NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F014284

Metagenome / Metatranscriptome Family F014284

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F014284
Family Type Metagenome / Metatranscriptome
Number of Sequences 264
Average Sequence Length 44 residues
Representative Sequence IPSGGKAFGERFEDTIVRIQPTRIIAFGIDPGETTNARSVGAA
Number of Associated Samples 184
Number of Associated Scaffolds 264

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.52 %
% of genes near scaffold ends (potentially truncated) 96.21 %
% of genes from short scaffolds (< 2000 bps) 92.05 %
Associated GOLD sequencing projects 171
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.697 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(39.015 % of family members)
Environment Ontology (ENVO) Unclassified
(41.288 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.076 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.63%    β-sheet: 19.72%    Coil/Unstructured: 74.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 264 Family Scaffolds
PF00296Bac_luciferase 6.06
PF07883Cupin_2 4.92
PF00150Cellulase 4.55
PF11716MDMPI_N 4.55
PF02657SufE 4.55
PF13302Acetyltransf_3 3.41
PF13191AAA_16 3.03
PF13527Acetyltransf_9 3.03
PF00583Acetyltransf_1 3.03
PF01243Putative_PNPOx 2.65
PF00196GerE 1.89
PF13649Methyltransf_25 1.89
PF104171-cysPrx_C 1.89
PF12680SnoaL_2 1.52
PF09957VapB_antitoxin 1.14
PF04248NTP_transf_9 1.14
PF01641SelR 1.14
PF00486Trans_reg_C 1.14
PF06445GyrI-like 1.14
PF00392GntR 1.14
PF08327AHSA1 1.14
PF00282Pyridoxal_deC 0.76
PF00903Glyoxalase 0.76
PF13398Peptidase_M50B 0.76
PF07969Amidohydro_3 0.76
PF12840HTH_20 0.76
PF02211NHase_beta 0.38
PF00891Methyltransf_2 0.38
PF02627CMD 0.38
PF06210DUF1003 0.38
PF03795YCII 0.38
PF00581Rhodanese 0.38
PF00962A_deaminase 0.38
PF13523Acetyltransf_8 0.38
PF05683Fumerase_C 0.38
PF13412HTH_24 0.38
PF13556HTH_30 0.38
PF07228SpoIIE 0.38
PF00892EamA 0.38
PF01636APH 0.38
PF01593Amino_oxidase 0.38
PF01738DLH 0.38
PF01451LMWPc 0.38
PF08922DUF1905 0.38
PF04229GrpB 0.38
PF00557Peptidase_M24 0.38
PF03640Lipoprotein_15 0.38
PF13006Nterm_IS4 0.38
PF13361UvrD_C 0.38
PF12852Cupin_6 0.38
PF01833TIG 0.38
PF00004AAA 0.38
PF04672Methyltransf_19 0.38
PF08592Anthrone_oxy 0.38
PF12681Glyoxalase_2 0.38
PF13358DDE_3 0.38
PF01553Acyltransferase 0.38
PF00069Pkinase 0.38
PF08241Methyltransf_11 0.38
PF13374TPR_10 0.38
PF13193AMP-binding_C 0.38
PF13411MerR_1 0.38
PF12585DUF3759 0.38

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 264 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 6.06
COG2166Sulfur transfer protein SufE, Fe-S cluster assemblyPosttranslational modification, protein turnover, chaperones [O] 4.55
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 4.55
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 4.55
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.52
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 1.14
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 1.14
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.76
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.38
COG1816Adenosine/6-amino-6-deoxyfutalosine deaminaseNucleotide transport and metabolism [F] 0.38
COG1838Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domainEnergy production and conversion [C] 0.38
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.38
COG2320GrpB domain, predicted nucleotidyltransferase, UPF0157 familyGeneral function prediction only [R] 0.38
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.38
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.38
COG4420Uncharacterized membrane proteinFunction unknown [S] 0.38


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.21 %
UnclassifiedrootN/A28.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10044242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1860Open in IMG/M
3300002245|JGIcombinedJ26739_101379823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium597Open in IMG/M
3300003505|JGIcombinedJ51221_10148256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia947Open in IMG/M
3300003505|JGIcombinedJ51221_10149011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia944Open in IMG/M
3300004103|Ga0058903_1524562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300005162|Ga0066814_10003766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1519Open in IMG/M
3300005338|Ga0068868_100043388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3513Open in IMG/M
3300005363|Ga0008090_10184381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300005434|Ga0070709_10266605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1239Open in IMG/M
3300005435|Ga0070714_100421559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1264Open in IMG/M
3300005435|Ga0070714_100897474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales860Open in IMG/M
3300005436|Ga0070713_100498745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1148Open in IMG/M
3300005439|Ga0070711_101264812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300005445|Ga0070708_100093955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2735Open in IMG/M
3300005445|Ga0070708_101461482Not Available637Open in IMG/M
3300005467|Ga0070706_100072930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3177Open in IMG/M
3300005467|Ga0070706_100122611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2423Open in IMG/M
3300005536|Ga0070697_100231351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1577Open in IMG/M
3300005537|Ga0070730_10062649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2645Open in IMG/M
3300005537|Ga0070730_10093450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2089Open in IMG/M
3300005541|Ga0070733_10074265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2146Open in IMG/M
3300005541|Ga0070733_10609643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300005564|Ga0070664_100430778All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300005577|Ga0068857_100415310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1254Open in IMG/M
3300005591|Ga0070761_10501527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales749Open in IMG/M
3300005602|Ga0070762_10172506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1308Open in IMG/M
3300005602|Ga0070762_10736368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300005610|Ga0070763_10923125Not Available520Open in IMG/M
3300005764|Ga0066903_102152123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1075Open in IMG/M
3300005764|Ga0066903_109010435Not Available505Open in IMG/M
3300005921|Ga0070766_10686045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia692Open in IMG/M
3300006028|Ga0070717_10222482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1659Open in IMG/M
3300006176|Ga0070765_100567946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1068Open in IMG/M
3300006176|Ga0070765_100915190Not Available829Open in IMG/M
3300006176|Ga0070765_101771549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300006358|Ga0068871_100099025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2440Open in IMG/M
3300006579|Ga0074054_12094785Not Available744Open in IMG/M
3300006755|Ga0079222_10055993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1860Open in IMG/M
3300006804|Ga0079221_10631616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava730Open in IMG/M
3300006806|Ga0079220_10247666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1064Open in IMG/M
3300006806|Ga0079220_10385870All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300006806|Ga0079220_12134960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300006854|Ga0075425_100572332Not Available1300Open in IMG/M
3300006954|Ga0079219_10853425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia727Open in IMG/M
3300006954|Ga0079219_11024077Not Available688Open in IMG/M
3300007265|Ga0099794_10204512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1012Open in IMG/M
3300009089|Ga0099828_10548846Not Available1041Open in IMG/M
3300009623|Ga0116133_1121402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300010048|Ga0126373_10088094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2846Open in IMG/M
3300010048|Ga0126373_10165041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2118Open in IMG/M
3300010048|Ga0126373_10363610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1462Open in IMG/M
3300010048|Ga0126373_11820439Not Available672Open in IMG/M
3300010048|Ga0126373_12104430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300010358|Ga0126370_11871719Not Available583Open in IMG/M
3300010359|Ga0126376_12430783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300010360|Ga0126372_10641615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1026Open in IMG/M
3300010360|Ga0126372_13017698Not Available522Open in IMG/M
3300010361|Ga0126378_11789004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300010361|Ga0126378_11816291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300010361|Ga0126378_11947135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia669Open in IMG/M
3300010361|Ga0126378_12772758Not Available560Open in IMG/M
3300010362|Ga0126377_11201935Not Available829Open in IMG/M
3300010362|Ga0126377_13498740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300010376|Ga0126381_101338761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300010376|Ga0126381_104314981Not Available551Open in IMG/M
3300010376|Ga0126381_105060506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300010379|Ga0136449_102768710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces693Open in IMG/M
3300010398|Ga0126383_10741585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1062Open in IMG/M
3300010398|Ga0126383_10937062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300010398|Ga0126383_13000146All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300010401|Ga0134121_12802508Not Available533Open in IMG/M
3300010876|Ga0126361_10529680Not Available562Open in IMG/M
3300010880|Ga0126350_10567795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii895Open in IMG/M
3300011089|Ga0138573_1273592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae984Open in IMG/M
3300012207|Ga0137381_10929416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300012209|Ga0137379_11656940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300012210|Ga0137378_10848907Not Available826Open in IMG/M
3300012351|Ga0137386_10833717All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300012356|Ga0137371_10238300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae1421Open in IMG/M
3300012958|Ga0164299_10845611Not Available658Open in IMG/M
3300012971|Ga0126369_13614362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. TF02-7507Open in IMG/M
3300013307|Ga0157372_10746095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1138Open in IMG/M
3300013308|Ga0157375_11024716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300016270|Ga0182036_10845496Not Available748Open in IMG/M
3300016294|Ga0182041_10848799Not Available818Open in IMG/M
3300016294|Ga0182041_11318898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300016294|Ga0182041_11884464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae555Open in IMG/M
3300016319|Ga0182033_10403937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1155Open in IMG/M
3300016319|Ga0182033_10589500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria965Open in IMG/M
3300016387|Ga0182040_11174896Not Available645Open in IMG/M
3300016404|Ga0182037_10747878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia840Open in IMG/M
3300016422|Ga0182039_10401467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1164Open in IMG/M
3300016422|Ga0182039_11367853Not Available642Open in IMG/M
3300017924|Ga0187820_1064633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1008Open in IMG/M
3300017926|Ga0187807_1219984Not Available618Open in IMG/M
3300017970|Ga0187783_10162351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1645Open in IMG/M
3300017970|Ga0187783_11306664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300017972|Ga0187781_11412217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium515Open in IMG/M
3300017974|Ga0187777_10312034Not Available1076Open in IMG/M
3300018058|Ga0187766_11085330All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300018062|Ga0187784_10827439Not Available738Open in IMG/M
3300018085|Ga0187772_10151541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1533Open in IMG/M
3300018085|Ga0187772_10325067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1058Open in IMG/M
3300018085|Ga0187772_10511894Not Available847Open in IMG/M
3300018086|Ga0187769_10639678Not Available804Open in IMG/M
3300018089|Ga0187774_10152690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1213Open in IMG/M
3300021088|Ga0210404_10721003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300021171|Ga0210405_11284635Not Available538Open in IMG/M
3300021171|Ga0210405_11383068All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300021374|Ga0213881_10028638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2326Open in IMG/M
3300021374|Ga0213881_10269901Not Available757Open in IMG/M
3300021402|Ga0210385_11103558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava609Open in IMG/M
3300021403|Ga0210397_11130990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii609Open in IMG/M
3300021405|Ga0210387_10957928Not Available751Open in IMG/M
3300021406|Ga0210386_10412326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1165Open in IMG/M
3300021406|Ga0210386_10659434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia902Open in IMG/M
3300021406|Ga0210386_11372295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300021432|Ga0210384_11503958Not Available579Open in IMG/M
3300021477|Ga0210398_10362291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1182Open in IMG/M
3300021479|Ga0210410_10837861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300021559|Ga0210409_10937755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava740Open in IMG/M
3300021560|Ga0126371_11148435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300022522|Ga0242659_1041701Not Available787Open in IMG/M
3300022722|Ga0242657_1116042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300022724|Ga0242665_10150841Not Available734Open in IMG/M
3300025464|Ga0208076_1024134Not Available1054Open in IMG/M
3300025634|Ga0208589_1141454Not Available551Open in IMG/M
3300025898|Ga0207692_11117503Not Available522Open in IMG/M
3300025903|Ga0207680_11148953Not Available554Open in IMG/M
3300025906|Ga0207699_10259213Not Available1201Open in IMG/M
3300025915|Ga0207693_10738852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300025916|Ga0207663_10038733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2884Open in IMG/M
3300025921|Ga0207652_10135564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2198Open in IMG/M
3300025922|Ga0207646_11891309Not Available509Open in IMG/M
3300025928|Ga0207700_10991343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava752Open in IMG/M
3300025929|Ga0207664_10171500All Organisms → cellular organisms → Bacteria1857Open in IMG/M
3300025929|Ga0207664_10187596All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300025929|Ga0207664_10657127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300025929|Ga0207664_11771155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava540Open in IMG/M
3300025945|Ga0207679_11996426All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium528Open in IMG/M
3300026118|Ga0207675_102471577All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium531Open in IMG/M
3300026551|Ga0209648_10546921Not Available649Open in IMG/M
3300027119|Ga0209522_1032617All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300027652|Ga0209007_1172692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii533Open in IMG/M
3300027857|Ga0209166_10236128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia974Open in IMG/M
3300027911|Ga0209698_11069034Not Available599Open in IMG/M
3300028792|Ga0307504_10308819Not Available598Open in IMG/M
3300028801|Ga0302226_10223210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300028906|Ga0308309_11302297Not Available625Open in IMG/M
3300030511|Ga0268241_10141724Not Available583Open in IMG/M
3300030741|Ga0265459_10646343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300031446|Ga0170820_12497986All Organisms → cellular organisms → Bacteria → Terrabacteria group696Open in IMG/M
3300031545|Ga0318541_10775934Not Available535Open in IMG/M
3300031546|Ga0318538_10722131Not Available540Open in IMG/M
3300031549|Ga0318571_10122670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300031561|Ga0318528_10070920Not Available1794Open in IMG/M
3300031564|Ga0318573_10057418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1916Open in IMG/M
3300031564|Ga0318573_10356703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300031572|Ga0318515_10410984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300031573|Ga0310915_10597131Not Available782Open in IMG/M
3300031640|Ga0318555_10086791Not Available1635Open in IMG/M
3300031640|Ga0318555_10447372All Organisms → cellular organisms → Bacteria → Terrabacteria group700Open in IMG/M
3300031679|Ga0318561_10650377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300031680|Ga0318574_10928115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava510Open in IMG/M
3300031708|Ga0310686_112148915Not Available629Open in IMG/M
3300031708|Ga0310686_119508672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6225Open in IMG/M
3300031713|Ga0318496_10316688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300031719|Ga0306917_10245573All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300031719|Ga0306917_11143469Not Available605Open in IMG/M
3300031723|Ga0318493_10842616Not Available517Open in IMG/M
3300031724|Ga0318500_10145772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1111Open in IMG/M
3300031744|Ga0306918_10609853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria855Open in IMG/M
3300031744|Ga0306918_11293635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300031748|Ga0318492_10192022Not Available1043Open in IMG/M
3300031748|Ga0318492_10482771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium656Open in IMG/M
3300031751|Ga0318494_10218104Not Available1090Open in IMG/M
3300031751|Ga0318494_10437082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium761Open in IMG/M
3300031763|Ga0318537_10165461Not Available824Open in IMG/M
3300031764|Ga0318535_10055789Not Available1661Open in IMG/M
3300031764|Ga0318535_10090981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1328Open in IMG/M
3300031765|Ga0318554_10085964All Organisms → cellular organisms → Bacteria1758Open in IMG/M
3300031770|Ga0318521_10303954All Organisms → cellular organisms → Bacteria → Terrabacteria group939Open in IMG/M
3300031770|Ga0318521_10317102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia920Open in IMG/M
3300031770|Ga0318521_10780531Not Available582Open in IMG/M
3300031770|Ga0318521_10966719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae521Open in IMG/M
3300031771|Ga0318546_10437243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia915Open in IMG/M
3300031778|Ga0318498_10056746All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300031778|Ga0318498_10073761Not Available1535Open in IMG/M
3300031779|Ga0318566_10228296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria924Open in IMG/M
3300031779|Ga0318566_10556310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300031781|Ga0318547_10248888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1071Open in IMG/M
3300031781|Ga0318547_10436592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300031781|Ga0318547_11028137All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031782|Ga0318552_10549854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300031782|Ga0318552_10594099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300031782|Ga0318552_10605794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300031782|Ga0318552_10730482Not Available505Open in IMG/M
3300031793|Ga0318548_10666564Not Available505Open in IMG/M
3300031794|Ga0318503_10172598All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031794|Ga0318503_10312926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300031819|Ga0318568_10171739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1332Open in IMG/M
3300031821|Ga0318567_10485408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300031832|Ga0318499_10244140Not Available698Open in IMG/M
3300031845|Ga0318511_10316321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300031846|Ga0318512_10422093Not Available671Open in IMG/M
3300031859|Ga0318527_10017164All Organisms → cellular organisms → Bacteria2518Open in IMG/M
3300031859|Ga0318527_10131281Not Available1043Open in IMG/M
3300031859|Ga0318527_10161652Not Available942Open in IMG/M
3300031860|Ga0318495_10370938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium633Open in IMG/M
3300031860|Ga0318495_10435158Not Available576Open in IMG/M
3300031879|Ga0306919_10246154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso8991344Open in IMG/M
3300031890|Ga0306925_11049837All Organisms → cellular organisms → Bacteria → Terrabacteria group827Open in IMG/M
3300031896|Ga0318551_10031478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2572Open in IMG/M
3300031896|Ga0318551_10112147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1462Open in IMG/M
3300031896|Ga0318551_10363227Not Available820Open in IMG/M
3300031897|Ga0318520_10344825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300031897|Ga0318520_10405678Not Available833Open in IMG/M
3300031910|Ga0306923_11898447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae608Open in IMG/M
3300031912|Ga0306921_11851050Not Available647Open in IMG/M
3300031941|Ga0310912_11467137Not Available514Open in IMG/M
3300031942|Ga0310916_10045380All Organisms → cellular organisms → Bacteria3331Open in IMG/M
3300031942|Ga0310916_10422167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1135Open in IMG/M
3300031945|Ga0310913_11016828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia pini581Open in IMG/M
3300031954|Ga0306926_11451116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300031959|Ga0318530_10074523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1319Open in IMG/M
3300032001|Ga0306922_10921576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300032008|Ga0318562_10713104All Organisms → cellular organisms → Eukaryota → Sar576Open in IMG/M
3300032009|Ga0318563_10328780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia827Open in IMG/M
3300032010|Ga0318569_10095633All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300032010|Ga0318569_10115733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1219Open in IMG/M
3300032010|Ga0318569_10125601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300032025|Ga0318507_10096716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1227Open in IMG/M
3300032025|Ga0318507_10353628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300032041|Ga0318549_10454556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300032043|Ga0318556_10286996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria860Open in IMG/M
3300032044|Ga0318558_10099752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1358Open in IMG/M
3300032052|Ga0318506_10081597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1358Open in IMG/M
3300032052|Ga0318506_10157790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia994Open in IMG/M
3300032052|Ga0318506_10201672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria878Open in IMG/M
3300032055|Ga0318575_10390609Not Available706Open in IMG/M
3300032055|Ga0318575_10423175Not Available676Open in IMG/M
3300032060|Ga0318505_10524446Not Available558Open in IMG/M
3300032063|Ga0318504_10089760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1362Open in IMG/M
3300032066|Ga0318514_10599405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300032066|Ga0318514_10716907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora amethystogenes532Open in IMG/M
3300032068|Ga0318553_10022334All Organisms → cellular organisms → Bacteria2958Open in IMG/M
3300032068|Ga0318553_10468970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300032090|Ga0318518_10217604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia979Open in IMG/M
3300032090|Ga0318518_10674447Not Available526Open in IMG/M
3300032180|Ga0307471_104031075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora takensis519Open in IMG/M
3300032261|Ga0306920_101927701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia830Open in IMG/M
3300032261|Ga0306920_102453386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria718Open in IMG/M
3300032261|Ga0306920_103275100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300032770|Ga0335085_10122370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3317Open in IMG/M
3300032770|Ga0335085_10408296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1574Open in IMG/M
3300032782|Ga0335082_10507802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300032892|Ga0335081_11311184Not Available816Open in IMG/M
3300032895|Ga0335074_10343867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus albus1665Open in IMG/M
3300032895|Ga0335074_10689593Not Available988Open in IMG/M
3300032896|Ga0335075_10187593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2499Open in IMG/M
3300032896|Ga0335075_10544129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava1170Open in IMG/M
3300032955|Ga0335076_10048927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4200Open in IMG/M
3300033134|Ga0335073_11126253All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300033290|Ga0318519_10320995Not Available910Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil39.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.17%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.76%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.76%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.76%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.38%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.38%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.38%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.38%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.38%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.38%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.38%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004103Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011089Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025464Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1004424253300001867Forest SoilTVVPTGGKAFGDRFEDTIVRIHPTRIIAFGIDSTESANARSISSP*
JGIcombinedJ26739_10137982313300002245Forest SoilKAFGDNFDDTIVRIHPRRIISFGINPGEQAANARSVNSA*
JGIcombinedJ51221_1014825613300003505Forest SoilGTATVVPSGGKAFGERFEDTIVRIQPTRIISFGVDPGETTTARSVTAT*
JGIcombinedJ51221_1014901123300003505Forest SoilGTATVVPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT*
Ga0058903_152456223300004103Forest SoilGTATVIPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT*
Ga0066814_1000376633300005162SoilVIPSGGKAIMERFEDTIVRIQPTRIISFGIDSAESANARSVGAA*
Ga0068868_10004338853300005338Miscanthus RhizosphereAEVRTEGGKAFGDRFEDTIVRIRPARIISFGINPGEEAMTARSV*
Ga0008090_1018438123300005363Tropical Rainforest SoilMIEIRGTAAVIPSGGKAFGEQFEDTIVRIQPTRIISAGIDPGGSRNARSVGPA*
Ga0070709_1026660533300005434Corn, Switchgrass And Miscanthus RhizosphereAAVIPSGGKAFGERFEDTIVRIQPTRIISFGIDSAESRNARSVGAA*
Ga0070714_10042155913300005435Agricultural SoilGTAEVLSSGGKALSDNFEDTIVRITPVRIIAFGIDSEDRGMNARSVTPGS*
Ga0070714_10089747433300005435Agricultural SoilIPSGGKAFGERFEDTIVRIQPTRIISFGIDSAESRNARSVGEA*
Ga0070713_10049874533300005436Corn, Switchgrass And Miscanthus RhizosphereIRGTAEVLSSGGKALSDNFEDTIVRITPVRIIAFGIDSEDRGMNARSVTPGS*
Ga0070711_10126481213300005439Corn, Switchgrass And Miscanthus RhizosphereGKAFGERFEDTIVRIQPTRIISFGIGPGESADARSVGPA*
Ga0070708_10009395533300005445Corn, Switchgrass And Miscanthus RhizosphereIPSGGKAFGERFDDAIVRIQPTRIVAAGIDEGELARNARSVSTA*
Ga0070708_10146148213300005445Corn, Switchgrass And Miscanthus RhizosphereRGTATVLPEGGKALNERFEDTVVRIQPTRIISFGIDSGDLTANARSVGAT*
Ga0070706_10007293043300005467Corn, Switchgrass And Miscanthus RhizosphereGGKAFGERFEDTIVRIRPTRIISFGIDPGETTTARSVTAT*
Ga0070706_10012261143300005467Corn, Switchgrass And Miscanthus RhizosphereRMIEVRGTAEVIDSGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVTPA*
Ga0070697_10023135113300005536Corn, Switchgrass And Miscanthus RhizosphereRMIEVRGSASVVPSGGKAFGEQFEDTVVRIRPARIIAFGIDPGEQANVRSVSASGQ*
Ga0070730_1006264913300005537Surface SoilNERFDDTIVRIRPTRIIAFGIDPGSSAANARTVVAS*
Ga0070730_1009345013300005537Surface SoilAFGDRFEDTIVRIQPTRIIAFGIDPGETTTARSVTT*
Ga0070733_1007426533300005541Surface SoilGSGGKAFGEGFEDTIVRIQPTRIIAFGIDPGETTTNARSVPAT*
Ga0070733_1060964323300005541Surface SoilVRGTAEVVPSGGKAFGEQFEDTIVRIRPTRIVAFGIDSGDRSSNARSVGGA*
Ga0070664_10043077813300005564Corn RhizosphereVSTEGGKAFGDRFEDTIVRIRPTRIISFGINPGEEAMTARSV*
Ga0068857_10041531013300005577Corn RhizosphereGGKALGDAFEDTIVRIRPARIISFGINPGEQSTTARSV*
Ga0070761_1050152733300005591SoilTVIPSGGKAFGERFEDTIVRIQPTRIIAFGIDSDETTSARSVKAPER*
Ga0070762_1017250613300005602SoilERFEDTIVRIRPTRIIAFGIDPGDAANARSVSAP*
Ga0070762_1073636833300005602SoilERFEDTIVRIQPTRIISFGIDPGETTTARSVGAT*
Ga0070763_1092312523300005610SoilGGKAFGEQFEDTIVRIQPTRIISFGIDPGQTTTARSVTAT*
Ga0066903_10215212313300005764Tropical Forest SoilGGKAFGDAFEDTIVRIRPARIISFGINPGEQSMTARSV*
Ga0066903_10901043513300005764Tropical Forest SoilKATFGDNFEETIVRIRPVRIVAFGIDPGGSANARSVS*
Ga0070766_1068604533300005921SoilAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT*
Ga0070717_1022248253300006028Corn, Switchgrass And Miscanthus RhizosphereSGGKALSDNFEDTIVRITPVRIIAFGIDSEGYAANARSVTPGS*
Ga0070765_10056794613300006176SoilRGTATVVPSGGKAFGERFEDTIVRIQPVRIISFGIDPGETTTARSVTDLRE*
Ga0070765_10091519013300006176SoilKALGERMDDTFVRIQPTRIISLGIDPGETRARSVHPDGA*
Ga0070765_10177154913300006176SoilGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT*
Ga0068871_10009902543300006358Miscanthus RhizosphereIEVRGTAAVIPSGGKAFGERFEDTIVRIQPTRIISFGIDSAESRNARSVGEA*
Ga0074054_1209478523300006579SoilMIEVRGTAAVVPSGGKAFGERFEDTIVRIQPARIISFGIDPGETASARSVSPA*
Ga0079222_1005599333300006755Agricultural SoilEGGKALGDAFEDTVVRIRPARIISFGINPGEQAMTARSV*
Ga0079221_1063161623300006804Agricultural SoilSGGKALSDNFEDTIVRITPVRIIAFGIDSEDRGMNARSVTPGS*
Ga0079220_1024766613300006806Agricultural SoilIRGTAEVSPEGGKALGDAFEDTIVRIRPARIISFGINPGEQAMTARSV*
Ga0079220_1038587013300006806Agricultural SoilAFGERFDDAIVRIQPTRIVAAGIDEGELTRNARSVSA*
Ga0079220_1213496013300006806Agricultural SoilEVRGTAAVIPSGGKAFGERFEDTIVRIQPTRIISFGIGPGESADARSVGPA*
Ga0075425_10057233213300006854Populus RhizosphereAEVSTEGGKAFGDAFENTIVRIRPIRIISFGINPGEQSMNARSV*
Ga0079219_1085342513300006954Agricultural SoilRMIEVRGIAEVVPVGGKAFGDGFEDTIVRIHPRRIISFGINPGEQTTNARSVGTG*
Ga0079219_1102407723300006954Agricultural SoilGGKATFGDNFEETVVRIRPVRIVAFGIDPGGSANARSV*
Ga0099794_1020451233300007265Vadose Zone SoilGKAFGDNFDDTIVRIHPRRIISFGINPGEQAANARSVNSA*
Ga0099828_1054884613300009089Vadose Zone SoilGGKAFGERFEVIIVRIQPTRIISFGIDSDQVTTNARSVSAT*
Ga0116133_112140213300009623PeatlandTAEVLGSGGKATFGDNFEDTIVRIRPTRIIAFGIDPGDTANARSV*
Ga0126373_1008809453300010048Tropical Forest SoilAVVPSGGKAFGEQFEDTIVRIQPARIISAGIDPGGSRNARSVGPA*
Ga0126373_1016504123300010048Tropical Forest SoilVIPSGGKAFGDRFDDAIVRIQPTRIVAVGIDEGELTRNARSVGTA*
Ga0126373_1036361013300010048Tropical Forest SoilIDSGGKAFGENFEDTIVRIRPTRIISFGIDSDLKVGARSVSVA*
Ga0126373_1182043923300010048Tropical Forest SoilRFEDAIVRIQPTRIVAAGIDEGELARNARSVSTA*
Ga0126373_1210443013300010048Tropical Forest SoilTAEVISSGGKAFGENFEDTIVRIQPVRIISFGMDPANPAMNARSVPAG*
Ga0126370_1187171913300010358Tropical Forest SoilRFEDTIVRIQPTRIVSFGIDDGALSANSRSVGTS*
Ga0126376_1243078313300010359Tropical Forest SoilAGGKAFGERFEDTIVRIRPTRIIAFGIDPGETTNARSVNAT*
Ga0126372_1064161533300010360Tropical Forest SoilGTAAVVPSGGKAFGEGFEDTIVRIQPTRIISIGIDSGESRNARSVGAA*
Ga0126372_1301769813300010360Tropical Forest SoilRGSADVIDSGGKAFGENFEDTIVRIKPARIISYGIDSGPKAGARSVTPA*
Ga0126378_1178900423300010361Tropical Forest SoilFGERFEDTIVRIRPTRIIAFGIDPGETTNARSVNAT*
Ga0126378_1181629123300010361Tropical Forest SoilVIDSGGKAFGKNFEDTIVRIKPARIISYGIDSDPRAGARSVTPA*
Ga0126378_1194713523300010361Tropical Forest SoilAVVQSGGKALNERFEDTIVRIQPTRIISFGIESGETPSARSVSAT*
Ga0126378_1277275823300010361Tropical Forest SoilAAVIPSGGKAFGERFDDAIVRIQPTRIVAAGIDEGESAGNARSVGTA*
Ga0126377_1120193533300010362Tropical Forest SoilAAVIPSGGKAFGERFEDAIVRIQPTRIVAAGIDEGELARNARSVTTA*
Ga0126377_1349874013300010362Tropical Forest SoilIPAGGKAFGERFEDTIVRIRPARIIAFGIDPGDATNARSVNAT*
Ga0126381_10133876113300010376Tropical Forest SoilIPSGGKAIMEQFEDTIVRIKPARIISFGIDSGESRNARSV*
Ga0126381_10431498113300010376Tropical Forest SoilPRMIEIRGTAAVIPSGGKAFGERFDDAIVRIRPARIVAAGIDEGELARNARSVSTA*
Ga0126381_10506050613300010376Tropical Forest SoilKAFGEQFEDTIVRIQPTRIISFGIDSAESANTRSVGAG*
Ga0136449_10276871013300010379Peatlands SoilMIEVRGSAEVVSSGGKAFGEQFEDTIVRIRPARIIAFGIESEDLTTNARSVTAS*
Ga0126383_1074158523300010398Tropical Forest SoilVIPSGGKAFGEQFEDTIVRIQPTRVVSFGIDSSESRNARSVGPP*
Ga0126383_1093706213300010398Tropical Forest SoilIRGTAEVLDTGGKAWGKQFDDTIVRIHPTRIISFGMDSENPAMEARSVTPA*
Ga0126383_1300014623300010398Tropical Forest SoilFGENFEDTIVRITPARIISIGIESEDFGANARSVGPGS*
Ga0134121_1280250823300010401Terrestrial SoilATFGDNFEETIVRIRPVRIVAFGIDPGESMNARSVG*
Ga0126361_1052968013300010876Boreal Forest SoilIPSGGKAFGEQFEDTIVRIQPTRIISFGIDPGETTTARSVT*
Ga0126350_1056779523300010880Boreal Forest SoilGKAFGDNFDDTIVRIHPRRIISFGINPGEQAANARSVNSG*
Ga0138573_127359233300011089Peatlands SoilRMIEIRGTAMVIPSGGKAFGERFEDTIVRIQPTRIIAFGIDPGDTANARSVSAP*
Ga0137381_1092941623300012207Vadose Zone SoilAVIPSGGKAFGERFEDTIVRIQPTRIISMGIDPGEWANARSVGTA*
Ga0137379_1165694023300012209Vadose Zone SoilGERFEDTIVRIQPTRIISFGINSGELTTNARSVSAT*
Ga0137378_1084890723300012210Vadose Zone SoilEVRGTAAVIPSGGKAFGERFEDTIVRIRPTRIISFGIDPGETASARSVSSAQPPPDR*
Ga0137386_1083371723300012351Vadose Zone SoilVVSEGGKAINERFEDTIVRIQPTRIIAFGIDAADAAASARSVGTS*
Ga0137371_1023830033300012356Vadose Zone SoilVRGTADVIPSGGKAFGERFEDTIVRIQPTRIISIGIDPGEWANARSVGTAGN*
Ga0164299_1084561123300012958SoilVSPEGGKALGDAFEDTVVRIRPARIISFGINPGEQSTTARSV*
Ga0126369_1361436223300012971Tropical Forest SoilVIPSGGKAFGERFDDAIVRIQPTRIVAVGIDEGELTRNARSVGTA*
Ga0157372_1074609513300013307Corn RhizosphereKAFGENFDDTIVRIRPQRIVSFGIDAEAEGITARDA*
Ga0157375_1102471633300013308Miscanthus RhizosphereEGGKAFGDRFEDTIVRIRPTRIISFGINPGEEAMTARSV*
Ga0182036_1084549613300016270SoilMIEIRGTATVIPSGGKAFGERFDDAIVRIQPARIVAAGIDEGELTRNARSVSTA
Ga0182041_1084879913300016294SoilPSGGKAFGERFDDAIVRIQPTRIVAAGIDEGELTRNARSVSTA
Ga0182041_1131889813300016294SoilGGKAFGERFEDTVVRIQPTRIVSIGIESGEMTTSARSVSAT
Ga0182041_1188446413300016294SoilIRGNAAVIPSGGKAFGERFEDTIVRIRPTRIISFGIDPGETSSARSVSAV
Ga0182033_1040393713300016319SoilMIEVRGSASVIPHGGKAFGEQFEDTIVRIQPTRIITFGIDPGDRPNARSVSASGQ
Ga0182033_1058950013300016319SoilGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVTSA
Ga0182040_1117489613300016387SoilGGKAFGERFEDTIVRIQPTRIIAFGINPDGATNARSVGAS
Ga0182037_1074787813300016404SoilKAFGPRFEDTIVRIQPTRIISMGIEATQQGAHARSVGTA
Ga0182039_1040146723300016422SoilEVRGTAEVIDSGGKAFGENFEDTIVRIKPARIISFGIDSDLTVGARSVTVA
Ga0182039_1136785323300016422SoilFGERFDDAIVRIQPARIVAAGIDEGELARNARSVSTA
Ga0187820_106463313300017924Freshwater SedimentGKAFGERFEDTIVRIQPTRIIAFGIDPGDGTNARSVEA
Ga0187807_121998413300017926Freshwater SedimentATVIPSGGKALGERFEDTIVRIQPTRIISFGIEPSETASARSVSTA
Ga0187783_1016235113300017970Tropical PeatlandVRGTASVIPSGGKAFGERFEDTIVRIQPTRIVSFGIDSGEPGSNARSVGGT
Ga0187783_1130666413300017970Tropical PeatlandASVIPSGGKVFGERFEDTIVRIQPTRIVAFGIDSGELGSNARSVGAT
Ga0187781_1141221723300017972Tropical PeatlandFIEIRGTAAVVPSGGKALGEQFEDTIVRIQPTRIISFGIDPGPTSARSVSAS
Ga0187777_1031203423300017974Tropical PeatlandSGGKAFGERFEDTIVRIHPTRIISFGVDPDTATNARSVSVT
Ga0187766_1108533013300018058Tropical PeatlandVRGTGAVLPSGGKAFGERFEDTIVRIQPTRIISSGIDSGETASARSVS
Ga0187784_1082743913300018062Tropical PeatlandIPSGGKAFGERFEDTIVRIQPTRIIAFGIDPGETTNARSVGAA
Ga0187772_1015154113300018085Tropical PeatlandVFGERFEDTIVRIQPTRVISFGIDPGETASARSVSTT
Ga0187772_1032506713300018085Tropical PeatlandAFGERFEDTIVRIQPTRIIAFGIDPGDSTNARSVGAT
Ga0187772_1051189433300018085Tropical PeatlandGKAFGERFEDTIVRIQPTRIIAFGIDPGDSTNARSVGAT
Ga0187769_1063967813300018086Tropical PeatlandTAAVVPLGGKAFGERFEDTIVRIQPTRIISFGIDPGETTSARSVSTT
Ga0187774_1015269033300018089Tropical PeatlandKAFGERFEDTIVRIQPTRIIAIGIDPGESANARSVGTA
Ga0210404_1072100323300021088SoilKAFGERFEDTIVRIQPARIISFGIDPGETASARSVSPAQLPPDR
Ga0210405_1128463523300021171SoilTVGPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT
Ga0210405_1138306813300021171SoilTAIVVPSGGKSFGERFEDTIVRIQPTRIISFGVDPGETTTARSVTAT
Ga0213881_1002863843300021374Exposed RockFGDRFEDTIVRIQPTRIISFGIGPGESAHARSVGAE
Ga0213881_1026990123300021374Exposed RockSGGKAFGERFEDTIVRIQPTRIVAFGIDDGEASNARSVNPS
Ga0210385_1110355813300021402SoilEIRGTAEVVASGGKALSDNFEDTIVRITPVRIIAFGIDSGDRGMNARSVPPGS
Ga0210397_1113099013300021403SoilVRGTAEVVPDGGKALRDNFEDTIIRIYPRRIISFGINPGEQAMNARSVNPG
Ga0210387_1095792813300021405SoilVIPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVATT
Ga0210386_1041232613300021406SoilVTYGGKAFGDNFDDTIVRIHPRRIISFGINPGEQAANARSVNPG
Ga0210386_1065943413300021406SoilGTATVVPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT
Ga0210386_1137229523300021406SoilRGTAEVVSSGGKAFGDNFEDTIVRIRPRRIISYGINPGEQAANARSVNPD
Ga0210384_1150395823300021432SoilVRGTAAVIPSGGKAFGERFEDTIVRIRPTRIISFGIDPGETASARSVSPAQLPPDR
Ga0210398_1036229113300021477SoilGGKATFGDSVEDTFIRIRPTRIISYGINAGDATTSARSVNSA
Ga0210410_1083786113300021479SoilFGERFEDPIVRIQPTRIISFGVDPGETTTARSVTAT
Ga0210409_1093775523300021559SoilAEVIASGGKALSDNFEDTIVRITPVRIIAFGIDSGDRGMNARSVPPGS
Ga0126371_1114843513300021560Tropical Forest SoilIEVRGTAEVATGGKAFGERFDDTDVRISPLRIIAFGIDADDLESNARSVR
Ga0242659_104170113300022522SoilVVPSGGKAFGERFEDTIVRIQPTRIISFGVDPGETTTARSVTAT
Ga0242657_111604233300022722SoilFGERFEDTIVRIQPTRIISFGVDPGETTTARSVTAT
Ga0242665_1015084133300022724SoilPSGGKAFGERFEDTIVRIQPTRIISFGVDPGETTTARSVTAT
Ga0208076_102413413300025464Arctic Peat SoilGGKAFGDNFEDTIVRIRPARIIAFGIDPGDSANARSI
Ga0208589_114145423300025634Arctic Peat SoilTVIPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTTT
Ga0207692_1111750323300025898Corn, Switchgrass And Miscanthus RhizosphereAEVSTEGGKAFGDRFEDTIVRIRPTRIISFGINPGEEAMTARSV
Ga0207680_1114895313300025903Switchgrass RhizospherePSGGKAFGERFEDTIVRIQPTRIISFGIDSAESRNARSVGAA
Ga0207699_1025921333300025906Corn, Switchgrass And Miscanthus RhizosphereMIEVRGAAEVLAAGGKATFGDNFEETIVRIRPVRIVAFGIDPGESMNARSVG
Ga0207693_1073885223300025915Corn, Switchgrass And Miscanthus RhizosphereLPGGGKATFGDNFEETIVRIRPVRIVAFGIDPGGSANARSVG
Ga0207663_1003873333300025916Corn, Switchgrass And Miscanthus RhizosphereEIRGTAEVSPEGGKALGDAFEDTIVRIRPARIISFGINPGEQSTTARSV
Ga0207652_1013556413300025921Corn RhizosphereGKAFGDGFDDTIVRIHPRRIISFGINPGEQTTNARSVGAG
Ga0207646_1189130913300025922Corn, Switchgrass And Miscanthus RhizosphereKALNERFEDTVVRIQPTRIISFGIDSGDLTANARSVGAT
Ga0207700_1099134313300025928Corn, Switchgrass And Miscanthus RhizosphereGKAWGGNFEDTIVRITPVRIIAFGIDSEGYGANARSVTPGS
Ga0207664_1017150013300025929Agricultural SoilAIFGDRVEDTFLRIYPRRIISFGINPEATTNARSVNSD
Ga0207664_1018759643300025929Agricultural SoilAAGGKAFGDNFEDTIVRIYPRRIISYGINPGEQAMNARSVDPA
Ga0207664_1065712713300025929Agricultural SoilSGGKALSDNFEDTIVRITPVRIIAFGIDSEDRGMNARSVTPGS
Ga0207664_1177115523300025929Agricultural SoilGGKALSDNFEDTIVRITPVRIIAFGIDSEDRGMNARSVTPGS
Ga0207679_1199642613300025945Corn RhizosphereTAEVSTEGGKAFGDRFEDTIVRIRPTRIISFGINPGEEAMTARSV
Ga0207675_10247157713300026118Switchgrass RhizosphereEGGKAFGDRFEDTIVRIRPTRIISFGINPGEEAMTARSV
Ga0209648_1054692123300026551Grasslands SoilEIRGTATVIPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT
Ga0209522_103261713300027119Forest SoilSGGKALSDNFEDTIVRITPVRIIGFGIDSEDRGMNARSVTPGS
Ga0209007_117269223300027652Forest SoilGTAQVLPSGGKALGDNFEDTIVRITPTRIISLGIDSAGHGANARSISPA
Ga0209166_1023612823300027857Surface SoilALNERFDDTIVRIRPTRIIAFGIDPGSSAANARTVVAS
Ga0209698_1106903433300027911WatershedsAAVLPAGGKAFGDRFEDTIVRIQPTRIISMGLGSGEMRTSARSVPAS
Ga0307504_1030881913300028792SoilGGKAFGERFEDTIVRIRPTRIISFGIDPGETASARSVSPAQPPPDR
Ga0302226_1022321033300028801PalsaGERFEDTIVRIQPTRIISFGIDSDETTSARSVTAT
Ga0308309_1130229713300028906SoilPRMIEIRGTAQVIPSGAKALGERMDDTFVRIQPTRIISLGIDPGETRARSVHPDGA
Ga0268241_1014172423300030511SoilGTAVVVPSGGKAFGERFEDTIVRIQPTRIISFGIESDEMGTNARWVNAS
Ga0265459_1064634333300030741SoilVIPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTSARSVTAT
Ga0170820_1249798613300031446Forest SoilMIEIRGTATVVAEGGKALNDRFEDTIVRIQPARIISFGIESGDVTANARSVNST
Ga0318541_1077593423300031545SoilMIEIRGTAAVIASGGKAFGERFDDAIVRIQPARIVAAGIDEGELARNARSVSTA
Ga0318538_1072213123300031546SoilMIEVRGTAAVIPSGGKAFGPRFEDTIVRIQPTRIISMGIEATQQGANARSVGTA
Ga0318571_1012267023300031549SoilVIDSGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVTSA
Ga0318528_1007092033300031561SoilKAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSSV
Ga0318573_1005741813300031564SoilGTAAVIASGGKAFGERFDDAIVRIQPARIVAAGIDEGELARNARSVSTA
Ga0318573_1035670333300031564SoilFGERFEDTIVRIQPTRIVAFGIDPGDTANARSVSAT
Ga0318515_1041098423300031572SoilIRGTAEVLPAGGKAFGENFEDTIVRIHPTRVIAFGIESAGQGMNARSVSPA
Ga0310915_1059713113300031573SoilERFDDAIVRIQPTRIVAAGIDEGELTRNARSVSPA
Ga0318555_1008679113300031640SoilVIPSGGKAFGERFEDTIVRIQPTRIISFGIDAGETSARSVSAV
Ga0318555_1044737223300031640SoilIEVRGTAAVIPSGGKAFGPRFEDTIVRIQPTRIISMGIEATQQGANARSVGTA
Ga0318561_1065037723300031679SoilRTAAVIPSGGKAFGPRFEDTIVRIQPTRIISMGIEATQQGANARSVGTA
Ga0318574_1092811523300031680SoilSGGKALSDNFEDTIVRITPFRIIAFGIDSEGYASNARSV
Ga0310686_11214891513300031708SoilTVIPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTTARSVTAT
Ga0310686_11950867213300031708SoilTVIPSGGKAFGERFEDTIVRIQPTRIISFGIDPGETTNARSVSAS
Ga0318496_1031668823300031713SoilGERFEDTIVRIRPTRIVAFGIDPGDTTNARSVSAT
Ga0306917_1024557323300031719SoilTAAVIPSGGKAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSAV
Ga0306917_1114346913300031719SoilGGKAFGERFDDAIVRIQPARIVAAGIDEGELTRNARSVSTA
Ga0318493_1084261623300031723SoilIEIRGTATVIPSGGKAFGERFDDAIVRIQPARIVAAGIDEGELTRNARSVSTA
Ga0318500_1014577223300031724SoilVLPEGGKAFGRNFEDTIVRIHPTRVIAFGIESADQGMNARSVGSA
Ga0306918_1060985323300031744SoilIEVRGTAEVIDSGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVTSA
Ga0306918_1129363513300031744SoilSSGGKAFGPQFEDTIVRIQPTRIISFGIESGEPGANARSVG
Ga0318492_1019202223300031748SoilSGGKDFGERFEDTIVRIQPTRIISFGIGPGDSANARSVGAE
Ga0318492_1048277113300031748SoilFGDRFEDTIVRIRPTRIISFGIDPGETANARSVGAT
Ga0318494_1021810433300031751SoilIEIRGTAAVIPSGGKAFGDRFEDTIVRIQPTRIISFGIDPSETTSARSVSAV
Ga0318494_1043708233300031751SoilVVPTGGKAFGERFEDTIVRIQPTRIISIGIESSEMMTNARSVAAG
Ga0318537_1016546123300031763SoilAAVIPSGGKAFGERFDDAIVRIQPTRIVAAGIDEGELTRNARSVSTA
Ga0318535_1005578913300031764SoilIEIRGNAAVIPSGGKAFGERFEDTIVRIRPTRIISFGIDPGETSSARSVSAV
Ga0318535_1009098113300031764SoilDSGGKAFGENFEDTIVRIKPARIISFGIDSDPKAGARSVTPA
Ga0318554_1008596413300031765SoilIRGTAAVVPSGGKAFGDRFEDTIVRIQPTRIISLGIDPGETRSNARSVPAS
Ga0318521_1030395413300031770SoilSGGKAFGERFEDTIVRIQPTRIVSFGIDPGDSTNARSVSAT
Ga0318521_1031710223300031770SoilTAEVLPEGGKAFGRNFEDTIVRIRPTRVIAFGIESADQGMNARSVGSA
Ga0318521_1078053123300031770SoilRGIAAVVPSGGKAFGDRFEDTIVRIQPTRIISLGIDPGETRSNARSVPAS
Ga0318521_1096671913300031770SoilAFGERFEDTIVRIRPTRIISFGIDPGETSSARSVSAV
Ga0318546_1043724323300031771SoilLEVPPVGGKAFGRNFEDTIVRIRPTRVIAFGIESADQGMNARSVGSA
Ga0318498_1005674613300031778SoilGKAFGEQFEDTIVRIRPTRIIAFGIDPGDTTNARSVGAP
Ga0318498_1007376133300031778SoilFGERFEDTIVRIQPTRIISFGIDAGETSARSVGAV
Ga0318566_1022829613300031779SoilEVRGTAAVIPAGGKAFGEGFEDTIVRIRPTRIIAFGIDPGDTTNARSVGAP
Ga0318566_1055631023300031779SoilAFGEQFEDTIVRIQPTRIISIGIESTEMMTNARSVAAG
Ga0318547_1024888813300031781SoilVIASGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVNSA
Ga0318547_1043659223300031781SoilVLPAGGKAFGKNFEDTIVRIHPTRVIAFGIESAGQGMNARSVSPA
Ga0318547_1102813723300031781SoilGEQFEDTIVRIQPTRIIAMGIDSGELARNARSVGAG
Ga0318552_1054985423300031782SoilSGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVTSA
Ga0318552_1059409913300031782SoilIEIRGTAEVLPAGGKAFGENFEDTIVRIHPTRVIAFGIESAGQGMNARSVSPA
Ga0318552_1060579413300031782SoilGGKAFGPRFEDTIVRIQPTRIISMGIEATQQGANARSVGTA
Ga0318552_1073048223300031782SoilIRGTAVVLPSGGKAFGDRFEDTIVRIQPTRIISLGIGPGERSNARSVPAS
Ga0318548_1066656413300031793SoilSGGKAFGERFDDAIVRIQPTRIVAAGIDEGELTRNARSVSPA
Ga0318503_1017259823300031794SoilIEVRGAAAVISSGGKAFGPQFEDTIVRIQPTRIISFGIESGEPGANARSVG
Ga0318503_1031292613300031794SoilGKAFGRNFEDTIVRIHPTRVIAFGIESADQGMNARSVGSA
Ga0318568_1017173943300031819SoilIPSGGKAFGEQFEDTIVRIQPTRIISAGIDPGGSRNARSVGPA
Ga0318567_1048540813300031821SoilEGGKAFGRNFEDTIVRIHPTRVIAFGIESADQGMNARSVGPA
Ga0318499_1024414023300031832SoilIEVRGTAAVIPSGGKAFGERFDDAIVRIQPTRIVAAGIDEGELTRNARSVGTA
Ga0318511_1031632123300031845SoilVPSGGKAFRERFEDTIVRIQPTRIVSFGIDPGDSTNARSVSAT
Ga0318512_1042209313300031846SoilRGTAAVIASGGKAFGDRFEDTIVRIQPTRIISFGIDPGETANARSVTAT
Ga0318527_1001716443300031859SoilTATVIPSGGKAFGEQFEDTIVRIQPTRIIAMGIDSGELARNARSVGAG
Ga0318527_1013128113300031859SoilIEIRGNAAVIPSGGKAFGERFEDTIVRIRPTRIISFGIGPGETSSARSVSAV
Ga0318527_1016165223300031859SoilGKAFGERFEDTIVRIQPTRIIAFGIDPGETAQARSISPA
Ga0318495_1037093813300031860SoilRGTAAVMPSGGKAFGDRFEDTIVRIRPTRIISFGIDPGETANARSVGAT
Ga0318495_1043515823300031860SoilIPSGGKAFGERFDDTIVRIQPTRIISFGIGPGETTSARSVSVA
Ga0306919_1024615413300031879SoilMIEVRGTAEVIDSGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVTSA
Ga0306925_1104983723300031890SoilPSGGKAFGERFEDTIVRIQPTRIVSFGIDPGDSTNARSVSAT
Ga0318551_1003147853300031896SoilIEIRGTAAVISSGGKAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSSV
Ga0318551_1011214713300031896SoilGTAAVIPSGGKAFGEQFEDTIVRIQPTRIISAGIDPGGSRNARSVGPA
Ga0318551_1036322723300031896SoilRGTAAVIPSGGKAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSAV
Ga0318520_1034482513300031897SoilVRGTAEVIDSGGKAFGENFEDTIVRIKPARIISFGIDSDLTVGARSVTVA
Ga0318520_1040567823300031897SoilVIPSGGKAFGERFDDAIVRIQPARIVAAGIDEGELTRNARSVSTA
Ga0306923_1189844713300031910SoilIEIRGTAAVIPTGGKAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSAV
Ga0306921_1185105013300031912SoilAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSAV
Ga0310912_1146713713300031941SoilKAFGDRFEDTIVRIQPTRIISLGIDPGETRSNARSVPAS
Ga0310916_1004538063300031942SoilGTAAVISSGGKAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSSV
Ga0310916_1042216743300031942SoilAFGEQFEDTIVRIQPTRIISAGIDPGGSRNARSVGPA
Ga0310913_1101682823300031945SoilAFGERFEDTIVRIQPTRIVSFGIDPGDSTNARSVSAT
Ga0306926_1145111613300031954SoilKAFGENFEDTIVRIHPTRVIAFGIESAGQGMNARSVSPA
Ga0318530_1007452313300031959SoilTAAVIPSGGKAFGERFDDAIVRIQPTRIVAAGIDEGELTRNARSVSTA
Ga0306922_1092157633300032001SoilVRGTAVVVPSGGKAFGEQFEDTIVRIQPTRIISIGIESTEMMTNARSVAAG
Ga0318562_1071310413300032008SoilSGGKAFGERFEDTIVRIRPTRIISFGIDPSETTSARSVSAV
Ga0318563_1032878013300032009SoilPEGGKAFGRNFEDTIVRIHPTRVIAFGIESGDQGMNARSVGSA
Ga0318569_1009563313300032010SoilAAVVPSGGKAFGDRFEDTIVRIQPTRIISLGIDPGETRSNARSVPAS
Ga0318569_1011573333300032010SoilAFGERFEDTIVRIQPTRIISFGIDPSETTSARSVSAV
Ga0318569_1012560113300032010SoilGEQFEDTIVRIRPTRIIAFGIDPGDTTNARSVGAP
Ga0318507_1009671613300032025SoilVRGTAAVIPAGGKAFGEQFEDTIVRIRPTRIIAFGIDPGDTTNARSVGAP
Ga0318507_1035362823300032025SoilFGENFEDTIVRIKPARIISFGIDSDLTVGARSVTVA
Ga0318549_1045455613300032041SoilRGTAAVVSSGGKAFGDRFEDTIVRIQPTRIISIGIESGEPVTSARSVGTA
Ga0318556_1028699623300032043SoilIEVRGTAAVIPAGGKAFGEGFEDTIVRIRPTRIIAFGIDPGDTTNARSVGAP
Ga0318558_1009975233300032044SoilGGKAFGERFDDAIVRIQPARIVAAGIDEGELARNARSVSTA
Ga0318506_1008159743300032052SoilIEIRGTAAVIPSGGKAFGDQFEDTIVRIQPTRIISAGIDPGGSRNARSVGPA
Ga0318506_1015779033300032052SoilIEVRGTAAVIPAGGKAFGERFEDTIVRIRPTRIVAFGIDPGDTTNARSVSAT
Ga0318506_1020167213300032052SoilVIDSGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVNSA
Ga0318575_1039060913300032055SoilRMIEIRGIAAVVPSGGKAFGDRFEDTIVRIQPTRIISLGIDPGETRSNARSVPAS
Ga0318575_1042317513300032055SoilGKAFGERFEDTIVRIRPTRIISFGIDPGETSSARSVSAV
Ga0318505_1052444633300032060SoilAFGERFEDTIVRIQPTRIIAFGINPDGATNARSVGAS
Ga0318504_1008976013300032063SoilIEIRGTAAVIPSGGKAFGERFDDAIVRIQPTRIVAAGIDEGELTRNARSVSTA
Ga0318514_1059940523300032066SoilEIRGTAEVLPAGGKAFGENFEDTIVRIHPTRVIAFGIESAGQGMNARSVSPA
Ga0318514_1071690723300032066SoilGKALSENFEDTIVRIHPSRIIAFGIDSGDQASNARSVR
Ga0318553_1002233413300032068SoilIPSGGKAFGERFEDTIVRIQPTRIISFGIDAGETSARSVSAV
Ga0318553_1046897013300032068SoilAFDERFEDTIVRIQPTRIISIGIESGEMVTSARSVGAG
Ga0318518_1021760413300032090SoilRMIEVRGTAAVIPSGGKAFGPRFEDTIVRIQPTRIISMGIDATQQGAHARSVGTA
Ga0318518_1067444713300032090SoilIEVRGTAAVIPAGGKAFGERFEDTIVRIQPTRIIAFGINPDGATNARSVGAS
Ga0307471_10403107513300032180Hardwood Forest SoilGGKAFGDNFEDTIVRIHPTRIVAFGIDSGDLQSNSRSVNSA
Ga0306920_10192770113300032261SoilGTAEVLPSGGKALRENFEDTIVRIHPSRIIAFGIDSGDQASNARSVR
Ga0306920_10245338613300032261SoilPRMIEVRGTAEVIDSGGKAFGKNFEDTIVRIKPARIISFGIDSDPKAGARSVTSA
Ga0306920_10327510023300032261SoilGHAGGDRFEDTIVRIQPTRIISIGIESGEPVTSARSVGTA
Ga0335085_1012237053300032770SoilVRGTAAVIPAGGKAFGERFEDTIVRIRPTRIIAFGIDPGDAANARSVSAT
Ga0335085_1040829613300032770SoilVIPAGGKAFGERFEDTIVRIQPTRVIAFGIDPGGTANARSVSAT
Ga0335082_1050780223300032782SoilMTRPHPPGGQAFGDRFEDTIVRIRPTRIIAFGIDPGDTANARSVSAA
Ga0335081_1131118413300032892SoilGGKAFGDRFEDTIVRIRPTRIISFGIDPGETANARSVSAT
Ga0335074_1034386713300032895SoilSGGKVFGERFEDTIVRIQPTRIVAFGIDPGEAPNARSVGAV
Ga0335074_1068959323300032895SoilRGTATVVPSGGKALGERFEDTVVRIRPTRIISFGIDADEMSARSVDGA
Ga0335075_1018759313300032896SoilGTASVVASGGKVFGERFEDTIVRIQPTRIVAFGIDPGEAPNARSVGAA
Ga0335075_1054412933300032896SoilPRMIEIRGTAEVISSGGKALSDNFEDTVVRITPFRVIAFGIDSEGHGTNARAV
Ga0335076_1004892773300032955SoilIRGTAEVISSGGKALSDNFEDTVVRITPFRVIAFGIDSEGHGANARAV
Ga0335073_1112625313300033134SoilSGGKAFGEQFEDTIVRIQPTRIVAFGIDPGEAPNARSVGAA
Ga0318519_1032099513300033290SoilAFGDRFEDTIVRIQPTRIISLGIDPGETRSNARSVPAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.