Basic Information | |
---|---|
Family ID | F014144 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 265 |
Average Sequence Length | 39 residues |
Representative Sequence | MQKGKVVICDICNKEIEVRWGIFAHDTLSRHRKAEHK |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 265 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 49.11 % |
% of genes near scaffold ends (potentially truncated) | 23.77 % |
% of genes from short scaffolds (< 2000 bps) | 43.40 % |
Associated GOLD sequencing projects | 146 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (56.981 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (21.132 % of family members) |
Environment Ontology (ENVO) | Unclassified (56.226 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.170 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.46% β-sheet: 9.23% Coil/Unstructured: 72.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 265 Family Scaffolds |
---|---|---|
PF03796 | DnaB_C | 12.08 |
PF13662 | Toprim_4 | 6.04 |
PF13506 | Glyco_transf_21 | 3.40 |
PF13641 | Glyco_tranf_2_3 | 2.26 |
PF02945 | Endonuclease_7 | 1.51 |
PF05050 | Methyltransf_21 | 1.51 |
PF02811 | PHP | 1.51 |
PF01521 | Fe-S_biosyn | 1.13 |
PF00154 | RecA | 1.13 |
PF13640 | 2OG-FeII_Oxy_3 | 1.13 |
PF08007 | JmjC_2 | 0.75 |
PF07733 | DNA_pol3_alpha | 0.75 |
PF00041 | fn3 | 0.75 |
PF00011 | HSP20 | 0.75 |
PF13155 | Toprim_2 | 0.75 |
PF09479 | Flg_new | 0.75 |
PF02668 | TauD | 0.75 |
PF00436 | SSB | 0.75 |
PF01807 | zf-CHC2 | 0.75 |
PF13884 | Peptidase_S74 | 0.75 |
PF04586 | Peptidase_S78 | 0.75 |
PF05065 | Phage_capsid | 0.75 |
PF13524 | Glyco_trans_1_2 | 0.75 |
PF00565 | SNase | 0.75 |
PF05118 | Asp_Arg_Hydrox | 0.75 |
PF02511 | Thy1 | 0.38 |
PF04820 | Trp_halogenase | 0.38 |
PF01464 | SLT | 0.38 |
PF00535 | Glycos_transf_2 | 0.38 |
PF04577 | Glyco_transf_61 | 0.38 |
PF13385 | Laminin_G_3 | 0.38 |
PF14579 | HHH_6 | 0.38 |
PF14279 | HNH_5 | 0.38 |
PF00210 | Ferritin | 0.38 |
PF14020 | DUF4236 | 0.38 |
PF16861 | Carbam_trans_C | 0.38 |
PF07883 | Cupin_2 | 0.38 |
PF05257 | CHAP | 0.38 |
PF09458 | H_lectin | 0.38 |
PF02467 | Whib | 0.38 |
PF09360 | zf-CDGSH | 0.38 |
PF01476 | LysM | 0.38 |
PF00085 | Thioredoxin | 0.38 |
PF01370 | Epimerase | 0.38 |
COG ID | Name | Functional Category | % Frequency in 265 Family Scaffolds |
---|---|---|---|
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 12.08 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 12.08 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.13 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 1.13 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.13 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.75 |
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.75 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.75 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.75 |
COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.75 |
COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.75 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.75 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.38 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.04 % |
Unclassified | root | N/A | 33.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001282|B570J14230_10084181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 981 | Open in IMG/M |
3300001838|RCM33_1036351 | Not Available | 786 | Open in IMG/M |
3300001851|RCM31_10010383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
3300001968|GOS2236_1085288 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
3300002161|JGI24766J26685_10014723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2042 | Open in IMG/M |
3300002200|metazooDRAFT_1274714 | Not Available | 757 | Open in IMG/M |
3300002303|B570J29644_1005216 | Not Available | 873 | Open in IMG/M |
3300003277|JGI25908J49247_10028365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1602 | Open in IMG/M |
3300003430|JGI25921J50272_10013781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2313 | Open in IMG/M |
3300003430|JGI25921J50272_10036771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1177 | Open in IMG/M |
3300004096|Ga0066177_10128422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300004112|Ga0065166_10023043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1858 | Open in IMG/M |
3300004112|Ga0065166_10088203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
3300004112|Ga0065166_10195141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300004772|Ga0007791_10112159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300005527|Ga0068876_10027645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3545 | Open in IMG/M |
3300005527|Ga0068876_10074952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2035 | Open in IMG/M |
3300005527|Ga0068876_10744737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
3300005528|Ga0068872_10024971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3956 | Open in IMG/M |
3300005528|Ga0068872_10028023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3700 | Open in IMG/M |
3300005528|Ga0068872_10070583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2138 | Open in IMG/M |
3300005580|Ga0049083_10191235 | Not Available | 696 | Open in IMG/M |
3300005581|Ga0049081_10013090 | Not Available | 3133 | Open in IMG/M |
3300005584|Ga0049082_10083388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1122 | Open in IMG/M |
3300005585|Ga0049084_10001070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11097 | Open in IMG/M |
3300005662|Ga0078894_10003332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12215 | Open in IMG/M |
3300005662|Ga0078894_10433111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1186 | Open in IMG/M |
3300005662|Ga0078894_10735961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300005662|Ga0078894_11301439 | Not Available | 611 | Open in IMG/M |
3300005805|Ga0079957_1001701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20008 | Open in IMG/M |
3300005805|Ga0079957_1006700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9164 | Open in IMG/M |
3300005805|Ga0079957_1009878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7271 | Open in IMG/M |
3300005805|Ga0079957_1018977 | All Organisms → Viruses → Predicted Viral | 4866 | Open in IMG/M |
3300005805|Ga0079957_1200285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 964 | Open in IMG/M |
3300005805|Ga0079957_1318438 | Not Available | 693 | Open in IMG/M |
3300006484|Ga0070744_10000035 | Not Available | 34100 | Open in IMG/M |
3300006802|Ga0070749_10552324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 624 | Open in IMG/M |
3300006802|Ga0070749_10585009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300006917|Ga0075472_10026958 | All Organisms → Viruses → Predicted Viral | 2644 | Open in IMG/M |
3300007169|Ga0102976_1005932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
3300007169|Ga0102976_1160391 | Not Available | 2122 | Open in IMG/M |
3300007177|Ga0102978_1108223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 4824 | Open in IMG/M |
3300007200|Ga0103273_1184213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2131 | Open in IMG/M |
3300007212|Ga0103958_1167910 | Not Available | 1125 | Open in IMG/M |
3300007214|Ga0103959_1221403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1386 | Open in IMG/M |
3300007585|Ga0102916_1133787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300007708|Ga0102859_1000135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16176 | Open in IMG/M |
3300008107|Ga0114340_1000539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25976 | Open in IMG/M |
3300008107|Ga0114340_1070344 | Not Available | 3700 | Open in IMG/M |
3300008113|Ga0114346_1051048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3853 | Open in IMG/M |
3300008113|Ga0114346_1108775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1254 | Open in IMG/M |
3300008114|Ga0114347_1075152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2046 | Open in IMG/M |
3300008114|Ga0114347_1212618 | Not Available | 631 | Open in IMG/M |
3300008116|Ga0114350_1000468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25814 | Open in IMG/M |
3300008116|Ga0114350_1002178 | Not Available | 12922 | Open in IMG/M |
3300008116|Ga0114350_1006160 | Not Available | 14269 | Open in IMG/M |
3300008120|Ga0114355_1004749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8156 | Open in IMG/M |
3300008120|Ga0114355_1013025 | Not Available | 4601 | Open in IMG/M |
3300008120|Ga0114355_1014578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4300 | Open in IMG/M |
3300008120|Ga0114355_1151458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 822 | Open in IMG/M |
3300008120|Ga0114355_1261231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
3300008261|Ga0114336_1019009 | Not Available | 6437 | Open in IMG/M |
3300008448|Ga0114876_1162466 | Not Available | 800 | Open in IMG/M |
3300008510|Ga0110928_1036474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1534 | Open in IMG/M |
3300008962|Ga0104242_1030791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300008962|Ga0104242_1046493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300009159|Ga0114978_10000886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25141 | Open in IMG/M |
3300009161|Ga0114966_10000104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 77440 | Open in IMG/M |
3300009170|Ga0105096_10574503 | Not Available | 591 | Open in IMG/M |
3300009184|Ga0114976_10409165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300009385|Ga0103852_1018302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300010354|Ga0129333_10001184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23324 | Open in IMG/M |
3300010354|Ga0129333_10023665 | All Organisms → Viruses | 5826 | Open in IMG/M |
3300010354|Ga0129333_10025000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5658 | Open in IMG/M |
3300010354|Ga0129333_10345964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
3300010354|Ga0129333_10409606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1199 | Open in IMG/M |
3300010354|Ga0129333_10695502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300010354|Ga0129333_11395214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300010354|Ga0129333_11471835 | Not Available | 559 | Open in IMG/M |
3300010370|Ga0129336_10000250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30008 | Open in IMG/M |
3300010370|Ga0129336_10584691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300010388|Ga0136551_1005566 | All Organisms → Viruses → Predicted Viral | 2822 | Open in IMG/M |
3300011010|Ga0139557_1000481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9576 | Open in IMG/M |
3300011116|Ga0151516_10420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20829 | Open in IMG/M |
3300012000|Ga0119951_1097975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300012012|Ga0153799_1037141 | Not Available | 921 | Open in IMG/M |
3300012352|Ga0157138_1006063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2017 | Open in IMG/M |
3300012663|Ga0157203_1000128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 27491 | Open in IMG/M |
3300012665|Ga0157210_1000208 | Not Available | 28971 | Open in IMG/M |
3300012665|Ga0157210_1008357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1909 | Open in IMG/M |
3300012667|Ga0157208_10010320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
3300012667|Ga0157208_10021396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300012968|Ga0129337_1239352 | Not Available | 1582 | Open in IMG/M |
3300012968|Ga0129337_1341318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1968 | Open in IMG/M |
3300013004|Ga0164293_10168923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
3300013004|Ga0164293_10617189 | Not Available | 703 | Open in IMG/M |
3300013087|Ga0163212_1097900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 944 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1032183 | All Organisms → Viruses → Predicted Viral | 2277 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10018438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6744 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10081667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2354 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10193047 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1291 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10406859 | Not Available | 769 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10038892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4355 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10087152 | Not Available | 2423 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10110696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2046 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10129390 | Not Available | 1835 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10658106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 621 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10744378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 575 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10837396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 536 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10100891 | All Organisms → Viruses | 2443 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10783830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 593 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10933852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 528 | Open in IMG/M |
(restricted) 3300013138|Ga0172371_10383120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1064 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10092408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2186 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10211185 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1224 | Open in IMG/M |
3300014819|Ga0119954_1000004 | Not Available | 91275 | Open in IMG/M |
3300017766|Ga0181343_1048248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300017784|Ga0181348_1115163 | Not Available | 1037 | Open in IMG/M |
3300017788|Ga0169931_10014967 | Not Available | 10433 | Open in IMG/M |
3300017788|Ga0169931_10064462 | All Organisms → Viruses | 3776 | Open in IMG/M |
3300017788|Ga0169931_10078860 | Not Available | 3286 | Open in IMG/M |
3300017788|Ga0169931_10331467 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
3300017788|Ga0169931_10449078 | Not Available | 931 | Open in IMG/M |
3300017788|Ga0169931_10724506 | Not Available | 651 | Open in IMG/M |
3300020048|Ga0207193_1105440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2545 | Open in IMG/M |
3300020074|Ga0194113_10035249 | Not Available | 5123 | Open in IMG/M |
3300020074|Ga0194113_10755868 | Not Available | 669 | Open in IMG/M |
3300020083|Ga0194111_10439525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 853 | Open in IMG/M |
3300020141|Ga0211732_1593496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2648 | Open in IMG/M |
3300020183|Ga0194115_10033089 | Not Available | 3595 | Open in IMG/M |
3300020183|Ga0194115_10235085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 877 | Open in IMG/M |
3300020183|Ga0194115_10459813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 530 | Open in IMG/M |
3300020190|Ga0194118_10480296 | Not Available | 603 | Open in IMG/M |
3300020190|Ga0194118_10516082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 569 | Open in IMG/M |
3300020196|Ga0194124_10036590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3217 | Open in IMG/M |
3300020205|Ga0211731_11678992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 4440 | Open in IMG/M |
3300020214|Ga0194132_10004796 | All Organisms → Viruses | 22680 | Open in IMG/M |
3300020214|Ga0194132_10508410 | Not Available | 593 | Open in IMG/M |
3300020222|Ga0194125_10840140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300020493|Ga0208591_1026818 | Not Available | 695 | Open in IMG/M |
3300020506|Ga0208091_1000046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 33345 | Open in IMG/M |
3300020543|Ga0208089_1006928 | All Organisms → Viruses → Predicted Viral | 1980 | Open in IMG/M |
3300020560|Ga0208852_1032970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300021519|Ga0194048_10161915 | Not Available | 838 | Open in IMG/M |
3300022752|Ga0214917_10000099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 95645 | Open in IMG/M |
3300022752|Ga0214917_10000352 | Not Available | 59817 | Open in IMG/M |
3300023174|Ga0214921_10000872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 53638 | Open in IMG/M |
3300023174|Ga0214921_10016374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8347 | Open in IMG/M |
3300023179|Ga0214923_10001125 | All Organisms → Viruses | 38849 | Open in IMG/M |
3300023179|Ga0214923_10038141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3869 | Open in IMG/M |
3300023184|Ga0214919_10001523 | Not Available | 37703 | Open in IMG/M |
3300023184|Ga0214919_10002577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28372 | Open in IMG/M |
3300024289|Ga0255147_1000022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 104732 | Open in IMG/M |
3300024289|Ga0255147_1061393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300024306|Ga0255148_1050053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300024346|Ga0244775_10161219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1891 | Open in IMG/M |
3300024346|Ga0244775_10204100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1658 | Open in IMG/M |
3300024346|Ga0244775_10370212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
3300024348|Ga0244776_10001210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27856 | Open in IMG/M |
3300024348|Ga0244776_10002850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17177 | Open in IMG/M |
3300024350|Ga0255167_1004596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3053 | Open in IMG/M |
3300024351|Ga0255141_1002059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3529 | Open in IMG/M |
3300024481|Ga0256330_1107210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300024500|Ga0255143_1013371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1390 | Open in IMG/M |
3300024503|Ga0255152_1023963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1162 | Open in IMG/M |
3300024857|Ga0256339_1064488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 769 | Open in IMG/M |
3300025585|Ga0208546_1003243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 4743 | Open in IMG/M |
3300026457|Ga0255160_1049401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300026473|Ga0255166_1022133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1359 | Open in IMG/M |
3300026570|Ga0255274_1027202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1515 | Open in IMG/M |
3300027467|Ga0255154_1058112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300027608|Ga0208974_1011329 | Not Available | 2893 | Open in IMG/M |
3300027608|Ga0208974_1014434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2512 | Open in IMG/M |
3300027621|Ga0208951_1089109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300027644|Ga0209356_1009911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 3380 | Open in IMG/M |
3300027707|Ga0209443_1012239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4069 | Open in IMG/M |
3300027744|Ga0209355_1001589 | Not Available | 12850 | Open in IMG/M |
3300027759|Ga0209296_1000974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23358 | Open in IMG/M |
3300027760|Ga0209598_10018383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 4186 | Open in IMG/M |
3300027770|Ga0209086_10000043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 110973 | Open in IMG/M |
3300027770|Ga0209086_10027965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 3415 | Open in IMG/M |
3300027793|Ga0209972_10213812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300027808|Ga0209354_10012258 | All Organisms → Viruses → Predicted Viral | 3428 | Open in IMG/M |
3300027892|Ga0209550_10005416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11966 | Open in IMG/M |
3300027892|Ga0209550_10115812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1974 | Open in IMG/M |
3300028025|Ga0247723_1003439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7911 | Open in IMG/M |
3300028025|Ga0247723_1014298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2897 | Open in IMG/M |
3300028091|Ga0255184_1095137 | Not Available | 554 | Open in IMG/M |
3300029930|Ga0119944_1000039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20437 | Open in IMG/M |
3300031758|Ga0315907_10000127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 109458 | Open in IMG/M |
3300031758|Ga0315907_10022767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5781 | Open in IMG/M |
3300031758|Ga0315907_10122606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2218 | Open in IMG/M |
3300031758|Ga0315907_10258841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
3300031758|Ga0315907_11302158 | Not Available | 502 | Open in IMG/M |
3300031787|Ga0315900_10057093 | Not Available | 4065 | Open in IMG/M |
3300031857|Ga0315909_10022092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6375 | Open in IMG/M |
3300031857|Ga0315909_10143290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1982 | Open in IMG/M |
3300031857|Ga0315909_10364618 | Not Available | 1050 | Open in IMG/M |
3300031951|Ga0315904_10001821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33667 | Open in IMG/M |
3300031951|Ga0315904_10005853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16953 | Open in IMG/M |
3300031951|Ga0315904_10031414 | Not Available | 6186 | Open in IMG/M |
3300031951|Ga0315904_10096971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3110 | Open in IMG/M |
3300031951|Ga0315904_10125290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2650 | Open in IMG/M |
3300031951|Ga0315904_11087899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 625 | Open in IMG/M |
3300031951|Ga0315904_11417915 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 517 | Open in IMG/M |
3300031963|Ga0315901_10166889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1943 | Open in IMG/M |
3300031963|Ga0315901_10375607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
3300031963|Ga0315901_10741657 | Not Available | 721 | Open in IMG/M |
3300032050|Ga0315906_10366812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300032092|Ga0315905_10011449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9002 | Open in IMG/M |
3300032116|Ga0315903_10006796 | All Organisms → Viruses | 14493 | Open in IMG/M |
3300032116|Ga0315903_10150425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2139 | Open in IMG/M |
3300032116|Ga0315903_10419475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1083 | Open in IMG/M |
3300032116|Ga0315903_11160342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300033993|Ga0334994_0029550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3560 | Open in IMG/M |
3300033996|Ga0334979_0024021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4106 | Open in IMG/M |
3300034019|Ga0334998_0383883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300034071|Ga0335028_0024850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4156 | Open in IMG/M |
3300034071|Ga0335028_0128065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1636 | Open in IMG/M |
3300034104|Ga0335031_0842956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300034105|Ga0335035_0444213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300034106|Ga0335036_0001397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 21375 | Open in IMG/M |
3300034112|Ga0335066_0012843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5965 | Open in IMG/M |
3300034121|Ga0335058_0076393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1954 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.13% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.32% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.57% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.68% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.79% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.66% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.15% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.40% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.40% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.64% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.64% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.64% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.89% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.51% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.75% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.75% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.38% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.38% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.38% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.38% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.38% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.38% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.38% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.38% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.38% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.38% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.38% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.38% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
3300002303 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007200 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects | Environmental | Open in IMG/M |
3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009385 | Microbial communities of water from Amazon river, Brazil - RCM5 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020546 | Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024280 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028091 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J14230_100072762 | 3300001282 | Freshwater | MEGGVVSSRFVVCDICNKEIELRWAIFGSDTLSRHRKAEHK* |
B570J14230_100841811 | 3300001282 | Freshwater | LLYTEYMTGKVVICPVCKKETEVRWGIFAHDTLNRHMKEHK* |
RCM33_10363514 | 3300001838 | Marine Plankton | MYNGYMANKAVVCNVCNKEIEVRWGIFAHETLNRHMKEHK* |
RCM31_100103834 | 3300001851 | Marine Plankton | MTSGRIVICSICNKEIEVRWGIFAHDTLSRHRKAEHKNV* |
GOS2236_10852884 | 3300001968 | Marine | MEKGRVVVCDICGKELEVRWGIFAHQTLSRHLKEHKNAEAA* |
JGI24766J26685_100147234 | 3300002161 | Freshwater And Sediment | MEGGIVENGRVVVCDICKKDIVVRWGIFANDTLSRHKKAEHK* |
metazooDRAFT_12747143 | 3300002200 | Lake | MEKGRVAICDLCNKEIEVRWGIFASDTLSRHKKVEHKNAA* |
B570J29644_10052161 | 3300002303 | Freshwater | VEGGLVEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK* |
JGI25908J49247_100283652 | 3300003277 | Freshwater Lake | MTNKRVAICEVCNKEIEVRWGIFANDTLKRHMKEHVNGA* |
JGI25921J50272_100137814 | 3300003430 | Freshwater Lake | MEGRVMEKGRVVTCDICNRDIEVRWGIFASDTLSRHKKAEHK* |
JGI25921J50272_100367714 | 3300003430 | Freshwater Lake | VEGGLVEKGRVVTCTICKKDIEVRWGIFANDTLTRHMKAEHK* |
Ga0066177_101284221 | 3300004096 | Freshwater Lake | MEGGLMEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK* |
Ga0065166_100230431 | 3300004112 | Freshwater Lake | SVEGGLVEKGRVVTCTICKKDIEVRWGIFANDTLTRHMKAEHK* |
Ga0065166_100882034 | 3300004112 | Freshwater Lake | SVEGGLVEKGRVVTCTICKRDIEVRWGIFANDTLTRHKKAEHK* |
Ga0065166_101951412 | 3300004112 | Freshwater Lake | MEGGLMEKGRVVTCDICKKDIEVRWGIFAHDTLTRHKKAEHK* |
Ga0007791_101121592 | 3300004772 | Freshwater | MEGGVVEKGRVVICDICKKQIEVRWGYFANETLNRHKKADHK* |
Ga0068876_100276452 | 3300005527 | Freshwater Lake | MTGKVVICPVCKKETEVRWGIFAHDTLNRHLKEHK* |
Ga0068876_100749524 | 3300005527 | Freshwater Lake | MNNLKRYVICPNCSKEIELRWGIFGHNTLARHLKQH* |
Ga0068876_107447372 | 3300005527 | Freshwater Lake | MYNDYMDKGRVVVCDVCNKEIEVRWGIFAHDTLSRHLREHSNG* |
Ga0068872_100249719 | 3300005528 | Freshwater Lake | MSNKIVVCDICKKEIEVRWGIFAHDTLGRHMREHK* |
Ga0068872_100280232 | 3300005528 | Freshwater Lake | VEKGKSVICEICDKQIEVRWGIFAHETLTRHKKAEHK* |
Ga0068872_100446613 | 3300005528 | Freshwater Lake | MEGGVVSGRFVVCDTCGKEIELRWGIFGHDTLNRHRKAEH* |
Ga0068872_100705834 | 3300005528 | Freshwater Lake | MEGGGMTGKVVICPICKKETEVRWGIFAHDTLNRHLKEHK* |
Ga0049083_101912352 | 3300005580 | Freshwater Lentic | VEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK* |
Ga0049081_1001309010 | 3300005581 | Freshwater Lentic | MTNKRVAVCEVCNKEIEVRWGIFANDTLKRHIKEHVNGA* |
Ga0049082_100833882 | 3300005584 | Freshwater Lentic | MEGGLMEKGRVVTCDICNKDIEVRWGIFANDTLIRHKKAEHR* |
Ga0049082_103352263 | 3300005584 | Freshwater Lentic | GGVMANRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK* |
Ga0049084_1000107015 | 3300005585 | Freshwater Lentic | MSNRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK* |
Ga0078894_100033328 | 3300005662 | Freshwater Lake | MEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK* |
Ga0078894_100134165 | 3300005662 | Freshwater Lake | MSGRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH* |
Ga0078894_104331113 | 3300005662 | Freshwater Lake | MEGGLVEKGRVVICDICKKDIVVRWGIFANDTLTRHKKAEHK* |
Ga0078894_107359612 | 3300005662 | Freshwater Lake | MEKGRVVICDICKKGIEVRWGIFANDTLLRHKKAAHK* |
Ga0078894_113014392 | 3300005662 | Freshwater Lake | MEGGVMEKSRVVTCDICKRDIEVRWGIFANDTLSRHKKAEHK* |
Ga0079957_100170116 | 3300005805 | Lake | MDKNKVVVCDICSKEIEVRWGIFAHDTLSRHRKAEH* |
Ga0079957_100670011 | 3300005805 | Lake | MSGRFVVCETCGKEIELRWGIFGHDTLSRHRKAEH* |
Ga0079957_10098782 | 3300005805 | Lake | MDKVVICDKCGKEIQVRWGIFAHETLSRHFKEHK* |
Ga0079957_10189774 | 3300005805 | Lake | MEKGRVVICTTCGRELEVRWGIFAHQTLSRHMKEHNNGKKSAEEAA* |
Ga0079957_10309853 | 3300005805 | Lake | MEGGRLMANRFVLCDICNKEIELRWGIFGHDALSRHKKEHK* |
Ga0079957_12002852 | 3300005805 | Lake | MEKGRITICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA* |
Ga0079957_13184382 | 3300005805 | Lake | MEGGGMTSQNRVVICSECQKEIEVRWGIFASHTLSRHMKEHK* |
Ga0070744_100000358 | 3300006484 | Estuarine | MEGGVMEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK* |
Ga0070749_105523242 | 3300006802 | Aqueous | MEKGRVVICDTCNKEIELRWGIFGHDALSRHKKEHKNA* |
Ga0070749_105850091 | 3300006802 | Aqueous | FGVRTSMEGGIVEKGKVVICNICNKETEVRFGIFAHDTLDRHIKKEHKDV* |
Ga0075472_100269584 | 3300006917 | Aqueous | MAGKVVICNICKKEIEVRSGIFAHDTLNRHMKEHK* |
Ga0102976_10059323 | 3300007169 | Freshwater Lake | MAGKVAICDICKKEIEVRWGIFAHDTLLRHRKAEHKNV* |
Ga0102976_10250334 | 3300007169 | Freshwater Lake | MEGGLVSSRVVVCEICKKEIEVRWGIFAHDTLGRHRKAEHT* |
Ga0102976_11603913 | 3300007169 | Freshwater Lake | MNRLVVCPNCKKEIEVRWGIFAHDTLNRHMKEHK* |
Ga0102978_11082237 | 3300007177 | Freshwater Lake | VYNRYMSNKIVVCDVCKKEIEVRWGIFAHDTLSRHMKGHK* |
Ga0103273_11842135 | 3300007200 | Freshwater Lake | MAGKVAICDICKKEIEVRWGIFAHDTLLRHRKAEH |
Ga0103958_11679103 | 3300007212 | Freshwater Lake | MEKGRFVVCDTCNKEIEVRWGIFAHDTLNRHIKEHKNAA* |
Ga0103959_12214031 | 3300007214 | Freshwater Lake | MDKGRVVICDTCNKEIEVRWGIFAHQTLSRHLKEHSNAS* |
Ga0102916_11337871 | 3300007585 | Estuarine | SMEGGVMEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK* |
Ga0102859_100013512 | 3300007708 | Estuarine | MEKGRVVTCDICNKDIEVRWGIFANDTLTRHKKAEHK* |
Ga0114340_100053919 | 3300008107 | Freshwater, Plankton | MSNRIVKCDMCNKEIELRWGIFGHDTLNRHIKAEHK* |
Ga0114340_10006668 | 3300008107 | Freshwater, Plankton | MTNRVVICEICNKEIELRWGIFGSDTLSRHKKAEHK* |
Ga0114340_10703445 | 3300008107 | Freshwater, Plankton | MGLIKVASNRVVICDVCQKEIELRWGIFGHDTLNRHMKEHNG* |
Ga0114343_11840851 | 3300008110 | Freshwater, Plankton | MESRVAPARVVVCEICKKELVVRWGIFAHDTLSRHRK |
Ga0114346_10510485 | 3300008113 | Freshwater, Plankton | MEGGVVEKGRTVNCELCGRDIEVRWGIFANETLSRHKKAEHK* |
Ga0114346_11087752 | 3300008113 | Freshwater, Plankton | MDKGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK* |
Ga0114347_10751526 | 3300008114 | Freshwater, Plankton | MSNKIVVCDICKKEIEVRWGIFAHDTLSRHMREHK* |
Ga0114347_12126182 | 3300008114 | Freshwater, Plankton | MNGKIVICPVCKKETEVRWGIFAHDTLNRHMKEHK* |
Ga0114350_100046822 | 3300008116 | Freshwater, Plankton | MTGKVVVCPVCKKETEVRWGIFAHDTLSRHMKEHGDVRD* |
Ga0114350_10021788 | 3300008116 | Freshwater, Plankton | MEPKRVVVCPVCYKETELRWGIFAHDTLSRHMKAEHKK* |
Ga0114350_100616035 | 3300008116 | Freshwater, Plankton | MEKGKVVICNICSKEIEVRWGIFGHDTLNRHKREHRDE* |
Ga0114350_10311951 | 3300008116 | Freshwater, Plankton | MSGRFVVCEICGKEIELRWGIFGHDTLSRHRKAEH* |
Ga0114355_10047496 | 3300008120 | Freshwater, Plankton | MESRVTEKGRVVICDICNKSIEVRWGIFASDTLFRHKKAEHK* |
Ga0114355_10130258 | 3300008120 | Freshwater, Plankton | MSNKVVICYICSKEIEVRWGIFAHDTLSRHKKEHNGKM* |
Ga0114355_10145784 | 3300008120 | Freshwater, Plankton | MADPKRVVVCHKCNKEIELRWGIFAHDTLSRHMKAEHK* |
Ga0114355_11514582 | 3300008120 | Freshwater, Plankton | GRVYNRNMEKGRVAICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA* |
Ga0114355_12612311 | 3300008120 | Freshwater, Plankton | MEKGRVVICDICNKEIEVRNNVFAHETLSRHLKEHKNG* |
Ga0114336_10190093 | 3300008261 | Freshwater, Plankton | MEKGRVVTCDICKRDIEVRWGIFANDTLNRHKKAEHK* |
Ga0114876_11624661 | 3300008448 | Freshwater Lake | YMGRVVICDVCKKEIELRWGIFAHDTLNRHRKEHK* |
Ga0110928_10364743 | 3300008510 | Water Bodies | MEKGRVAICDKCGKELEVRWGIFAHQTLSRHMKEHKDGQEAA* |
Ga0104242_10307912 | 3300008962 | Freshwater | MEGGIVEKGRVVICDICKKGIEVRWGIFANDTLSRHKKAEHK* |
Ga0104242_10464931 | 3300008962 | Freshwater | GMMSNRIVKCSICNKEIEVRWGIFANETLSRHMKEHK* |
Ga0114968_101427981 | 3300009155 | Freshwater Lake | RRELRASMESRVVPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH* |
Ga0114978_1000088612 | 3300009159 | Freshwater Lake | VEKRRVVTCDICNKDIEVRWGMFANETLNRHKKAEHK* |
Ga0114966_1000010464 | 3300009161 | Freshwater Lake | VEKSKVVTCDICNKDVEVRWGIFANETLNRHKKAEHK* |
Ga0105096_105745033 | 3300009170 | Freshwater Sediment | MELIKVSRIVICPVCKKELEVRKGIFAHDTLYRHSQEHK |
Ga0114976_104091653 | 3300009184 | Freshwater Lake | LEGGLVSNRFVVCEFCSKEIEVRWGIFASDTIQRHMRAEHK* |
Ga0103852_10183023 | 3300009385 | River Water | KAKVVICDICKKQIEVRWGIFAHDTLSRHKKAEHK* |
Ga0129333_100011844 | 3300010354 | Freshwater To Marine Saline Gradient | MSARLVICDKCNKEIELRWGIFAHDTLSRHLKAEHK* |
Ga0129333_100236657 | 3300010354 | Freshwater To Marine Saline Gradient | MEKGRVAICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA* |
Ga0129333_100250007 | 3300010354 | Freshwater To Marine Saline Gradient | MANKVVVCDICKKEIEVRGGIFAHDTLNRHMKEHK* |
Ga0129333_100560667 | 3300010354 | Freshwater To Marine Saline Gradient | MVIMTNNRVVVCDICNKEIELRWGIFGHDTLSRHNKEHK* |
Ga0129333_103459644 | 3300010354 | Freshwater To Marine Saline Gradient | CASMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK* |
Ga0129333_104096061 | 3300010354 | Freshwater To Marine Saline Gradient | MEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLK |
Ga0129333_106955024 | 3300010354 | Freshwater To Marine Saline Gradient | MEGGRMTGKVVTCPICKKETEVRWGIFAHDTLNRHLKEHK* |
Ga0129333_113952142 | 3300010354 | Freshwater To Marine Saline Gradient | MEKGRVVICEKCSKELEVRWGIFAHQTLSRHMKEHKNGEKSAEEAA* |
Ga0129333_114718354 | 3300010354 | Freshwater To Marine Saline Gradient | MSNRVVICDICSKEIEVRWGIFAHDSLNRHRKEHK* |
Ga0129336_100002508 | 3300010370 | Freshwater To Marine Saline Gradient | MEGGLVSSRVVVCEICKKEIEVRWGIFAHDTLSRHRKAEHK* |
Ga0129336_105846913 | 3300010370 | Freshwater To Marine Saline Gradient | VEKGKVVICDICKKEIEVRWGIFAHDTLNRHRKAEHK* |
Ga0136551_10055663 | 3300010388 | Pond Fresh Water | MSRIVVCPICKKELDVRKGIFAHDTLSRHSKEHK* |
Ga0133913_100342117 | 3300010885 | Freshwater Lake | MEGRIVSGRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH* |
Ga0133913_106092946 | 3300010885 | Freshwater Lake | MSSRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH* |
Ga0139557_10004817 | 3300011010 | Freshwater | VEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK* |
Ga0139556_100010013 | 3300011011 | Freshwater | MANRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK* |
Ga0151516_1042017 | 3300011116 | Freshwater | MAVGNRVTVCEICNKEIEVRWGIFASSTLSRHMKEHK* |
Ga0119951_10979751 | 3300012000 | Freshwater | MEGGLVEKGRTVKCELCGKEIEVRWGIFANDTLSRHRKAEHK* |
Ga0153799_10371413 | 3300012012 | Freshwater | MTNKRVAVCEVCNKEIEVRWGIFANDTLKRHMKEHVNGA* |
Ga0157138_10060634 | 3300012352 | Freshwater | MEKGRVVVCDICKKEVVVRWGIFANDTLTRHKKAEHK* |
Ga0157203_100012812 | 3300012663 | Freshwater | MEGRVMEKSRSVTCDICKRDIEVRWGIFASDTLSRHKKAEHK* |
Ga0157210_100005423 | 3300012665 | Freshwater | MSSRVVVCDICKKEIELRWGIFAHDTLSRHRKAEH* |
Ga0157210_100020825 | 3300012665 | Freshwater | MSREVICPKCKRGIEVRWGIFAMDTLNRHIKREH* |
Ga0157210_10083573 | 3300012665 | Freshwater | MEGGLVEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK* |
Ga0157208_100103202 | 3300012667 | Freshwater | MEKGRVVICDICKKDIVVRWGIFANDTLTRHKKAEHK* |
Ga0157208_100213962 | 3300012667 | Freshwater | MEGGVMEKGRTVICDICKKEVEVRWGIFANETLSRHKRAEHK* |
Ga0129337_10702494 | 3300012968 | Aqueous | VSGRFVVCDTCGKEIELRWGIFGHDTLNRHRKAEH* |
Ga0129337_12393521 | 3300012968 | Aqueous | MNNKVVVCPICKKETEVRWGIFAHDTLNRHLKEHK* |
Ga0129337_13413184 | 3300012968 | Aqueous | VCASMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK* |
Ga0164293_101689233 | 3300013004 | Freshwater | VEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK* |
Ga0164293_106171891 | 3300013004 | Freshwater | VEGGLVEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK* |
Ga0163212_10979002 | 3300013087 | Freshwater | NIRMQKGRVVICNMCGKELEVRWSIFAHETLSRHIREHKNVKAA* |
(restricted) Ga0172374_10321833 | 3300013122 | Freshwater | MEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNDKAA* |
(restricted) Ga0172367_100184389 | 3300013126 | Freshwater | MEGGIMTGRVAICPICNKEIEVRNNVFAHETLSRHMKEHK* |
(restricted) Ga0172367_100816674 | 3300013126 | Freshwater | MTDLKRLAICPECSKAIEVRWGIFASHTLSRHMKEHK* |
(restricted) Ga0172367_101414683 | 3300013126 | Freshwater | MEGGLMSSRIVICEICKKEIELRWGIFGHDTLSRHRKAEH |
(restricted) Ga0172367_101930471 | 3300013126 | Freshwater | VYNRIMEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA* |
(restricted) Ga0172367_103674404 | 3300013126 | Freshwater | MEGGLMSSRIVICEICKKEIELRWGIFGHDTLSRHRKAEH* |
(restricted) Ga0172367_104068593 | 3300013126 | Freshwater | MEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREH |
(restricted) Ga0172373_100388926 | 3300013131 | Freshwater | MDKRVVVCPVCNKETEVRWGIFAHDTLNRHMKEHK* |
(restricted) Ga0172373_100871523 | 3300013131 | Freshwater | MEKGRVVVCDMCGKELEVRWGIFAHQTLLRHIKEHKNGQKAA* |
(restricted) Ga0172373_101106964 | 3300013131 | Freshwater | MTSKVVICPVCNKETEVRWGIFAHDTLNRHMKEHGNVRD* |
(restricted) Ga0172373_101293903 | 3300013131 | Freshwater | MEKGRVVVCNMCGKELEVRWGIFAHQTLLRHIKEHKNDEKAA* |
(restricted) Ga0172373_106581062 | 3300013131 | Freshwater | NRSMEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNDKAA* |
(restricted) Ga0172373_107443781 | 3300013131 | Freshwater | NRSMEKGRVVVCDMCGKELEVRWGIFAHETLSRHLKEHKNAKAA* |
(restricted) Ga0172373_108373961 | 3300013131 | Freshwater | SMEKGRVVVCDMCGKELEVRWGIFAHETLSRHLKEHKNAKAA* |
(restricted) Ga0172372_101008915 | 3300013132 | Freshwater | MEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA* |
(restricted) Ga0172372_107838302 | 3300013132 | Freshwater | MEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNGKAA* |
(restricted) Ga0172372_109338522 | 3300013132 | Freshwater | GRVVVCDMCGKELEVRWGIFAHETLSRHLKEHKNAKAA* |
(restricted) Ga0172375_101610474 | 3300013137 | Freshwater | MASRFVLCDICNKEIELRWGIFGHDALSRHKKEHK* |
(restricted) Ga0172371_103831202 | 3300013138 | Freshwater | MEKGRVVVCDMCGKELEVRWGIFAHQTLLRHIKEHKNDEKAA* |
(restricted) Ga0172376_100924083 | 3300014720 | Freshwater | MEGGIMQKGKVAICDICNKEIEVRWGIFAHDTLSRHRKAEHK* |
(restricted) Ga0172376_102111851 | 3300014720 | Freshwater | KGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA* |
Ga0119954_1000004125 | 3300014819 | Freshwater | MEKGRVAVCDKCGKELEVRWGIFAHDTLSRHLKEHKNGQEAA* |
Ga0181343_10482481 | 3300017766 | Freshwater Lake | LLELIKITNKKVVVCEICKKEIEVRWGIFASDTLRRHTKEHK |
Ga0181348_11151631 | 3300017784 | Freshwater Lake | EGGLVEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK |
Ga0169931_100149675 | 3300017788 | Freshwater | MEGGIMTGRVAICPICNKEIEVRNNVFAHETLSRHMKEHK |
Ga0169931_100644623 | 3300017788 | Freshwater | MEKGRVVVCDMCGKELEVRWGIFAHQTLLRHIKEHKNGQKAA |
Ga0169931_100788601 | 3300017788 | Freshwater | VYNRIMEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA |
Ga0169931_103314673 | 3300017788 | Freshwater | MEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNDKAA |
Ga0169931_104490783 | 3300017788 | Freshwater | MTDLKRLAICPECSKAIEVRWGIFASHTLSRHMKEHK |
Ga0169931_107245063 | 3300017788 | Freshwater | MEKGRVVVCNMCGKELEVRWGIFAHQTLLRHIKEHKNDEKAA |
Ga0207193_11054404 | 3300020048 | Freshwater Lake Sediment | MSGRVVVCDLCKKEIELRWGIFAHDSLSRHRKAEH |
Ga0194113_100352499 | 3300020074 | Freshwater Lake | MEKGRVVICEMCGKELEVRWGIFAHDTLSRHIREHKNVKAA |
Ga0194113_102003124 | 3300020074 | Freshwater Lake | MASRFVLCDICNKEIELRWGIFGHDALSRHNKEHK |
Ga0194113_107558684 | 3300020074 | Freshwater Lake | VLVYNKSMNSKVVICPVCQKETEVRWGIFAHDTLNRHMREHK |
Ga0194111_104395252 | 3300020083 | Freshwater Lake | GRVVICEMCGKELEVRWGIFAHDTLSRHIREHKNVKAA |
Ga0194112_101524104 | 3300020109 | Freshwater Lake | MASRFVLCDICNKEIELRWGIFGHDALSRHKKEHK |
Ga0211732_15934965 | 3300020141 | Freshwater | MEGRVMEKGKVVTCDICKKDIEVRWGIFASDTLSRHKKAEHK |
Ga0194115_100330895 | 3300020183 | Freshwater Lake | MEKLRVVVCDLCGKELEVRWSIFAHSTLSRHMREHKNVKAA |
Ga0194115_102350851 | 3300020183 | Freshwater Lake | DKRYYVGYNRSMEKGRVVICEMCGKELEVRWGIFAHDTLSRHIREHKNVKAA |
Ga0194115_104598132 | 3300020183 | Freshwater Lake | DKRYYVGYNRSMEKGRVVICEMCGKELEVRWGIFAHDTLSRHVREHKNVKAA |
Ga0194118_104802962 | 3300020190 | Freshwater Lake | MEKGRVVICEMCGKELEVRWGIFAHDTLSRHVREHKNVKAA |
Ga0194118_105160822 | 3300020190 | Freshwater Lake | RYSVGYNRSMEKGRVVICEMCGKELEVRWSIFAHQTLSRHIREHKNVKAA |
Ga0194124_100365902 | 3300020196 | Freshwater Lake | MQKGKVVICDICNKEIEVRWGIFAHDTLSRHRKAEHK |
Ga0211731_116789924 | 3300020205 | Freshwater | MEKGKVVTCDICKKDIEVRWGIFASDTLSRHKKAEHK |
Ga0194132_1000479611 | 3300020214 | Freshwater Lake | MEKGRSVVCDKCGKEIQVRWGIFAYNTLSRHMREHKNVKAA |
Ga0194132_105084102 | 3300020214 | Freshwater Lake | MEKGRVVICEMCGKELEVRWGIFAYNTLSRHMREHKNVKAA |
Ga0194125_108401401 | 3300020222 | Freshwater Lake | SCMEGGVMQKGKVVICDICNKEIEVRWGIFAHDTLSRHRKSEHK |
Ga0208591_10268182 | 3300020493 | Freshwater | VEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK |
Ga0208091_10000465 | 3300020506 | Freshwater | VEKSRVVTCDICHKDIEVRWGIFANETLNRHKKAEHK |
Ga0208089_10069281 | 3300020543 | Freshwater | LLLYTEYMTGKVVICPVCKKETEVRWGIFAHDTLNRHMKEHK |
Ga0208853_10431151 | 3300020546 | Freshwater | MEGGVVSSRFVVCDICNKEIELRWAIFGSDTLSRHRKAEHK |
Ga0208852_10329702 | 3300020560 | Freshwater | VEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK |
Ga0208465_10141131 | 3300020570 | Freshwater | MESRVAPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH |
Ga0194130_100221485 | 3300021376 | Freshwater Lake | MEGGRLMASRFVLCDICNKEIELRWGIFGHDALSRHKKEHK |
Ga0194048_101619153 | 3300021519 | Anoxic Zone Freshwater | MAGKVIVCPICNKEVEVRWGIFASDTLGRHIKEHK |
Ga0222714_100856372 | 3300021961 | Estuarine Water | MANRFVLCDICNKEIELRWGIFGHDALSRHKKEHK |
Ga0214917_1000009973 | 3300022752 | Freshwater | MASRVVVCDICSKEIELRWGIFGHDALSRHRKAEHK |
Ga0214917_1000035271 | 3300022752 | Freshwater | MEKGRVAVCDKCGKELEVRWGIFAHDTLSRHLKEHKNGQEAA |
Ga0214921_1000087286 | 3300023174 | Freshwater | MEGGIVEKGRVVICDICKKGIEVRWGIFANDTLSRHKKAEHK |
Ga0214921_100163743 | 3300023174 | Freshwater | MTKRAVVCDVCKKEIEVRWAIFANETLGKHKKMEHK |
Ga0214923_1000112540 | 3300023179 | Freshwater | MEKGRVAVCNKCGKELEVRWGIFAHDTLSRHLKEHKNGQESA |
Ga0214923_100381412 | 3300023179 | Freshwater | MEKSRVVVCMTCSKELEVRWGIFAHQTLSRHIKEHNNGKKSAEEAA |
Ga0214919_1000152310 | 3300023184 | Freshwater | MTDSRVVICPECKKEIKVQLGIFAHATLSRHMKEHK |
Ga0214919_1000257720 | 3300023184 | Freshwater | MEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK |
Ga0255209_10294274 | 3300024280 | Freshwater | GRLMANRFVLCDICNKEIELRWGIFGHDALSRHKKEHK |
Ga0255147_100002228 | 3300024289 | Freshwater | MEKGRVVICDLCNKTIEVRWGIFAHQSLYRHKKADHK |
Ga0255147_10613931 | 3300024289 | Freshwater | MEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK |
Ga0255148_10500532 | 3300024306 | Freshwater | MEKGRTVICTTCGRELEVRWGIFAHQTLSRHMKEHSNGK |
Ga0244775_101612193 | 3300024346 | Estuarine | MSGRFVICNVCKKEIEVRSGIFAHETLRRHIIKEHK |
Ga0244775_102041003 | 3300024346 | Estuarine | MEGGVMEKGRVVTCDICKRDIEVRWGIFANDTLSRHKKAEHK |
Ga0244775_102576572 | 3300024346 | Estuarine | MSSRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH |
Ga0244775_103702124 | 3300024346 | Estuarine | MEGGVVEKGRVVVCDICKKDVVVRWGIFANDTLSRHKKAEHK |
Ga0244776_100012108 | 3300024348 | Estuarine | MEGGVMEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK |
Ga0244776_1000285013 | 3300024348 | Estuarine | MEKGRVVTCDICNKDIEVRWGIFANDTLTRHKKAEHK |
Ga0255167_10045962 | 3300024350 | Freshwater | MTGKVVICPVCKKETEVRWGIFAHDTLNRHLKEHK |
Ga0255141_100205913 | 3300024351 | Freshwater | YMGRVVICDVCKKEIEVRWGIFAHDTLNRHRKEHK |
Ga0256330_11072102 | 3300024481 | Freshwater | EKGRVVICDLCNKTIEVRWGIFAHQSLYRHKKADHK |
Ga0255143_10133712 | 3300024500 | Freshwater | MSNKVVICNVCKKEIEVRWGIFAHDTLSRHMKEHK |
Ga0255152_10239634 | 3300024503 | Freshwater | MEKGRTVICTTCGRELEVRWGIFAHQTLSRHMKEH |
Ga0256339_10644882 | 3300024857 | Freshwater | VICTTCGRELEVRWGIFAHQTLSRHMKEHSNGKKSAEEAA |
Ga0208546_100324311 | 3300025585 | Aqueous | MAGKVVICNICKKEIEVRSGIFAHDTLNRHMKEHK |
Ga0255160_10494011 | 3300026457 | Freshwater | MEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHL |
Ga0255166_10221331 | 3300026473 | Freshwater | QVRASMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK |
Ga0255274_10272021 | 3300026570 | Freshwater | NRSMEKGRVVICDLCNKTIEVRWGIFAHQSLYRHKKADHK |
Ga0255154_10581121 | 3300027467 | Freshwater | KVCSSMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK |
Ga0208974_10113299 | 3300027608 | Freshwater Lentic | MTNKRVAVCEVCNKEIEVRWGIFANDTLKRHIKEHVNGA |
Ga0208974_10144345 | 3300027608 | Freshwater Lentic | NKRVAVCEVCNKEIEVRWGIFANDTLKRHIKEHVNGA |
Ga0208951_10891094 | 3300027621 | Freshwater Lentic | SSVEGGLVEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK |
Ga0209356_10099113 | 3300027644 | Freshwater Lake | MEGRVMEKSRSVTCDICKRDIEVRWGIFASDTLSRHKKAEHK |
Ga0208960_10048314 | 3300027649 | Freshwater Lentic | MSNRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK |
Ga0209443_10122397 | 3300027707 | Freshwater Lake | VEGGLVEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK |
Ga0209442_12435313 | 3300027732 | Freshwater Lake | MESRVVPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH |
Ga0209355_10015899 | 3300027744 | Freshwater Lake | VEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK |
Ga0209296_10009744 | 3300027759 | Freshwater Lake | VEKRRVVTCDICNKDIEVRWGMFANETLNRHKKAEHK |
Ga0209598_100183831 | 3300027760 | Freshwater Lake | WKMEKSRVVTCDICNRDIEVRWGIFASDTLTRHKKAEHK |
Ga0209770_100084675 | 3300027769 | Freshwater Lake | MSGRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH |
Ga0209086_1000004332 | 3300027770 | Freshwater Lake | VEKSKVVTCDICNKDVEVRWGIFANETLNRHKKAEHK |
Ga0209086_100279651 | 3300027770 | Freshwater Lake | KMEKSRSVTCDICNREIEVRWGIFASDTLGRHKKAEH |
Ga0209972_102138125 | 3300027793 | Freshwater Lake | MSNKIVVCDICKKEIEVRWGIFAHDTLGRHMREHK |
Ga0209354_100122581 | 3300027808 | Freshwater Lake | ILVMMTNKRVAICEVCNKEIEVRWGIFASDTLKRHMKEHN |
Ga0209550_100054167 | 3300027892 | Freshwater Lake | MEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK |
Ga0209550_101158124 | 3300027892 | Freshwater Lake | MEGRVMEKGRVVTCDICNRDIEVRWGIFASDTLSRHKKAEHK |
Ga0247723_10034395 | 3300028025 | Deep Subsurface Sediment | MEKSRYIICEVCGREIEVRWGIFASDTLVRHMKEHKE |
Ga0247723_10142985 | 3300028025 | Deep Subsurface Sediment | VEKGRVVICDICKKGIEVRWGIFANDTLLRHKKAAHK |
Ga0255184_10951371 | 3300028091 | Freshwater | MGRVVICDVCKKEIEVRWGIFAHDTLNRHRKEHKXPKKL |
(restricted) Ga0247843_10884073 | 3300028569 | Freshwater | ELIKITSKRVVVCEICKKEIEVRSGIFAYDTLTRHLKEHK |
Ga0119944_100003914 | 3300029930 | Aquatic | MTGKVVICPVCGKETDVRWGIFAHDTLNRHMKEHK |
Ga0315907_10000127104 | 3300031758 | Freshwater | MSNRIVKCDMCNKEIELRWGIFGHDTLNRHIKAEHK |
Ga0315907_100210314 | 3300031758 | Freshwater | MEGGVVSGRFVVCDTCGKEIELRWGIFGHDTLNRHRKAEH |
Ga0315907_100227678 | 3300031758 | Freshwater | MGLIKVASNRVVICDVCQKEIELRWGIFGHDTLNRHMKEHNG |
Ga0315907_101226067 | 3300031758 | Freshwater | MSNKVVICYICSKEIEVRWGIFAHDTLSRHKKEHNGKM |
Ga0315907_102588412 | 3300031758 | Freshwater | MTGKVVVCPVCKKETEVRWGIFAHDTLSRHMKEHGDVRD |
Ga0315907_113021582 | 3300031758 | Freshwater | MEPKRVVVCPVCYKETELRWGIFAHDTLSRHMKAEHKK |
Ga0315900_100570938 | 3300031787 | Freshwater | MYNDYMDKGRVVVCDVCNKEIEVRWGIFAHDTLSRHLREHSNG |
Ga0315900_102167434 | 3300031787 | Freshwater | MSGRFVICEACGKEIELRWGIFGHDTLSRHRKAEH |
Ga0315909_100220926 | 3300031857 | Freshwater | MEKGKVVICNICSKEIEVRWGIFGHDTLNRHKREHRDE |
Ga0315909_101432909 | 3300031857 | Freshwater | KGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK |
Ga0315909_103646183 | 3300031857 | Freshwater | MEKGRIAICDTCNKEIEVRWGIFAHDTINRHKKAEHK |
Ga0315904_1000182127 | 3300031951 | Freshwater | MSGRFVVCEICGKEIELRWGIFGHDTLSRHRKAEH |
Ga0315904_1000585328 | 3300031951 | Freshwater | MEKGRVVICDICNKEIEVRNNVFAHETLSRHLKEHKNG |
Ga0315904_100314144 | 3300031951 | Freshwater | MADPKRVVVCHKCNKEIELRWGIFAHDTLSRHMKAEHK |
Ga0315904_100341503 | 3300031951 | Freshwater | MNRVVICDICKKEIELRWGIFGHDALSRHKGKEHK |
Ga0315904_100969716 | 3300031951 | Freshwater | MSGRVVICPICKKETEVRTGIFAHDTLSRHMKEHK |
Ga0315904_101252903 | 3300031951 | Freshwater | VEKGKSVICEICDKQIEVRWGIFAHETLTRHKKAEHK |
Ga0315904_110878992 | 3300031951 | Freshwater | SMDKGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK |
Ga0315904_114179151 | 3300031951 | Freshwater | MEKGRVVICDTCNKEIELRWGIFGHDALSRHKKEHKNAA |
Ga0315901_101668892 | 3300031963 | Freshwater | MDKGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK |
Ga0315901_103756074 | 3300031963 | Freshwater | QRIGGIMSSRVVICPKCKKEIELRWGIFAHDTLSRHMKEHK |
Ga0315901_107416573 | 3300031963 | Freshwater | MPGKFVICDICKKEIEVRSGIFAHDTLNRHMKEHKXNHISL |
Ga0315906_103668123 | 3300032050 | Freshwater | VEGGVVEKGKSVICEICDKQIEVRWGIFAHETLTRHKKAEHK |
Ga0315905_100114494 | 3300032092 | Freshwater | MEGRVMEKSRAVTCDICKRDIEVRWGIFASDTLSRHKKAEHK |
Ga0315903_1000679632 | 3300032116 | Freshwater | MEKGRVAICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA |
Ga0315903_101504251 | 3300032116 | Freshwater | RQLYKIGRLLYTGYMTGKVVICPVCKKETEVRWGIFAHDTLNRHMKEHK |
Ga0315903_104194753 | 3300032116 | Freshwater | NRNMEKGRVAICDKCGKELEVRWGIFAHQTLSRHMKEHKNAKAA |
Ga0315903_111603422 | 3300032116 | Freshwater | MEGGMMSNRIVKCSICNKEIEVRWGIFANETLSRHMKEHK |
Ga0334977_0100564_964_1077 | 3300033978 | Freshwater | MSRFVICSDCKKEIEVRWGIFGHDTLSRHSKECKGGK |
Ga0334982_0017982_1396_1518 | 3300033981 | Freshwater | MESGVAQARVVVCEVCKKELVVRWGIFAHDTLSRHRKAEH |
Ga0334992_0053624_2_112 | 3300033992 | Freshwater | VAQARVVVCEVCKKELVVRWGIFAHDTLSRHRKAEH |
Ga0334994_0029550_959_1087 | 3300033993 | Freshwater | VEGGLVEKSRVVTCDICHKDIEVRWGIFANETLNRHKKAEHK |
Ga0334979_0024021_2925_3038 | 3300033996 | Freshwater | MEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK |
Ga0334985_0029527_2_112 | 3300034018 | Freshwater | MESRVAPARVVVCEVCKKELVVRWGIFAHDTLSRHRK |
Ga0334998_0383883_3_107 | 3300034019 | Freshwater | MTSKVVVCPICNKETEVRWGIFAHDTLSRPMKEHG |
Ga0335028_0024850_4016_4126 | 3300034071 | Freshwater | MSAKVVICDKCSKEIEVRQGIFASATLSRHYKAEHK |
Ga0335028_0128065_2_139 | 3300034071 | Freshwater | CSSMEGRVMEKIRAVTCDICKRDIEVRWGIFASDTLSRHKKAEHK |
Ga0335022_0163419_2_145 | 3300034095 | Freshwater | RRELCASMESRVAPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH |
Ga0335030_0116893_1_141 | 3300034103 | Freshwater | RFRASMEGGVMSNRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK |
Ga0335031_0842956_385_507 | 3300034104 | Freshwater | VVEKTRVVVCDICSKSIEVRWGIFANDTLSRHKKVEHKNE |
Ga0335035_0444213_3_128 | 3300034105 | Freshwater | LELIKITDKKVVICETCKKEIEVRWGIFASDTLKRHTKEHK |
Ga0335036_0001397_5545_5658 | 3300034106 | Freshwater | MEKSRVVTCDICHKDIEVRWGIFANETLNRHKKAEHK |
Ga0335066_0000770_23031_23153 | 3300034112 | Freshwater | MESRVAQARVVVCEVCKKELVVRWGIFAHDTLSRHRKAEH |
Ga0335066_0012843_1289_1408 | 3300034112 | Freshwater | MTSKVVVCPICNKETEVRWGIFAHDTLSRHMKEHGDVRD |
Ga0335058_0076393_715_843 | 3300034121 | Freshwater | MEGRVMEKIRAVTCDICKRDIEVRWGIFASDTLSRHKKAEHK |
⦗Top⦘ |