NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013928

Metagenome / Metatranscriptome Family F013928

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013928
Family Type Metagenome / Metatranscriptome
Number of Sequences 267
Average Sequence Length 41 residues
Representative Sequence MGYSVVNVEEIEGAGPGGAVRFVRRELGLEAFGINWFEL
Number of Associated Samples 221
Number of Associated Scaffolds 267

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.90 %
% of genes near scaffold ends (potentially truncated) 97.38 %
% of genes from short scaffolds (< 2000 bps) 94.76 %
Associated GOLD sequencing projects 212
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.169 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.479 % of family members)
Environment Ontology (ENVO) Unclassified
(26.592 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.562 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.42%    β-sheet: 10.45%    Coil/Unstructured: 73.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 267 Family Scaffolds
PF01039Carboxyl_trans 56.93
PF08327AHSA1 6.37
PF02504FA_synthesis 3.00
PF04237YjbR 3.00
PF00324AA_permease 2.25
PF01022HTH_5 1.87
PF00117GATase 1.12
PF00482T2SSF 1.12
PF00296Bac_luciferase 0.75
PF00701DHDPS 0.75
PF02274ADI 0.75
PF07676PD40 0.75
PF13520AA_permease_2 0.75
PF12840HTH_20 0.75
PF00171Aldedh 0.75
PF01783Ribosomal_L32p 0.75
PF00756Esterase 0.37
PF00120Gln-synt_C 0.37
PF00614PLDc 0.37
PF00583Acetyltransf_1 0.37
PF00571CBS 0.37
PF00353HemolysinCabind 0.37
PF04542Sigma70_r2 0.37
PF13646HEAT_2 0.37
PF00027cNMP_binding 0.37
PF04226Transgly_assoc 0.37
PF02311AraC_binding 0.37
PF08803ydhR 0.37
PF06974WS_DGAT_C 0.37
PF03176MMPL 0.37
PF01471PG_binding_1 0.37
PF003936PGD 0.37
PF13529Peptidase_C39_2 0.37
PF01547SBP_bac_1 0.37
PF13738Pyr_redox_3 0.37
PF13649Methyltransf_25 0.37
PF01872RibD_C 0.37
PF07883Cupin_2 0.37
PF01391Collagen 0.37
PF04545Sigma70_r4 0.37
PF13365Trypsin_2 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 267 Family Scaffolds
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 56.93
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 56.93
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 56.93
COG0416Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis)Lipid transport and metabolism [I] 3.00
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 3.00
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 2.25
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 2.25
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 2.25
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 2.25
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.50
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.75
COG0333Ribosomal protein L32Translation, ribosomal structure and biogenesis [J] 0.75
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.75
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.75
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.75
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.75
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.75
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.75
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.37
COG03626-phosphogluconate dehydrogenaseCarbohydrate transport and metabolism [G] 0.37
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.37
COG10236-phosphogluconate dehydrogenase (decarboxylating)Carbohydrate transport and metabolism [G] 0.37
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.37
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.37
COG1502Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthaseLipid transport and metabolism [I] 0.37
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.37
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.37
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.37
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.37
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.41 %
UnclassifiedrootN/A29.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02IQTGSNot Available513Open in IMG/M
2067725001|GPWNP_F5MPXY301ECW5NAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
2170459017|G14TP7Y02HCD7XNot Available569Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1018163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1054Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1029403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300000880|AL20A1W_1262663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300000956|JGI10216J12902_111822639Not Available636Open in IMG/M
3300001535|A3PFW1_10059829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300001538|A10PFW1_12429451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300001686|C688J18823_10811811Not Available594Open in IMG/M
3300002568|C688J35102_118606448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300002568|C688J35102_119402691All Organisms → cellular organisms → Eukaryota688Open in IMG/M
3300004081|Ga0063454_100953505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300004081|Ga0063454_101173517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300004114|Ga0062593_100551342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1085Open in IMG/M
3300004114|Ga0062593_101208803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales794Open in IMG/M
3300004153|Ga0063455_100988708Not Available608Open in IMG/M
3300004153|Ga0063455_101448357Not Available533Open in IMG/M
3300004156|Ga0062589_101853493Not Available607Open in IMG/M
3300004156|Ga0062589_102839058All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300004479|Ga0062595_101518981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300005093|Ga0062594_100674790All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300005158|Ga0066816_1027519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300005175|Ga0066673_10562319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300005175|Ga0066673_10888019Not Available507Open in IMG/M
3300005176|Ga0066679_10688703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales663Open in IMG/M
3300005327|Ga0070658_11462750Not Available593Open in IMG/M
3300005332|Ga0066388_102277662Not Available980Open in IMG/M
3300005334|Ga0068869_101972530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300005339|Ga0070660_100557184Not Available956Open in IMG/M
3300005339|Ga0070660_101598942Not Available555Open in IMG/M
3300005345|Ga0070692_10550797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300005356|Ga0070674_100458328Not Available1054Open in IMG/M
3300005436|Ga0070713_101376923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300005457|Ga0070662_100978933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300005468|Ga0070707_100299908All Organisms → cellular organisms → Eukaryota1561Open in IMG/M
3300005471|Ga0070698_101371837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300005471|Ga0070698_101421598All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005535|Ga0070684_100086530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2781Open in IMG/M
3300005542|Ga0070732_10338888All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300005553|Ga0066695_10245472Not Available1130Open in IMG/M
3300005553|Ga0066695_10549622Not Available702Open in IMG/M
3300005557|Ga0066704_10289804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1108Open in IMG/M
3300005564|Ga0070664_101093300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria751Open in IMG/M
3300005564|Ga0070664_101122964Not Available741Open in IMG/M
3300005564|Ga0070664_101556494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora626Open in IMG/M
3300005574|Ga0066694_10281724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300005575|Ga0066702_10309601Not Available963Open in IMG/M
3300005576|Ga0066708_10701124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300005578|Ga0068854_102151903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300005764|Ga0066903_100370715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2332Open in IMG/M
3300005764|Ga0066903_101133362Not Available1446Open in IMG/M
3300005764|Ga0066903_106816482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300005764|Ga0066903_108851019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300005883|Ga0075299_1033513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300005897|Ga0075281_1064900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300006034|Ga0066656_10827850Not Available593Open in IMG/M
3300006173|Ga0070716_101295521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300006175|Ga0070712_100046516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales3000Open in IMG/M
3300006196|Ga0075422_10006059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3815Open in IMG/M
3300006573|Ga0074055_11654416Not Available714Open in IMG/M
3300006579|Ga0074054_12125813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium1058Open in IMG/M
3300006580|Ga0074049_12566081All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300006580|Ga0074049_12834355Not Available587Open in IMG/M
3300006580|Ga0074049_13100050Not Available532Open in IMG/M
3300006755|Ga0079222_10473593Not Available905Open in IMG/M
3300006796|Ga0066665_11196379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300006804|Ga0079221_11014692Not Available624Open in IMG/M
3300006804|Ga0079221_11374767All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300006806|Ga0079220_11096754Not Available644Open in IMG/M
3300006853|Ga0075420_101802396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300006871|Ga0075434_101560768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales669Open in IMG/M
3300006871|Ga0075434_102337138Not Available537Open in IMG/M
3300006903|Ga0075426_11022395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300006903|Ga0075426_11465788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Paraconexibacteraceae → Paraconexibacter → Paraconexibacter antarcticus519Open in IMG/M
3300006954|Ga0079219_10322935Not Available972Open in IMG/M
3300007076|Ga0075435_101583536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300007543|Ga0102853_1098342Not Available549Open in IMG/M
3300009012|Ga0066710_101860815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium904Open in IMG/M
3300009093|Ga0105240_10839433Not Available992Open in IMG/M
3300009098|Ga0105245_12996528Not Available523Open in IMG/M
3300009137|Ga0066709_100246267All Organisms → cellular organisms → Bacteria → Terrabacteria group2389Open in IMG/M
3300009137|Ga0066709_100378730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1955Open in IMG/M
3300009137|Ga0066709_103031396Not Available616Open in IMG/M
3300009147|Ga0114129_12195354Not Available664Open in IMG/M
3300009156|Ga0111538_11768943Not Available778Open in IMG/M
3300009162|Ga0075423_12326310Not Available583Open in IMG/M
3300009174|Ga0105241_10325792All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300009792|Ga0126374_11431141All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Dictyosteliales → Raperosteliaceae → Tieghemostelium → Tieghemostelium lacteum564Open in IMG/M
3300009821|Ga0105064_1107261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300010036|Ga0126305_10029125All Organisms → cellular organisms → Bacteria2992Open in IMG/M
3300010040|Ga0126308_10274824All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica1101Open in IMG/M
3300010046|Ga0126384_12099304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300010303|Ga0134082_10210099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300010325|Ga0134064_10398410Not Available549Open in IMG/M
3300010337|Ga0134062_10750058All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300010361|Ga0126378_12857768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300010366|Ga0126379_11281122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales839Open in IMG/M
3300010375|Ga0105239_10756535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1112Open in IMG/M
3300010375|Ga0105239_11026844All Organisms → cellular organisms → Bacteria → Terrabacteria group948Open in IMG/M
3300010396|Ga0134126_10687713All Organisms → cellular organisms → Bacteria → Terrabacteria group1164Open in IMG/M
3300010396|Ga0134126_12236480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300010399|Ga0134127_10152909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae2097Open in IMG/M
3300010400|Ga0134122_10293849All Organisms → cellular organisms → Bacteria → Terrabacteria group1392Open in IMG/M
3300012198|Ga0137364_10625125Not Available812Open in IMG/M
3300012200|Ga0137382_10964414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300012205|Ga0137362_11113951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300012212|Ga0150985_117053272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300012354|Ga0137366_10381368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300012356|Ga0137371_10005657All Organisms → cellular organisms → Bacteria → Terrabacteria group9752Open in IMG/M
3300012484|Ga0157333_1028411Not Available543Open in IMG/M
3300012532|Ga0137373_10701903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium754Open in IMG/M
3300012902|Ga0157291_10280885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300012906|Ga0157295_10324981Not Available547Open in IMG/M
3300012908|Ga0157286_10128750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300012912|Ga0157306_10270280Not Available609Open in IMG/M
3300012913|Ga0157298_10345750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300012915|Ga0157302_10146080All Organisms → cellular organisms → Bacteria → Terrabacteria group799Open in IMG/M
3300012915|Ga0157302_10482104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300012955|Ga0164298_10196231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1176Open in IMG/M
3300012955|Ga0164298_11123178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300012985|Ga0164308_10606510All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300012989|Ga0164305_10093174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1912Open in IMG/M
3300013296|Ga0157374_10260746All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300013307|Ga0157372_10209461All Organisms → cellular organisms → Bacteria2259Open in IMG/M
3300013764|Ga0120111_1050031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1051Open in IMG/M
3300013765|Ga0120172_1144659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300014272|Ga0075327_1153440Not Available719Open in IMG/M
3300014302|Ga0075310_1030678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1003Open in IMG/M
3300014325|Ga0163163_11951192All Organisms → cellular organisms → Eukaryota647Open in IMG/M
3300014745|Ga0157377_10070487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2019Open in IMG/M
3300014969|Ga0157376_11051634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria838Open in IMG/M
3300015077|Ga0173483_10270274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium818Open in IMG/M
3300015371|Ga0132258_11129050All Organisms → cellular organisms → Bacteria1981Open in IMG/M
3300015373|Ga0132257_101109219All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300015373|Ga0132257_101330789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300015373|Ga0132257_103568755Not Available566Open in IMG/M
3300015374|Ga0132255_104814079Not Available572Open in IMG/M
3300016341|Ga0182035_11186027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa siamensis681Open in IMG/M
3300017924|Ga0187820_1143761All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4714Open in IMG/M
3300017944|Ga0187786_10285435Not Available670Open in IMG/M
3300017959|Ga0187779_10107590All Organisms → cellular organisms → Bacteria → Terrabacteria group1685Open in IMG/M
3300018032|Ga0187788_10553355All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300018060|Ga0187765_10006019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5200Open in IMG/M
3300018066|Ga0184617_1089197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300018089|Ga0187774_10305091Not Available928Open in IMG/M
3300018468|Ga0066662_11958972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300018468|Ga0066662_12814313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300018482|Ga0066669_11130495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300019356|Ga0173481_10616062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300019361|Ga0173482_10449736Not Available612Open in IMG/M
3300019361|Ga0173482_10711031All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300019361|Ga0173482_10727710Not Available517Open in IMG/M
3300019362|Ga0173479_10154252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300019890|Ga0193728_1004002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7505Open in IMG/M
3300020000|Ga0193692_1126257All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium513Open in IMG/M
3300021445|Ga0182009_10563093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300021560|Ga0126371_11797334All Organisms → cellular organisms → Bacteria → Terrabacteria group734Open in IMG/M
3300021560|Ga0126371_12464272Not Available629Open in IMG/M
3300023064|Ga0247801_1021464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium876Open in IMG/M
3300024055|Ga0247794_10115635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300024181|Ga0247693_1056234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300024232|Ga0247664_1119829Not Available613Open in IMG/M
3300024283|Ga0247670_1087156All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300024288|Ga0179589_10293707All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri730Open in IMG/M
3300025551|Ga0210131_1007594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1415Open in IMG/M
3300025900|Ga0207710_10484474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300025905|Ga0207685_10472857All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4655Open in IMG/M
3300025908|Ga0207643_11088126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300025911|Ga0207654_10900682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300025914|Ga0207671_10164963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1717Open in IMG/M
3300025916|Ga0207663_11051559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300025923|Ga0207681_11352935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300025924|Ga0207694_10508042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1009Open in IMG/M
3300025925|Ga0207650_11358465Not Available605Open in IMG/M
3300025931|Ga0207644_11000265Not Available702Open in IMG/M
3300025939|Ga0207665_10241904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1330Open in IMG/M
3300025941|Ga0207711_10416307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1249Open in IMG/M
3300025941|Ga0207711_11055943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300025944|Ga0207661_11113629All Organisms → cellular organisms → Eukaryota727Open in IMG/M
3300025945|Ga0207679_11733130All Organisms → cellular organisms → Bacteria → Terrabacteria group571Open in IMG/M
3300025949|Ga0207667_12075532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300025952|Ga0210077_1135578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300025961|Ga0207712_10836950Not Available810Open in IMG/M
3300025972|Ga0207668_11368345Not Available638Open in IMG/M
3300026075|Ga0207708_11603098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300026078|Ga0207702_10312334All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300026089|Ga0207648_12285472All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300026116|Ga0207674_10172090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2119Open in IMG/M
3300026312|Ga0209153_1033080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum1776Open in IMG/M
3300026317|Ga0209154_1130240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1060Open in IMG/M
3300026550|Ga0209474_10131605All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300026552|Ga0209577_10372533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1042Open in IMG/M
3300026929|Ga0207461_1001817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium857Open in IMG/M
3300027543|Ga0209999_1054109Not Available760Open in IMG/M
3300027725|Ga0209178_1128952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300027765|Ga0209073_10115880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium960Open in IMG/M
3300027765|Ga0209073_10139096All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300027826|Ga0209060_10097055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus1380Open in IMG/M
3300027882|Ga0209590_10866155All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027909|Ga0209382_11682456All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium623Open in IMG/M
3300027991|Ga0247683_1014405Not Available680Open in IMG/M
3300028072|Ga0247675_1032813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium759Open in IMG/M
3300028708|Ga0307295_10208593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300028708|Ga0307295_10250640Not Available510Open in IMG/M
3300028713|Ga0307303_10096580Not Available673Open in IMG/M
3300028715|Ga0307313_10222724Not Available586Open in IMG/M
3300028718|Ga0307307_10280834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300028719|Ga0307301_10085326Not Available993Open in IMG/M
3300028755|Ga0307316_10108325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium973Open in IMG/M
3300028755|Ga0307316_10133826All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300028755|Ga0307316_10351494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300028768|Ga0307280_10001658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5387Open in IMG/M
3300028768|Ga0307280_10065140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1163Open in IMG/M
3300028784|Ga0307282_10131532Not Available1177Open in IMG/M
3300028784|Ga0307282_10213965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium923Open in IMG/M
3300028784|Ga0307282_10499380Not Available591Open in IMG/M
3300028800|Ga0265338_11032800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300028876|Ga0307286_10221291All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri689Open in IMG/M
3300028876|Ga0307286_10224947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300028880|Ga0307300_10128439All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300028885|Ga0307304_10417619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300028889|Ga0247827_10986728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300030336|Ga0247826_10085819All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300030336|Ga0247826_11325290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300030490|Ga0302184_10073582Not Available1597Open in IMG/M
3300031027|Ga0302308_10850364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300031226|Ga0307497_10276411Not Available761Open in IMG/M
3300031226|Ga0307497_10386089Not Available665Open in IMG/M
3300031226|Ga0307497_10767926Not Available503Open in IMG/M
3300031232|Ga0302323_101887587Not Available677Open in IMG/M
3300031240|Ga0265320_10132212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1133Open in IMG/M
3300031543|Ga0318516_10111042Not Available1556Open in IMG/M
3300031547|Ga0310887_10141538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1249Open in IMG/M
3300031547|Ga0310887_10844664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300031640|Ga0318555_10447502All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300031716|Ga0310813_10706503All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300031719|Ga0306917_10736357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium774Open in IMG/M
3300031723|Ga0318493_10230757All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031724|Ga0318500_10168833Not Available1037Open in IMG/M
3300031747|Ga0318502_10807010Not Available569Open in IMG/M
3300031771|Ga0318546_10408167Not Available949Open in IMG/M
3300031858|Ga0310892_10425106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia870Open in IMG/M
3300031890|Ga0306925_10836346All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300031911|Ga0307412_11968557Not Available540Open in IMG/M
3300031954|Ga0306926_10427152All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300032025|Ga0318507_10334025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300032043|Ga0318556_10755471All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300032064|Ga0318510_10467920All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300032065|Ga0318513_10276597Not Available814Open in IMG/M
3300032065|Ga0318513_10381065All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300032074|Ga0308173_10410513Not Available1194Open in IMG/M
3300032205|Ga0307472_101325421Not Available694Open in IMG/M
3300032770|Ga0335085_12003639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium587Open in IMG/M
3300032782|Ga0335082_11713162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300032783|Ga0335079_12313895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300032893|Ga0335069_10928715Not Available971Open in IMG/M
3300032954|Ga0335083_10186263All Organisms → cellular organisms → Eukaryota1915Open in IMG/M
3300033412|Ga0310810_11299317Not Available573Open in IMG/M
3300033475|Ga0310811_10785788All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300033501|Ga0326732_1063669Not Available605Open in IMG/M
3300033550|Ga0247829_11055721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300033551|Ga0247830_10465952Not Available991Open in IMG/M
3300033551|Ga0247830_10795135All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300033805|Ga0314864_0090738Not Available738Open in IMG/M
3300034150|Ga0364933_149293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus604Open in IMG/M
3300034690|Ga0364923_0213740Not Available521Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.12%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.37%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.25%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.12%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.75%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.75%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.75%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.37%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.37%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.37%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.37%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.37%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.37%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.37%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.37%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.37%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.37%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2067725001Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005883Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302EnvironmentalOpen in IMG/M
3300005897Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012484Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014302Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025952Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026929Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027991Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033501Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fractionEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_016554902065487018SoilMGFSVVNVEEIEGSGPGGAVRFVRRELGLEAFGINWFE
GPWNP_031888502067725001SoilVAYSIVHLDEIEPAGPGDAVRFVRRELGVKAFGINWYE
4ZMR_051707102170459017Switchgrass, Maize And Mischanthus LitterVSGYSAVHVDDVQASGPRGGVRFVRRELGVEAFGINWFEL
AP72_2010_repI_A01DRAFT_101816313300000579Forest SoilMGYSKVNLNEIEPTGPGGMVRFVRRELDLQAFGINWFDLPP
AP72_2010_repI_A100DRAFT_102940323300000837Forest SoilMGYSMVNVADIEGEGPGGAVRFVRRRLGCEAFGINWFEIP
AL20A1W_126266313300000880PermafrostMGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGINW
JGI10216J12902_11182263913300000956SoilMGYSVKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFELP
A3PFW1_1005982913300001535PermafrostMGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGINWFELPPNA
A10PFW1_1242945113300001538PermafrostMGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGINWFELPPN
C688J18823_1081181113300001686SoilVGYSMVHVDDLPAEGPSGNVRFVRRHLGXDAFGVNWF
C688J35102_11860644813300002568SoilMGYTKVNVNEIEPAGPGGAVRFVRRELDLQAFGINWFELPPNAEG
C688J35102_11940269113300002568SoilMSYSIVRVDEIEGSGPGDAVHFVRRELGVEAFGINWFEFPPDTE
Ga0063454_10095350523300004081SoilMGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEPGFAG
Ga0063454_10117351723300004081SoilMGYSVVNIADVEGAGPGGAVKFLRRELGVQAFGVNWFELPPN
Ga0062593_10055134213300004114SoilVGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVRG
Ga0062593_10120880333300004114SoilMGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVRG
Ga0063455_10098870813300004153SoilMGYTVVNVEDIEGAGPGGAVRFVRRELGCEAFGINWFELAPGAEG
Ga0063455_10144835713300004153SoilMGYSVVNIADVEGVGPGGAVKFLRRELGVEAFGVNWFELPPNAEG
Ga0062589_10185349323300004156SoilMGFSVVHIDEIEGAGPGNAVKFVRRRLGVEAFGINWFEVPPDMEGVE
Ga0062589_10283905823300004156SoilVGYSVANVDEIEREGPGGAVRFVRRKLGVQAFGINWFELGPNVR
Ga0062595_10151898123300004479SoilMGYSHVHVDDIEPAGPGGAVRFVRRELGVEAFGINRFDLPPNAE
Ga0062594_10067479013300005093SoilMGYSIVNVEDVEGAGPGGRVKFVRRELGCEAFGINWFQLPPNT
Ga0066816_102751913300005158SoilMGYSMISVDDIEGEGPGGAARFVRRRLGVEAFGINWFEIPPGA
Ga0066673_1056231933300005175SoilVSYSIVHVDDLPGEGPGEAVRFVRRHLGAEAFGINWFEFAPNVTG
Ga0066673_1088801923300005175SoilMGYDVVHADDLEGSGPGGAVRFVRRELGVAAFGINWFELPP
Ga0066679_1068870313300005176SoilMGYSIVNVGDIEPAGPGGAVRFVRRELGCEAFGINWFEVPPNFAGPEA*
Ga0070658_1146275023300005327Corn RhizosphereMAYSIVRVDEIEGSGPGGAVHFVRRELGVEAFGINWFELP
Ga0066388_10227766223300005332Tropical Forest SoilMAYSIVHVDDIEGTGPGGAVHFVRRELGVEAFGINWFEIPPN
Ga0068869_10197253013300005334Miscanthus RhizosphereMEAGMGYSMVQIGDIEPAGPGGAVRFLRREIGAQAFGVNWFE
Ga0070660_10055718413300005339Corn RhizosphereMSYTIVHVDDIEGAGPGGSVKFVRRELGVDAFGVNWFELP
Ga0070660_10159894213300005339Corn RhizosphereMAYSIVRVDEIEGSGPGGAVHFVRRELGVEAFGINWFELPPGA
Ga0070692_1055079713300005345Corn, Switchgrass And Miscanthus RhizosphereMGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWFEIP
Ga0070674_10045832813300005356Miscanthus RhizosphereMGYSMIHVDEVVPAGPGGAVRFVRRVLGVEAFGINWFEIPP
Ga0070713_10137692333300005436Corn, Switchgrass And Miscanthus RhizosphereMGYSVVNVEDIEGGGPGGAVRFVRREIDCEAFGINWFELQP
Ga0070662_10097893313300005457Corn RhizosphereMGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPNS
Ga0070707_10029990823300005468Corn, Switchgrass And Miscanthus RhizosphereVAYTIVHVDDIEPAGPRGAVRFVRRELGVEAFGINWFQIPP
Ga0070698_10137183723300005471Corn, Switchgrass And Miscanthus RhizosphereMSFSKVNVDEIEGAGPGGAVRFVRRQLGVEAFGINWIELPPD
Ga0070698_10142159823300005471Corn, Switchgrass And Miscanthus RhizosphereMGYSVVNVNDLEAAGPGGAVRFVRRELGLEAFGLNWFELPPN
Ga0070684_10008653013300005535Corn RhizosphereVGYSVVNVEDIEGEGPGGAVRFVRRKLGVQAFGINWFELG
Ga0070732_1033888813300005542Surface SoilMGYSVVNVDDIEGAGPGGAVRFVRRELGVEAFGINWFDLPPGTA
Ga0066695_1024547233300005553SoilVGYSMVHVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEIPPNAEG
Ga0066695_1054962213300005553SoilMAYSITHIDEIEGAGPGGSVRFVRRVLGVEAFGIN
Ga0066704_1028980423300005557SoilMGYSIVNVGDIEPAGPGGAVRFVRRDLGCEAFGINWFEVPPNFAGPGA*
Ga0070664_10109330023300005564Corn RhizosphereMGYSVVRIDEIEPSGPGGAIRFVRRELGVEAFGINWFELPPNA
Ga0070664_10112296413300005564Corn RhizosphereVAYSIVRVEEIEGAGPGGTVRFVRRELGAEAFGINWFELPP
Ga0070664_10155649433300005564Corn RhizosphereMAYSLVHIDDIEPSGPGGAVRFVRRELGVEAFGINRFDLPPNR
Ga0066694_1028172413300005574SoilVGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEIPPNV
Ga0066702_1030960113300005575SoilMAYSVVRIDEIEPSGPGGAVRFVRRELGVEAFGVNWFELRPNAEG
Ga0066708_1070112423300005576SoilMGYSLVHADDIEPSGPGGAVRFVRRALGVEAFGINRFDLPAGREGRE
Ga0068854_10215190313300005578Corn RhizosphereMAYSIVRVDEVEGSGPGGMVRFVRRELGVEAFGINWFELPP
Ga0066903_10037071513300005764Tropical Forest SoilMGYSVKSIGDIEGTGPGGAVRFVRRELGLEAFGINWFEL
Ga0066903_10113336233300005764Tropical Forest SoilMGYSVLNVAELEPAGPGGAVRFVRRELGVGAFGINWFELAPHA
Ga0066903_10681648213300005764Tropical Forest SoilMGYSVVRIEEIEPAGPGGAVRFVRRELGVEAFGVNWFELPP
Ga0066903_10885101923300005764Tropical Forest SoilMGYSVVHVDEIEGAGPGGAVKFVRRELGLLAFGVNWFE
Ga0075299_103351313300005883Rice Paddy SoilMGYSVVKVQDIEPAGPGGAVRFVRRELGVEAFGINWFEVPPN
Ga0075281_106490023300005897Rice Paddy SoilMGYSIVNVNELEAGCRSGRVKFIRRALGLEAFGLNWFELPPD
Ga0066656_1082785023300006034SoilMSYSITHIDDIEGAGPAGSVRFVRRVLGVEAFGINWFEIAPNSE
Ga0070716_10129552113300006173Corn, Switchgrass And Miscanthus RhizosphereMGYSVVRVDDIEGSGPGGAVRFVRRQLGVEAFGINWFEIP
Ga0070712_10004651613300006175Corn, Switchgrass And Miscanthus RhizosphereMAYSLVHIDDIEPSGPGGAVRFVRRALGVEAFGINRF
Ga0075422_1000605913300006196Populus RhizosphereMAYSIAHVDDIEGTGPGGAVHFVRRELGVEAFGINWFEIP
Ga0074055_1165441623300006573SoilMGYSVAHVDELEPAGPGGMVRFVRRAIGVEASVTRRSS
Ga0074054_1212581323300006579SoilMGYSKVNVHELEPAGPGGAIRFVRRELDLLAFGINWFELAPNA
Ga0074049_1256608113300006580SoilMGYSIVNVDEIEGAGRSGAVRFVRRELGAEAFGINWFEL
Ga0074049_1283435513300006580SoilMGYSLVHLDDIEPGGPGGVIRFVRRELEVEAFGINWFE
Ga0074049_1310005013300006580SoilMGYSILNVNEIEGGGPTGAFHFVRRELGVEAFGINWIDLPPGAEG
Ga0079222_1047359323300006755Agricultural SoilMGYSTVNVDDIEGAGPGGGVHFVRRVLGVEAFGVNWIEIPPNSPG
Ga0066665_1119637913300006796SoilMGYSVVHVTEVEPAGPAGAVRFVRRALGVEAVGINWF
Ga0079221_1101469223300006804Agricultural SoilVGYSVVKIADIEPAGPGNAVRFVRRELGVEAFGVNWFE
Ga0079221_1137476713300006804Agricultural SoilMGYSVINVDEVEGAGPGGVVHFVRRQLGVEAFGINW
Ga0079220_1109675423300006806Agricultural SoilMGYSVVKVADIEPAGPGNAVRFVRRELGVEAFGINWFEIPANTA
Ga0075420_10180239623300006853Populus RhizosphereMGHSIVHVDDITPAGPGDAVRFVRRELGVGAFGINWYELGPSVVGRE
Ga0075434_10156076813300006871Populus RhizosphereVGYSIVNVDEIEGAGTSGAVRFVRRELGVEAFGINWFEL
Ga0075434_10233713823300006871Populus RhizosphereVAYSVVQVDELEGAGPGGAVRFVRRALGVEAFGINWFE
Ga0075426_1102239523300006903Populus RhizosphereMGYSYVDLDDIEPAGPGGAVRFVRRELGATAFGINQFILPPGATGLEH
Ga0075426_1146578813300006903Populus RhizosphereVGYTLVDVADVEPGGPGGAVRFVRRELGCEAFGIN
Ga0079219_1032293523300006954Agricultural SoilMGYSKVNLNEIEPTGPGGMVRFVRRELDLQAFGINWFQLPP
Ga0075435_10158353613300007076Populus RhizosphereMGYSVVDVSDVEGAGPGGSVRFVRRELGVEAFGINWFELAP
Ga0102853_109834223300007543EstuarineVGYTVVDIEEIEGAGPGGAVRFVRRQLGVEAFGVNWFE
Ga0066710_10186081513300009012Grasslands SoilMGWSVVDVHELEGEGPGGAVRFVRRRLGCEAFGINWFE
Ga0105240_1083943313300009093Corn RhizosphereMGYSVVNIADVEGSGPGNAVKFLRRELGVSAFGVNWFDLPPNGV
Ga0105245_1299652823300009098Miscanthus RhizosphereMGYSTVHVEEIEGSGPGGAVHFVRRVLGVEAFGVNWFEIP
Ga0066709_10024626743300009137Grasslands SoilMGYSKVNVYDLEPAGPGGVVRFVRRELDLLAFGINWFEIPPN
Ga0066709_10037873033300009137Grasslands SoilMGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGIN
Ga0066709_10303139623300009137Grasslands SoilMGYSITHLDEIEGAGPGGSVRFVRRVLGVEAFGINWFEIAPNSEGH
Ga0114129_1219535413300009147Populus RhizosphereMGFSVIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWFEIPPNAEGR
Ga0111538_1176894323300009156Populus RhizosphereMGYSMINVEDVEPSGPGDAVRFVRRELGVQAFGINWFEIPPGVEGRE
Ga0075423_1232631013300009162Populus RhizosphereVGYSFVNIADVEGSGPGNAVKFLRRELGVGAFGVNWFDLPPNGE
Ga0105241_1032579213300009174Corn RhizosphereMGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWF
Ga0126374_1143114123300009792Tropical Forest SoilMGWSVVNVDEIEGSGPGGAVRFVRRQLGVEAFGINWFELPPGAEG
Ga0105064_110726123300009821Groundwater SandMGYSMLHVDEIEPAGPGGAVRFVRRELGVEAFGINWFEPS
Ga0126305_1002912533300010036Serpentine SoilVGYTHVNVDDIAPAGPGGAARFVRRELGVGAFGINWYEI
Ga0126308_1027482423300010040Serpentine SoilMGYSIAHVDEIEGGGPGGGFHFVRRELGVEAFGINWIDLPPGA
Ga0126384_1209930423300010046Tropical Forest SoilMGYHVVHVDELEGAGPGGAVRFVRRELGVEAFGINW
Ga0134082_1021009923300010303Grasslands SoilMGYSKVNVHEIEPAGPGGAVRFVRRELGVEAFGINWFELPPDFGG*
Ga0134064_1039841033300010325Grasslands SoilVSYSMVQVDDLPGEGPGGAVRFVRRHLGAEAFGINWFEFAPN
Ga0134062_1075005833300010337Grasslands SoilMVQVDDLPPEGPGGSVRFVRRHLGVGAFGINWFEIP
Ga0126378_1285776813300010361Tropical Forest SoilMGYSKINLDEIEPTGPGGMVRFVRRELDLQAFGINWF
Ga0126379_1128112213300010366Tropical Forest SoilMGYDVVNVEEIEGAGPGGAVRFVRRELGCEAFGINWF
Ga0105239_1075653513300010375Corn RhizosphereMGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEP
Ga0105239_1102684413300010375Corn RhizosphereMGYSVVDIAGIDATGPGGAVRFVRRELGVEAFGINWFEVAANMS
Ga0134126_1068771323300010396Terrestrial SoilLAYSVIHSDEIDPAGPGGMVRFVRRGLGVEAFGINRFDLPPGA
Ga0134126_1223648013300010396Terrestrial SoilMGYSVVNVDDIAPAGPGGAVRFVRRELGVQAFGINWF
Ga0134127_1015290923300010399Terrestrial SoilMAYSLVHVDDIEPGGPGGAVRFVRRALGVQAFGINRFDLSPNR*
Ga0134122_1029384913300010400Terrestrial SoilVGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFEL
Ga0137364_1062512523300012198Vadose Zone SoilMGYSKVNVNEIEPAGPGGAVKFVRRELDLLAFGLNWFELPPNVS
Ga0137382_1096441423300012200Vadose Zone SoilMGYSKVNVHELEPAGPGGAIRFVRRELDLLAFGINWFELAP
Ga0137362_1111395113300012205Vadose Zone SoilMGYSIVKVEDLEGEGPGGAVRFVRRHLGCEAFGINWFELPPNSEGK
Ga0150985_11705327223300012212Avena Fatua RhizosphereMGYSAVKIAEIEPAGPRGMVRFVRRELGVEAFGINWFELPPNAKG
Ga0137366_1038136823300012354Vadose Zone SoilMAYSIVKVDEIDPEGPGGAVRFVRRRLGVQAFGINWFEFPP
Ga0137371_1000565713300012356Vadose Zone SoilVGYSMVHVDDLPHEGPGGAVRFVRRHLGVGAFGIN
Ga0157333_102841113300012484SoilMAYDVVDALELEGEGPGGAVRFVRRRLNVTAFGINWYQL
Ga0137373_1070190323300012532Vadose Zone SoilMGYSHVNVDDIEGASPGGAVRFVRRELGVGAFGINWFEIPP
Ga0157291_1028088523300012902SoilMGYSVANVDELEPAGPGGMVRFVRRALGVEAFGVNWY
Ga0157295_1032498133300012906SoilVGYSIVQVDDLPSEGPGGSVRFVRRHLGVGAFGINWF
Ga0157286_1012875013300012908SoilMGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINW
Ga0157306_1027028023300012912SoilMGYSVVNVEEIEGEGPAGAVRFVRRKLGVQAFGINWFELGPNVRGRE
Ga0157298_1034575023300012913SoilMGYSKLNVHELEGAGPGGAVRFVRRQLGVEAFGINWFELGPNVVGHE
Ga0157302_1014608023300012915SoilLAYSVIHSDEIDPAGPGGVVRFVRRGLGVEAFGINRFDLPPGAG
Ga0157302_1048210413300012915SoilMGYSLAHVDEIEPGGPGGAVRFVRRELGVKAFGINWFEL
Ga0164298_1019623143300012955SoilMGYSVKDIEDIEGAGPGGAVRFVRRELGLEAFGINWF
Ga0164298_1112317813300012955SoilMGYSIANIDEIEGAGPGGAVRFVRRELGVEAFGINWFEL
Ga0164308_1060651013300012985SoilMGYSIANVDEIEGAGPTGAVRFVRRELGAEAFGINWFELAPGA
Ga0164305_1009317413300012989SoilMGYSLVHIDDVEPSGPGGAVRFVRRALGVEAFGINRFDLPPDREGI
Ga0157374_1026074653300013296Miscanthus RhizosphereMGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGVNWFE
Ga0157372_1020946113300013307Corn RhizosphereMAYSVVRIDEIEPSGPGGAIRFVRRELGVEAFGINWFE
Ga0120111_105003123300013764PermafrostMGYSIVQVEEIDPAGPGGVVRFVRRELGVEAFGIN
Ga0120172_114465913300013765PermafrostMGYSMVNVDEIDGSGPGGAVHFVRKVLGAEAFGINWFELPPNTAGFE
Ga0075327_115344023300014272Natural And Restored WetlandsVAYSVVHIDDIEPAGPGGSVRFVRRELDVQAFGVNWFELPP
Ga0075310_103067823300014302Natural And Restored WetlandsMSYSVVNVEEIEGEGPGGAVRFIRRQLGVQAFGINWF
Ga0163163_1195119223300014325Switchgrass RhizosphereVGYSKVNVHELDGAGPGGAVRFVRRELGAEAFGINWFEL
Ga0157377_1007048733300014745Miscanthus RhizosphereMAYSLVHVDDIEPGGPGGAVRFVRRALGVEAFGINRFDLSPNR
Ga0157376_1105163433300014969Miscanthus RhizosphereMGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGINWFE
Ga0173483_1027027423300015077SoilMAYSIVHIDEIEPAGSGGAVRFVRRELGVEAFGINWFELPP
Ga0132258_1112905013300015371Arabidopsis RhizosphereMGYTHVNVDEIEPSGPGGAVRFVRRELGVEAFGINWFE
Ga0132257_10110921933300015373Arabidopsis RhizosphereMGYSVVDITGIESAGPGGAVRFVRRELGVEAFGINWF
Ga0132257_10133078933300015373Arabidopsis RhizosphereGYSVVDIAGIEAAGPGGAVRFVRRELGVEAFGINF*
Ga0132257_10356875523300015373Arabidopsis RhizosphereMGYSVAHVDEIEGSGPGGAFHFVRRELGVAAFGINWINLPPG
Ga0132255_10481407933300015374Arabidopsis RhizosphereSRAMGYSVVDIAGIEAAGPGGAVRFVRRELGVEAFGINF*
Ga0182035_1118602723300016341SoilVGFSVVHVDDIEGAGQGGAIRFVRRELGVEAFGINW
Ga0187820_114376123300017924Freshwater SedimentMGYSVVRIDEIEPAGSGGAVRFVRRELGVEAFGVNWFELPPNAE
Ga0187786_1028543513300017944Tropical PeatlandMGYTALNVDEIEGSGPGGAVRFVRRELGLEAFGINW
Ga0187779_1010759013300017959Tropical PeatlandVPLVGYSVVNVDEIEGAGPGGAVRFVRRELGVEAFGINWFELPPNAK
Ga0187788_1055335513300018032Tropical PeatlandMGYSVVHVDEIEGAGPGGGVRFVRRELGLEAFGVN
Ga0187765_1000601913300018060Tropical PeatlandMSYSVVNVDEIEPGGRTGMVRFVRRALEVEAFGINWFELPPNAEG
Ga0184617_108919713300018066Groundwater SedimentVGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEIP
Ga0187774_1030509123300018089Tropical PeatlandMGYSVVRVSEIEPTGPGGAVRFVRRELGVEAFGINWFELPPGMEG
Ga0066662_1195897213300018468Grasslands SoilMGYSIVNVGDIEPAGPGGAVRFVRRELGCEAFGINWFEVPPNFAGPEA
Ga0066662_1281431313300018468Grasslands SoilMGYSKVNVHELEPAGPGGAVRFVRRELDLLSFGINWFE
Ga0066669_1113049533300018482Grasslands SoilLGYSVVNVDELEPAGPGGAVRFVRRALGVEAFGINWFE
Ga0173481_1061606213300019356SoilMGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEIQPNADGYR
Ga0173482_1044973623300019361SoilMGYSKLNVHELEGAGPGGAVRFVRRPLGVEAFGLNWFERGP
Ga0173482_1071103123300019361SoilVGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNV
Ga0173482_1072771023300019361SoilMGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGINWFELP
Ga0173479_1015425213300019362SoilVGYSVVNVEDIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVR
Ga0193728_100400213300019890SoilMGYSKVNVHELEPAGPGGVVRFVRRELDLQAFGINW
Ga0193692_112625713300020000SoilMGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPKS
Ga0182009_1056309323300021445SoilMGYSKVNLNEIEPTGPGGMVRFVRRELDLQAFGINWFQLPPNVD
Ga0126371_1179733423300021560Tropical Forest SoilVRLAIGYSVINYADVAPEGPGGAVRFVRRVLGVEAFGINFF
Ga0126371_1246427233300021560Tropical Forest SoilMGYSTINVDEIEGEGPGGAVRFVRRRLGVEAFGINWSEIPPN
Ga0247801_102146413300023064SoilMGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWF
Ga0247794_1011563523300024055SoilMAYSIVHVSDIEGSGPGGAAHFVRRELGVEAFGINW
Ga0247693_105623423300024181SoilVGYSMVRVDELEPAGPGSAVRFVRRELGVEAFGVNWFELPPDAEGRR
Ga0247664_111982923300024232SoilMGFSVVNVEEIEGSGPGGAVRFVRRELGLEAFGVNWFELPPGAP
Ga0247670_108715623300024283SoilMSYSLVNVDEIEPGGPGGAVRFVRRELGALAFGINWFELGP
Ga0179589_1029370723300024288Vadose Zone SoilMGYSKVNVHELEPAGPGGAVRFVRRELDLLAFGINWFELAPTAD
Ga0210131_100759423300025551Natural And Restored WetlandsMAYSIVHIDDIEPAGPGGAVRFVRRELGVEAFGINWFELG
Ga0207710_1048447413300025900Switchgrass RhizosphereMGYSMIHVDKVEPSGPGGAVRFVRRVLGVEAFGINWFEIPANTEGR
Ga0207685_1047285713300025905Corn, Switchgrass And Miscanthus RhizosphereMGYSVVRIDEIEPSGPGGAIRFVRRELGVEAFGINWFELPPNAE
Ga0207643_1108812623300025908Miscanthus RhizosphereMGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGIN
Ga0207654_1090068223300025911Corn RhizosphereMSYTIVHVDDIEGAGPGGSVKFVRRELGVDAFGVNWFELPPNAEGF
Ga0207671_1016496323300025914Corn RhizosphereMGYSAVHIDDIEPGGPGSAVRFVRRALGVEAFGINRFDLRAGREG
Ga0207663_1105155933300025916Corn, Switchgrass And Miscanthus RhizosphereVGYWLVQVDELPPEGPGGSVRFVRRHLGVDAFGINWFELPPNAEGRE
Ga0207681_1135293523300025923Switchgrass RhizosphereVGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVR
Ga0207694_1050804213300025924Corn RhizosphereMGYSVVEIDEIEPAGPGGAVRFVRRELGVEAFGINWFELPPHAE
Ga0207650_1135846513300025925Switchgrass RhizosphereMGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFELPPGA
Ga0207644_1100026513300025931Switchgrass RhizosphereMGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFELPPG
Ga0207665_1024190423300025939Corn, Switchgrass And Miscanthus RhizosphereMGYSLVHIDDVEPSGPGGAVRFVRRALGVEAFGINRFDLPPDRE
Ga0207711_1041630723300025941Switchgrass RhizosphereVGYSIVRVDELEGSGPGGAVRFVRRELGVEAFGINWFELP
Ga0207711_1105594313300025941Switchgrass RhizosphereMGYSIVNVDEIDGAGPTGGVRFVRRELGLEAFGINWFELP
Ga0207661_1111362923300025944Corn RhizosphereMGYSVVNVDEIEPGGRTGAVRFVRRELGLEAFGINWFELPP
Ga0207679_1173313013300025945Corn RhizosphereVGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWF
Ga0207667_1207553213300025949Corn RhizosphereMGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEPG
Ga0210077_113557823300025952Natural And Restored WetlandsMNYSVVNVHEMEPGGRTGRVKFVRRELGVEAFGLNWFELPPDT
Ga0207712_1083695013300025961Switchgrass RhizosphereMGYSMVQIGDIEPAGPGGVVRFLRREIGAQAFGVNWFELP
Ga0207668_1136834513300025972Switchgrass RhizosphereMAYSIVRVDEIEGSGPGGAVHFVRRELGVGAFGINW
Ga0207708_1160309833300026075Corn, Switchgrass And Miscanthus RhizosphereMGYSMVHVKDIEGSGPGGAVHFVRRELGAEAFGIN
Ga0207702_1031233413300026078Corn RhizosphereMGYSFKNIEDIDGAGPGGAVRFVRRELGLEAFGINWFRMASL
Ga0207648_1228547213300026089Miscanthus RhizosphereVAYSVVNVEEIEAEGPGGAVRYVRRNLGVQAFGINWFELAPNVR
Ga0207674_1017209013300026116Corn RhizosphereMAYSLVHIDDIEPSGPGGAVRFVRRELGVEAFGINRFDLPPNRE
Ga0209153_103308023300026312SoilMGYSVVKVADIEPAGPGNAVRFVRRELGVEAFGVNWFQQPQ
Ga0209154_113024023300026317SoilMAYSLVNIDEIEPGGRTGMVKFVRRELGIEAFGLNWFELPPSTEGVEHHE
Ga0209474_1013160513300026550SoilMGYSVVHLDEIEPGGPGGAVRFVRRALGVEAFGINWFELP
Ga0209577_1037253323300026552SoilMGYSKVNVHDLEPAGPGGAIRYVRRELDLLAFGINWFE
Ga0207461_100181713300026929SoilVGYSIVRVDELEGSGPGGSVRFVRRELGVEAFGINWFDLPPDAE
Ga0209999_105410923300027543Arabidopsis Thaliana RhizosphereMGYSVAHVDELEPEGPGGMVRFVRRALGVEAFGINWYELPA
Ga0209178_112895223300027725Agricultural SoilMAYSLVHIDDIEPSGPGGAVRFVRRALGVEAFGINRFDLAAGREGI
Ga0209073_1011588033300027765Agricultural SoilVGYSIVQVDDLPSEGPGGSVRFVRRHLGVGAFGINWFEFPPNVE
Ga0209073_1013909643300027765Agricultural SoilMGYTVVNVDEIEPAGPGGAVRFVRRELGVQAFGINRFDIGP
Ga0209060_1009705523300027826Surface SoilVAYSVVHLDDIEPAGPGAAVKFVRRELGVEAFGVNWFDVPANFAGP
Ga0209590_1086615513300027882Vadose Zone SoilMGYSVAHIDEIDGAGPGGSVHFVRRVLGVEAFGINWFEIAPNSDG
Ga0209382_1168245623300027909Populus RhizosphereMAYSIAHVDDIEGTGPGGAVHFVRRELGVEAFGINWF
Ga0247683_101440523300027991SoilMGYSMVHVKDIEGSGPGGAVHFVRRELGAEAFGINWFDLPPNSEGF
Ga0247675_103281313300028072SoilMGYSVVHIDELEPSGPGGAIRFVRRELGVEAFGINWFE
Ga0307295_1020859323300028708SoilMGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPNGDGHQ
Ga0307295_1025064013300028708SoilMGYSVAHVDELKPEGPGGMVRFVRRALGVEAFGVNW
Ga0307303_1009658013300028713SoilMGYSLAHVEDIEGSGPGGAVHFVRRELGVEAFGVNWF
Ga0307313_1022272433300028715SoilVGYSMVQVDDLPAEGPGGAVRFVRRHLGVSAFGINWFEFAPN
Ga0307307_1028083413300028718SoilMGYSKVNVNDIEPAGPGGAVRFVRRELDLQAFGINWFELPPNADGNY
Ga0307301_1008532623300028719SoilMGYSKVNVHDLEPAGPGGAIRFVRRELDLLAFGINWFEISPKGD
Ga0307316_1010832513300028755SoilVGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFE
Ga0307316_1013382613300028755SoilVGYSVVNVEEIEGAGPGGAVRFVRRQLGVQAFGINWFELA
Ga0307316_1035149413300028755SoilMGYSKVNVHDLEPAGPGGVVRFVRRELDLLAFGINWFEIPPN
Ga0307280_1000165813300028768SoilVSYSIVNVDEIEGGGPGGGFRFVRRELGVGAFGINW
Ga0307280_1006514013300028768SoilMGYSVKSVEDIEGAGPGGAVRFVRRELGLEAFGINWFE
Ga0307282_1013153233300028784SoilVGYSMVQVDDLPPEGPGGAVRFVRRHLGVGAFGINWFEI
Ga0307282_1021396523300028784SoilVGYSLVNVEEIEVSGPGGAVRFVRRELGVEAFGINWYELPPNTEGREG
Ga0307282_1049938013300028784SoilMGYSLVRLGDIEPGGPGGAVRFVRRELGVEAFGINCFEIPPLSEGR
Ga0265338_1103280023300028800RhizosphereMSYSVVNVDEIEPGGRTGVVKFVRRALGVEAFGINWFELPPNA
Ga0307286_1022129123300028876SoilMGYSLVHVEDIEGSGPGGAVHFVRRELGVEAFGVNWFE
Ga0307286_1022494713300028876SoilVGYSVVNVEEIEGAGPGGAVRFVRRQLGVQAFGINWFE
Ga0307300_1012843913300028880SoilVGYSVVNVEEIEGEGPGGAVRFVRRNLGVQAFGINWFE
Ga0307304_1041761933300028885SoilVGYSMVQVDDLPAEGPGGSVRFVRRHLGVGAFGIN
Ga0247827_1098672813300028889SoilVGYSKLNVHELDGAGPGGAVRFVRRELGAEAFGINWFELGPDV
Ga0247826_1008581953300030336SoilMGYSTLDADEIEGAGPGGAVRFVRRELGVEAFGINWFELAP
Ga0247826_1132529013300030336SoilMSYSMIHVDKVEASGPGGAVRFVRRVLGVEAFGINWFEIP
Ga0302184_1007358223300030490PalsaMPYSVVNVDEVEGTGPGGAVHFVRRELGVEAFGINWFELPP
Ga0302308_1085036423300031027PalsaMPYSVVNVDEVEGTGPGGAVHFVRRELGVEAFGINWFELPPN
Ga0307497_1027641123300031226SoilMAYSIAHVDEIEPGGPGGAVRFVRRELGVEAFGINWFELGPNV
Ga0307497_1038608923300031226SoilMGYSLAHVDEIEPDGPGGAVRFVRRELGVNAFGINWFELPPNA
Ga0307497_1076792623300031226SoilVGYSIVRVDELEGSGPGGAVHFVRRELGVEAFGINWFELPPNADGF
Ga0302323_10188758723300031232FenMGYSVLKIDEVEGVGPGGAVKFLRRELGVEAFGVNWFELAPNVKGVEH
Ga0265320_1013221223300031240RhizosphereMSYSVVNVDEIEPGGRTGMVKFVRRALGVEAFGINWFEL
Ga0318516_1011104213300031543SoilMSYSIVHLDDIEPGGPGGAVRFVRRELEVGAFGIN
Ga0310887_1014153833300031547SoilVGYSVVNVEEIEGEGPGGAVRFVRRKLGVQAFGINWFELGPNVRGR
Ga0310887_1084466413300031547SoilMGYSMIHVDEVEPAGPGGGVRFVRRVLGVEAFGINWFEIPP
Ga0318555_1044750213300031640SoilVGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGINWFELP
Ga0310813_1070650333300031716SoilMGYSVKNVDDIEGAGPGGAVRFVRRELGLEAFGINWFELPPGTP
Ga0306917_1073635723300031719SoilMGYSIVDVAEIDGSGPGGAVRFVRRELGCEAFGLNWFE
Ga0318493_1023075713300031723SoilMGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGINWFELP
Ga0318500_1016883323300031724SoilMGYSIVDVAEIDGSGPGGAVRFVRRELGCEAFGLNWFELPP
Ga0318502_1080701013300031747SoilMGYSVVHLDEIEPGGPGGAVRFVRRELEVGAFGINWFELPPE
Ga0318546_1040816723300031771SoilMGYSVVNVEEIEPAGPGGAVRFLRRALGVEAFGINWFELPPGARRRNR
Ga0310892_1042510623300031858SoilMGYSLAHVDDIEPGGPGGAVRFVRRELGVEAFGIN
Ga0306925_1083634613300031890SoilMGYSVVNVEEIEGAGPGGAVRFVRRELGLEAFGINWFELPPGAE
Ga0307412_1196855713300031911RhizosphereVSYSVADLDALEPGGPGGMVRFVRKALGTRAFGCNYF
Ga0306926_1042715213300031954SoilVGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGIN
Ga0318507_1033402523300032025SoilMGYSVVNVEEIEPAGPGGAVRFLRRALGVEAFGINWFELPPGAE
Ga0318556_1075547133300032043SoilMGYSTINVDDIEGSGPGGAVRFVRRELGVEAFGINWFE
Ga0318510_1046792013300032064SoilMGYSVVNVEEIAGSGPGGAVRFVRRELGCEAFGINWFGLPPD
Ga0318513_1027659713300032065SoilMSYSIVHLDDIEPGGPGGAVRFVRRELEVGAFGINWF
Ga0318513_1038106513300032065SoilVGYTVVNVEDIEGAGPGGAVRFVRRELGLEAFGINWFELPPG
Ga0308173_1041051323300032074SoilMGYSTVNVDDIEGSGPGGAVHFVRRVLGVEAFGVNW
Ga0307472_10132542133300032205Hardwood Forest SoilMGYSVVDVEEIEGSGPGGAVRFVRRELGLEAFGINWFELPP
Ga0335085_1200363923300032770SoilMGYTVINVDEVEPGGKTGAVRFTRRALGVEAFGINWFDL
Ga0335082_1171316223300032782SoilMGYSVVNVNEMEPGGRTGVIKFVRRELGLEAFGLNWFELPPDT
Ga0335079_1231389513300032783SoilVRPVGYSVLNVDDIEGSGPGGVIRFVRRELGVEAFGINWFEIPPNAE
Ga0335069_1092871513300032893SoilMGYSVVNVEEIEGAGPGGAVRFVRRELGLEAFGINWFEL
Ga0335083_1018626313300032954SoilMGYSIVDVADIEGSGPGGAVRFVRRELGCEAFGLNWF
Ga0310810_1129931713300033412SoilVAYTIVHVDDVEPAGPGGAVRFVRRELGVEAFGINWFEIPPKTEGL
Ga0310811_1078578813300033475SoilMGYSVVNVDEIEGAGPGGAVRFVRRELGCEAFGIN
Ga0326732_106366913300033501Peat SoilMGFSKINVEETEGGGPTGAFHFVRRELGVEAFGINWIDLPPGA
Ga0247829_1105572113300033550SoilMGHRVVDVEQIEPAGPGGAVRFVRRELGTRAFGINQFVLEPGFAGPE
Ga0247830_1046595223300033551SoilVGYSKVNVHELDGAGPGGAVRFVRRELGAEAFGINWFELG
Ga0247830_1079513533300033551SoilMGYSTLDADEIEGAGPGGAVRFVRRELGVEAFGINWFELAPGAEGL
Ga0314864_0090738_3_1343300033805PeatlandVGYSVVHADEVESGGAVRFIRRELGCEAFGVNWFELPPNTAGFE
Ga0364933_149293_482_6043300034150SedimentMGYSVAHVDELEPAGPGGMVRFVRRALGVEAFGVNWYELPA
Ga0364923_0213740_1_1293300034690SedimentVAYSVVHVDDIEGAGPGGAVRFVRRALDVEAFGINWIELGPGV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.