMSAAEDAMNAGKAK |
Ga0207937_10287181 | 3300020544 | Freshwater | MPLLIITLLLCSCSPRPVDHNNTLPRYSDMGAAEDAG |
Ga0208231_10129833 | 3300020557 | Freshwater | MPLLILTLFFCSCSPKPVDHNNVLPRYSDMGAAEDAGKVK |
Ga0213922_10018616 | 3300021956 | Freshwater | MPLLFITLLLCSCSQRTTDNNALPKYSDMGAAEDAGKAK |
Ga0222712_100464035 | 3300021963 | Estuarine Water | MPILLIAFLLCSCSPKPADNNVLPRYSDMGAAEDAGKVK |
Ga0181354_10205741 | 3300022190 | Freshwater Lake | MPFLLLALCLCSCSPRPAENTGLPDYSDMSAAEDAGKAK |
Ga0181354_10222752 | 3300022190 | Freshwater Lake | MPFLLLALCLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSLK |
Ga0181354_10679453 | 3300022190 | Freshwater Lake | MPLLLLIALLLCSCSPKPADSNVLPRYSDMGAAEDAGAVSSGNA |
Ga0181354_11023442 | 3300022190 | Freshwater Lake | MPLLLIALLLCSCSPKHTENNVLPNYEMMQAAEDAGKTPSVK |
Ga0181354_11211072 | 3300022190 | Freshwater Lake | MKYLILTILLSSCSPKETIKDSLTVRYSDMSAAEDAG |
Ga0181354_11688911 | 3300022190 | Freshwater Lake | MPLFFIALLLCSCSPKETVKESLTVRYSDMSAAEDAGKTPS |
Ga0181351_10027245 | 3300022407 | Freshwater Lake | MPLLLLALLLCSCSPKKHTDNNFLPDYGEMGAASDAGKAK |
Ga0181351_11858922 | 3300022407 | Freshwater Lake | MGTIIMPVLFLALLLSSCSPKKTDNTGLPDYSDMSAAEDAGKAK |
Ga0181351_11882841 | 3300022407 | Freshwater Lake | ARHLMPLLLLALLLCSCSPRPVENMPNYDMMQAAEDAGKAPSK |
Ga0181351_11945762 | 3300022407 | Freshwater Lake | MPLLLLTLLLSSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0214917_1000140138 | 3300022752 | Freshwater | MPLLLLTLFLCSCSPRPADNNVLPRYSDMGAAEDAGKVK |
Ga0214917_100070238 | 3300022752 | Freshwater | MQFIKLVLICFALSSCSPKPADNNVLPRYSDMGAATDAGNVK |
Ga0214917_100149435 | 3300022752 | Freshwater | MPLLFLTLLLCSCSPKPADKNVLPRYSDMGAAEDAGKAK |
Ga0214917_101223664 | 3300022752 | Freshwater | MPLLLLALLLCSCSPRHTDNNALPNYETMQAAEDAGKVKSE |
Ga0214917_103026271 | 3300022752 | Freshwater | RNWPRIAMRLILLAVLLSSCSLKPVDHNNALPRYSDMGAAEDAGKVK |
Ga0214921_100049648 | 3300023174 | Freshwater | MPLLLITLLLCSCSPKQTDNTELPDYSDMGAAADAGKAK |
Ga0214921_100341726 | 3300023174 | Freshwater | MPFLLITLLLCSCSPRPAENTGLPQYSDMSAAEDAGKAK |
Ga0214921_100662414 | 3300023174 | Freshwater | MPILFLAFLLCSCSPKEVQDSPLPNYGEMGAASDAGMAK |
Ga0214923_100742793 | 3300023179 | Freshwater | MKYLAIAVLLSSCSPKNEQANGLPNYSDMGAAADAGKNGEE |
Ga0214923_100927924 | 3300023179 | Freshwater | MPTLALIPVLLLCSCAKKQDNNVLPQYSDMGAAEDAGKTKWTR |
Ga0208916_100015923 | 3300025896 | Aqueous | MPLILLIALLFCSCSPKKHTENNALPDYGEMGAAAEAGRVKSE |
Ga0208916_1000302011 | 3300025896 | Aqueous | MPILLLTLFLCSCSPKHTDNNALPLYSDMGAAEDAGKVK |
Ga0208916_100091625 | 3300025896 | Aqueous | MPLLLITLLLCSCSPRPVDHNNMLPQYSDMGAAEDAGKAK |
Ga0208009_100010522 | 3300027114 | Deep Subsurface | MPLLLITLFLCSCSQRPAESTGLPNYDMMQAAEDAGKTPSK |
Ga0255082_10617781 | 3300027139 | Freshwater | MLILLITLFLCSCSPKQEDNNILPRYSEMGAAADAGAISSGNVK |
Ga0255204_100092611 | 3300027157 | Freshwater | MPLLLLALLLCSCSPKPSDNNVLPRYSDMGAAEDAGKAK |
Ga0209552_10621353 | 3300027563 | Freshwater Lake | MPLLLIALLLCSCSPRPVENTGLPNYSDMSAAEDAGRAK |
Ga0209651_10229232 | 3300027581 | Freshwater Lake | MPLLFIALLLSSCSPKHEDNNALPRYSDMGAASDAGKVNP |
Ga0208974_100014033 | 3300027608 | Freshwater Lentic | MPLLLLALFFCSCSPKKHTENNALPDYGEMGAATDAGQVK |
Ga0208974_10100666 | 3300027608 | Freshwater Lentic | MGTIIMPALFLALLLCSCSPRPVDHNNMLPRYSDMGAAEDAGKVK |
Ga0208974_11702951 | 3300027608 | Freshwater Lentic | MPLLLIALFLCSCSPRPTNNTGLPDYSDMSAAEDAG |
Ga0209357_10383643 | 3300027656 | Freshwater Lake | RITLMPLLFIALLLSSCSPKHEDNNALPRYSDMGAASDAGKVNP |
Ga0209357_10954842 | 3300027656 | Freshwater Lake | MPLLLLTLLLCSCSPRPVENTGLPNYSDMSAAEDAGKAK |
Ga0209617_100010568 | 3300027720 | Freshwater And Sediment | MPLLLLTLFFCSCSPRHTDNNALPNYEMMQAAEDAGKTPSK |
Ga0209617_100055091 | 3300027720 | Freshwater And Sediment | MPILLIALLLCSCSPKPVDHNNALPRYSDLPDYGEMGAASDA |
Ga0209442_12582872 | 3300027732 | Freshwater Lake | MPLLLITLLLCSCSPKPADSNVLPRYSDMGAASDAG |
Ga0209297_10033227 | 3300027733 | Freshwater Lake | MPLLLLALLLCSCSPKKTDNTGLPRYSDMGAASDAGAVSSGNVK |
Ga0209297_11546361 | 3300027733 | Freshwater Lake | TYIKIMKLIFLVLMLLCSCSQRPADNTGLPNYEMMQAAEDAGQTPSK |
Ga0209087_100012832 | 3300027734 | Freshwater Lake | MKLIFLVLMLLCSCSQRPADNTGLPNYEMMQAAEDAGQTPSK |
Ga0209087_100050038 | 3300027734 | Freshwater Lake | MPLLLLTALLCSCSPKKTDNTGLPRYSDMGAAEDAGNVK |
Ga0209190_10083015 | 3300027736 | Freshwater Lake | MKIVLICLFVCSCCPKPEDNNNLLPRYSDMGAAEDAGKAK |
Ga0209190_10281833 | 3300027736 | Freshwater Lake | MPLLLLTLLLCSCSPKKHTENNALPDYGEMGAAADAGQVK |
Ga0209085_100042519 | 3300027741 | Freshwater Lake | MPILLIALLLGSCSPRHTDNNALPRYSDMSAAEDAGRVKSQ |
Ga0209597_10174943 | 3300027746 | Freshwater Lake | MPLLLLALFLCSCSPKHTDNNALPNYEMMQAAEDAGKTPSLK |
Ga0209597_13872551 | 3300027746 | Freshwater Lake | MRWIILALCLCSCSPRQHEQRDVNPLPNYSDMGAADDAGRT |
Ga0209596_100047041 | 3300027754 | Freshwater Lake | MKLLLVALFFCSCSPRHKDNNALPRYSDMGAAEDAGKVK |
Ga0209596_10172269 | 3300027754 | Freshwater Lake | MPLLLLALLLCSCSPRQTETDTQLPRYSDMGAAADAGQVK |
Ga0209296_10119328 | 3300027759 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAAEDAGAVSSGNVK |
Ga0209598_101202163 | 3300027760 | Freshwater Lake | MPLLLITLLLSSCSPRPAENTGLPQYSDMSAAEEAGRTPSK |
Ga0209246_100063417 | 3300027785 | Freshwater Lake | MPLLLLALCLCSCSPKVTVKESLTVRYSDMSAAEDAGKTPSIK |
Ga0209246_101855631 | 3300027785 | Freshwater Lake | DSFQMPILFIALLLCSCSPKPVDHNNVLPRYSDMGAASDAGKVKSE |
Ga0209246_101971401 | 3300027785 | Freshwater Lake | MPLLLLALLLCSCSPKPADSNVLPRYSDMGAAEDAGNV |
Ga0209353_101210031 | 3300027798 | Freshwater Lake | MPLLLLTLLLCSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0209353_101466911 | 3300027798 | Freshwater Lake | MPLLLLIALLLCSCSPKPADSNVLPRYSDMGAAEDAGAVSSGNVK |
Ga0209354_103167152 | 3300027808 | Freshwater Lake | MPLLLLALCLCSCSPKETVKESLPVGYSDMSAAEDAGKTPSLK |
Ga0209298_1000311411 | 3300027973 | Freshwater Lake | MPLVLLTLLLFSCSPRPAENTGLPRYSDMSAAEDAGKAK |
Ga0209298_100118217 | 3300027973 | Freshwater Lake | MPVLLLAILLCSCSPKRDNNVLPRYSDMSAAEDAGKSR |
(restricted) Ga0247834_11359301 | 3300027977 | Freshwater | MPLLLLALLLCSCSPKQHDQRDMHILSNYSDMSAAADAG |
(restricted) Ga0247834_11509534 | 3300027977 | Freshwater | MPLLLLALCLCSCSPKQHDQRDVHRLSNYSDMSAAADAGR |
Ga0247723_100042524 | 3300028025 | Deep Subsurface Sediment | MKLILLSFFLCSCSPKPEHNNILPRYSDMGAAEDAGKVK |
(restricted) Ga0247835_11270991 | 3300028114 | Freshwater | MPLLLLALLLCSCSPKQHDQRDVHRLSNYSDMSAAADAGR |
Ga0304729_100070927 | 3300028392 | Freshwater Lake | MPLLLLALFLCSCSPKHTENNALPNYEMMQAAEDAGRTPSTK |
Ga0304729_10165571 | 3300028392 | Freshwater Lake | MPILFLALLLCSCSPKHTENNVLPNYEMMQAAEDAGKTPSLK |
(restricted) Ga0247832_11431331 | 3300028557 | Freshwater | MPLLLLALLLCSCSPKQHDQRDMHILSNYSDMSAA |
(restricted) Ga0247831_11143021 | 3300028559 | Freshwater | MPLLLLALLLCSCSPKQHDQRDMHILSNYSDMSAAA |
Ga0307380_108651281 | 3300031539 | Soil | PLLLLALLALSSCSKPDYDSLPYTEMEAAKDAGAVK |
Ga0307379_107258782 | 3300031565 | Soil | MPLLLLALLLCSCSPQKDNTGLPRYTEMEAAKDAGAVK |
Ga0307379_112931063 | 3300031565 | Soil | MPLLLLALCLCSCSPKPDYDSLPYTEMEAAKDAGAVK |
Ga0307376_105948012 | 3300031578 | Soil | MRISGLMPLLLLALLLCSCSPQKDNTGLPKYTEMEAAKDAGAVK |
Ga0307377_102298972 | 3300031673 | Soil | MPILLLALLALSSCSKPDYDSLPYTEMEAAKDAGAVK |
Ga0315291_102048622 | 3300031707 | Sediment | MPLLLLALLLCSCSPKETVKESLPVRYSDMSAAEDAGKTPSK |
Ga0315291_103209964 | 3300031707 | Sediment | MPLLLLALLLCSCSPRPVENTGLPNYYSDMQAAED |
Ga0315291_104907501 | 3300031707 | Sediment | MPLLILALLLCSCSPRPVENTGLSNYSDMGAAEDA |
Ga0315288_101075996 | 3300031772 | Sediment | MPLLLLALLLCSCSPRPVENTGLPNYSDMGAAEDAGKTPSK |
Ga0315288_107459202 | 3300031772 | Sediment | MPLLLLTLLLCSCSPRPVENTGLPNYSDMQAAEDAGKTPSK |
Ga0315285_103546001 | 3300031885 | Sediment | MPLLLLALLLCSCSPRPVENTGLPNYSDMQAAEDAGKTPSP |
Ga0315294_104444572 | 3300031952 | Sediment | MPLLLLALFLCSCSPKQHEGKDMNALPIYGDMSAAEEAGKTPSSK |
Ga0315294_105277392 | 3300031952 | Sediment | MPLLLLTLLLCSCSPKTDNTGLPNYEYGDMQAAEDAGRTPSK |
Ga0315274_107096741 | 3300031999 | Sediment | FNHLTPNIIMPLLLLALLLSSCSPKQTDNTGLPNYSDMSAAFEAGQTPSK |
Ga0315289_103962483 | 3300032046 | Sediment | MPLLFLTLLLCSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0315289_112889051 | 3300032046 | Sediment | MPLLLLALFLCSCSPKQHEGKDMNALPIYGDMSAAEEAGK |
Ga0315284_105188223 | 3300032053 | Sediment | MPLLLLTLLLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSFK |
Ga0315284_123153021 | 3300032053 | Sediment | MYPDKMPLLLIALCLCSCSPRQHDQRDVNRLPDYSDMGAAEDAGRT |
Ga0315905_111146303 | 3300032092 | Freshwater | MPLLFIALCLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSLK |
Ga0315277_104476713 | 3300032118 | Sediment | MPLLLLTLCLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSFK |
Ga0315295_115931031 | 3300032156 | Sediment | MYPDKMPLLLLALLLCSCTPRQHDQRDVNSLPRYDDMGAAE |
Ga0315281_103999015 | 3300032163 | Sediment | YLYKNSLMPLLLLTLLLCSCSPKPADSNVLPRYSDMGAAADAGAVSSGNVK |
Ga0315268_111029402 | 3300032173 | Sediment | MPLLLLALLLCSCSPKKHTENNALPDYGEMGAAEDAGKAK |
Ga0315276_104609642 | 3300032177 | Sediment | MPLLLLALLLSSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0315276_115762901 | 3300032177 | Sediment | MPLLLLALLLCSCSPKSADSNVLPRYSDMGAAEDAGNVK |
Ga0315276_122199872 | 3300032177 | Sediment | MYPDKMPLLLLALCLCSCSPRQHDQRDMNLLPRYDDMGAAEDAGRTP |
Ga0315286_102376274 | 3300032342 | Sediment | MPLILLALLLCSCSPKPADSNVLPRYSDMGAAEDAGNVK |
Ga0315286_105243322 | 3300032342 | Sediment | MPLLLLALLLCSCSPKHTENNVLPNYEYGEMQAAEDAGKTPSFK |
Ga0315273_120659984 | 3300032516 | Sediment | LMPLLLLALLLCSCSPRPVENTGLPNYSDMQAAEDAGKTPSK |
Ga0334986_0104247_354_482 | 3300034012 | Freshwater | MPLLLLALLLCSCSPKKHTENNALPDYGEMGAASEAGRVKSE |
Ga0335019_0000225_17326_17454 | 3300034066 | Freshwater | MPLFFIALMLCSCSPRPVDHNNALPRYSDMSAAEDAGKAPSK |
Ga0310143_01612_4602_4730 | 3300034523 | Fracking Water | MPLLLITLLLCSCSPKKHTENNALPDYGEMGAASDAGKVKSE |
⦗Top⦘ |