NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013911

Metagenome / Metatranscriptome Family F013911

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013911
Family Type Metagenome / Metatranscriptome
Number of Sequences 267
Average Sequence Length 43 residues
Representative Sequence MTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Number of Associated Samples 197
Number of Associated Scaffolds 267

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 66.29 %
% of genes near scaffold ends (potentially truncated) 48.69 %
% of genes from short scaffolds (< 2000 bps) 90.64 %
Associated GOLD sequencing projects 179
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (60.674 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.476 % of family members)
Environment Ontology (ENVO) Unclassified
(28.464 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.446 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 22.86%    β-sheet: 0.00%    Coil/Unstructured: 77.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 267 Family Scaffolds
PF13378MR_MLE_C 12.73
PF13533Biotin_lipoyl_2 3.75
PF02945Endonuclease_7 3.37
PF04542Sigma70_r2 2.25
PF08281Sigma70_r4_2 1.87
PF04545Sigma70_r4 1.87
PF03401TctC 1.50
PF00072Response_reg 1.12
PF00873ACR_tran 1.12
PF00042Globin 1.12
PF00149Metallophos 0.75
PF00529CusB_dom_1 0.75
PF04392ABC_sub_bind 0.37
PF00196GerE 0.37
PF07859Abhydrolase_3 0.37
PF00903Glyoxalase 0.37
PF03150CCP_MauG 0.37
PF05694SBP56 0.37
PF03631Virul_fac_BrkB 0.37
PF12850Metallophos_2 0.37
PF12833HTH_18 0.37
PF030614HBT 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 267 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.25
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.25
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.25
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.25
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.50
COG1017Hemoglobin-like flavoproteinEnergy production and conversion [C] 1.12
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.37
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.37
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 0.37
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A60.67 %
All OrganismsrootAll Organisms39.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig08339Not Available782Open in IMG/M
2140918013|NODE_3235_length_1088_cov_6.904412Not Available1120Open in IMG/M
2166559005|cont_contig95186Not Available598Open in IMG/M
2199352025|deepsgr__Contig_55133Not Available555Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0734474All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11267851Not Available529Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100603931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria722Open in IMG/M
3300000550|F24TB_10120915Not Available512Open in IMG/M
3300000858|JGI10213J12805_10073402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1745Open in IMG/M
3300001661|JGI12053J15887_10007590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5832Open in IMG/M
3300002568|C688J35102_119823091Not Available785Open in IMG/M
3300003911|JGI25405J52794_10168793Not Available502Open in IMG/M
3300004081|Ga0063454_101414435Not Available590Open in IMG/M
3300004114|Ga0062593_100413632All Organisms → cellular organisms → Bacteria → Proteobacteria1212Open in IMG/M
3300004156|Ga0062589_100340230Not Available1184Open in IMG/M
3300004156|Ga0062589_100729886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria885Open in IMG/M
3300004156|Ga0062589_101468145Not Available669Open in IMG/M
3300004157|Ga0062590_101155189Not Available751Open in IMG/M
3300004479|Ga0062595_100155549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1339Open in IMG/M
3300004479|Ga0062595_100344388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1034Open in IMG/M
3300004479|Ga0062595_101281885Not Available658Open in IMG/M
3300004643|Ga0062591_100119993All Organisms → cellular organisms → Bacteria → Proteobacteria1755Open in IMG/M
3300005162|Ga0066814_10011904Not Available1086Open in IMG/M
3300005163|Ga0066823_10009293Not Available1364Open in IMG/M
3300005164|Ga0066815_10070168Not Available614Open in IMG/M
3300005167|Ga0066672_10871932All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005328|Ga0070676_11472053Not Available524Open in IMG/M
3300005332|Ga0066388_100222501All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300005332|Ga0066388_100576418Not Available1751Open in IMG/M
3300005332|Ga0066388_101984357Not Available1042Open in IMG/M
3300005335|Ga0070666_10657730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides terrigena767Open in IMG/M
3300005339|Ga0070660_101481767Not Available577Open in IMG/M
3300005347|Ga0070668_101348762Not Available649Open in IMG/M
3300005347|Ga0070668_101692202Not Available581Open in IMG/M
3300005364|Ga0070673_100377971All Organisms → cellular organisms → Bacteria → Proteobacteria1262Open in IMG/M
3300005366|Ga0070659_100434179All Organisms → cellular organisms → Bacteria → Proteobacteria1112Open in IMG/M
3300005366|Ga0070659_101880867Not Available537Open in IMG/M
3300005367|Ga0070667_100139370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2123Open in IMG/M
3300005434|Ga0070709_10990299Not Available668Open in IMG/M
3300005436|Ga0070713_100558217All Organisms → cellular organisms → Bacteria → Proteobacteria1085Open in IMG/M
3300005437|Ga0070710_10291135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1063Open in IMG/M
3300005438|Ga0070701_10613544All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300005439|Ga0070711_100102892All Organisms → cellular organisms → Bacteria → Proteobacteria2081Open in IMG/M
3300005455|Ga0070663_100161436All Organisms → cellular organisms → Bacteria → Proteobacteria1725Open in IMG/M
3300005455|Ga0070663_100256256All Organisms → cellular organisms → Bacteria → Proteobacteria1386Open in IMG/M
3300005456|Ga0070678_100331993All Organisms → cellular organisms → Bacteria → Proteobacteria1302Open in IMG/M
3300005466|Ga0070685_10017701All Organisms → cellular organisms → Bacteria → Proteobacteria3818Open in IMG/M
3300005466|Ga0070685_10211632All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300005615|Ga0070702_101150684Not Available623Open in IMG/M
3300005616|Ga0068852_101478929All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300005617|Ga0068859_102790410Not Available536Open in IMG/M
3300005618|Ga0068864_101104733Not Available789Open in IMG/M
3300005713|Ga0066905_100041070All Organisms → cellular organisms → Bacteria2742Open in IMG/M
3300005713|Ga0066905_100464849Not Available1043Open in IMG/M
3300005713|Ga0066905_100527060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici987Open in IMG/M
3300005713|Ga0066905_100902316All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium773Open in IMG/M
3300005713|Ga0066905_101689623Not Available581Open in IMG/M
3300005713|Ga0066905_101721590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici576Open in IMG/M
3300005713|Ga0066905_101768362Not Available569Open in IMG/M
3300005713|Ga0066905_101932815Not Available546Open in IMG/M
3300005713|Ga0066905_102295368Not Available504Open in IMG/M
3300005718|Ga0068866_11250977Not Available538Open in IMG/M
3300005719|Ga0068861_100173585All Organisms → cellular organisms → Bacteria → Proteobacteria1788Open in IMG/M
3300005764|Ga0066903_100902903All Organisms → cellular organisms → Bacteria → Proteobacteria1599Open in IMG/M
3300005764|Ga0066903_100912832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1591Open in IMG/M
3300005764|Ga0066903_103072962Not Available904Open in IMG/M
3300005764|Ga0066903_103597064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria835Open in IMG/M
3300005764|Ga0066903_106493715Not Available609Open in IMG/M
3300005937|Ga0081455_10104008All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2272Open in IMG/M
3300005983|Ga0081540_1226664Not Available662Open in IMG/M
3300006034|Ga0066656_10755510Not Available623Open in IMG/M
3300006038|Ga0075365_10002588All Organisms → cellular organisms → Bacteria8946Open in IMG/M
3300006038|Ga0075365_10277797Not Available1178Open in IMG/M
3300006038|Ga0075365_10372884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1007Open in IMG/M
3300006038|Ga0075365_10779179Not Available675Open in IMG/M
3300006038|Ga0075365_10972716Not Available598Open in IMG/M
3300006038|Ga0075365_11111387Not Available556Open in IMG/M
3300006038|Ga0075365_11124278Not Available553Open in IMG/M
3300006038|Ga0075365_11326102Not Available506Open in IMG/M
3300006047|Ga0075024_100114223Not Available1198Open in IMG/M
3300006177|Ga0075362_10197406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici979Open in IMG/M
3300006178|Ga0075367_10241722All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300006178|Ga0075367_10999951Not Available534Open in IMG/M
3300006196|Ga0075422_10526924Not Available539Open in IMG/M
3300006358|Ga0068871_100170657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1864Open in IMG/M
3300006572|Ga0074051_11719580Not Available562Open in IMG/M
3300006800|Ga0066660_10016703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4171Open in IMG/M
3300006844|Ga0075428_100225738Not Available2022Open in IMG/M
3300006844|Ga0075428_102066862Not Available590Open in IMG/M
3300006844|Ga0075428_102359643Not Available547Open in IMG/M
3300006845|Ga0075421_101697112Not Available683Open in IMG/M
3300007076|Ga0075435_101332344Not Available629Open in IMG/M
3300009092|Ga0105250_10385749Not Available619Open in IMG/M
3300009098|Ga0105245_10072787Not Available3123Open in IMG/M
3300009098|Ga0105245_11687315Not Available686Open in IMG/M
3300009100|Ga0075418_11194108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria824Open in IMG/M
3300009143|Ga0099792_10410791Not Available830Open in IMG/M
3300009143|Ga0099792_10459013Not Available790Open in IMG/M
3300009156|Ga0111538_10723220All Organisms → cellular organisms → Bacteria → Proteobacteria1261Open in IMG/M
3300009162|Ga0075423_11177398Not Available817Open in IMG/M
3300009174|Ga0105241_10069675All Organisms → cellular organisms → Bacteria → Proteobacteria2727Open in IMG/M
3300009176|Ga0105242_10240211All Organisms → cellular organisms → Bacteria → Proteobacteria1628Open in IMG/M
3300009177|Ga0105248_11537662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales753Open in IMG/M
3300009545|Ga0105237_10067728All Organisms → cellular organisms → Bacteria → Proteobacteria3564Open in IMG/M
3300009545|Ga0105237_10141615All Organisms → cellular organisms → Bacteria → Proteobacteria2399Open in IMG/M
3300009553|Ga0105249_11877240Not Available672Open in IMG/M
3300010040|Ga0126308_10709868Not Available692Open in IMG/M
3300010045|Ga0126311_11271346Not Available611Open in IMG/M
3300010047|Ga0126382_11418100Not Available634Open in IMG/M
3300010321|Ga0134067_10082674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1078Open in IMG/M
3300010359|Ga0126376_10419260All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1212Open in IMG/M
3300010359|Ga0126376_12066785Not Available613Open in IMG/M
3300010362|Ga0126377_12112259Not Available639Open in IMG/M
3300010371|Ga0134125_12458051Not Available566Open in IMG/M
3300010371|Ga0134125_12625907Not Available548Open in IMG/M
3300010373|Ga0134128_12242634Not Available602Open in IMG/M
3300010375|Ga0105239_10115840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2973Open in IMG/M
3300010397|Ga0134124_10784753All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300010397|Ga0134124_12733174Not Available537Open in IMG/M
3300010400|Ga0134122_11741294Not Available653Open in IMG/M
3300010401|Ga0134121_12418425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1566Open in IMG/M
3300012022|Ga0120191_10119124Not Available569Open in IMG/M
3300012203|Ga0137399_10893663Not Available748Open in IMG/M
3300012212|Ga0150985_108586891Not Available593Open in IMG/M
3300012469|Ga0150984_107115876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1965Open in IMG/M
3300012469|Ga0150984_122004082Not Available951Open in IMG/M
3300012911|Ga0157301_10407318Not Available528Open in IMG/M
3300012915|Ga0157302_10072620Not Available1025Open in IMG/M
3300012930|Ga0137407_10194775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1815Open in IMG/M
3300012937|Ga0162653_100018846All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300012937|Ga0162653_100057044Not Available613Open in IMG/M
3300012939|Ga0162650_100030549Not Available822Open in IMG/M
3300012951|Ga0164300_10120165All Organisms → cellular organisms → Bacteria → Proteobacteria1186Open in IMG/M
3300012958|Ga0164299_10266066All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300012961|Ga0164302_10503503Not Available855Open in IMG/M
3300012961|Ga0164302_10677365Not Available760Open in IMG/M
3300012986|Ga0164304_11649563Not Available535Open in IMG/M
3300012987|Ga0164307_11147402Not Available641Open in IMG/M
3300012989|Ga0164305_11192353Not Available659Open in IMG/M
3300013297|Ga0157378_12674468Not Available551Open in IMG/M
3300013306|Ga0163162_10968566Not Available961Open in IMG/M
3300013306|Ga0163162_11451098All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300014969|Ga0157376_10457694All Organisms → cellular organisms → Bacteria → Proteobacteria1246Open in IMG/M
3300015371|Ga0132258_11240386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1884Open in IMG/M
3300015371|Ga0132258_11601049All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1644Open in IMG/M
3300015372|Ga0132256_100345252All Organisms → cellular organisms → Bacteria → Proteobacteria1581Open in IMG/M
3300015373|Ga0132257_102499972Not Available671Open in IMG/M
3300015374|Ga0132255_102289355Not Available824Open in IMG/M
3300017792|Ga0163161_11541346Not Available584Open in IMG/M
3300017965|Ga0190266_10064042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1365Open in IMG/M
3300017965|Ga0190266_10345790Not Available799Open in IMG/M
3300017965|Ga0190266_10508565Not Available704Open in IMG/M
3300017966|Ga0187776_10757127All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300018027|Ga0184605_10014464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3084Open in IMG/M
3300018027|Ga0184605_10050573All Organisms → cellular organisms → Bacteria → Proteobacteria1767Open in IMG/M
3300018028|Ga0184608_10003424All Organisms → cellular organisms → Bacteria → Proteobacteria4920Open in IMG/M
3300018031|Ga0184634_10009919All Organisms → cellular organisms → Bacteria → Proteobacteria3361Open in IMG/M
3300018031|Ga0184634_10081277Not Available1392Open in IMG/M
3300018051|Ga0184620_10018638Not Available1694Open in IMG/M
3300018074|Ga0184640_10099915Not Available1262Open in IMG/M
3300018081|Ga0184625_10060268Not Available1913Open in IMG/M
3300018431|Ga0066655_10552751Not Available769Open in IMG/M
3300018465|Ga0190269_10081955All Organisms → cellular organisms → Bacteria → Proteobacteria1545Open in IMG/M
3300018476|Ga0190274_10301715Not Available1491Open in IMG/M
3300018476|Ga0190274_10436099All Organisms → cellular organisms → Bacteria → Proteobacteria1285Open in IMG/M
3300018476|Ga0190274_11492173Not Available767Open in IMG/M
3300018482|Ga0066669_11151318All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300018920|Ga0190273_11671735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300019356|Ga0173481_10308236Not Available739Open in IMG/M
3300019361|Ga0173482_10092948All Organisms → cellular organisms → Bacteria → Proteobacteria1080Open in IMG/M
3300019362|Ga0173479_10414322Not Available654Open in IMG/M
3300019869|Ga0193705_1056147Not Available803Open in IMG/M
3300019999|Ga0193718_1121283Not Available517Open in IMG/M
3300020005|Ga0193697_1046744All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1078Open in IMG/M
3300020005|Ga0193697_1144573Not Available533Open in IMG/M
3300020016|Ga0193696_1023028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1671Open in IMG/M
3300021078|Ga0210381_10017046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1872Open in IMG/M
3300021080|Ga0210382_10320862Not Available682Open in IMG/M
3300021082|Ga0210380_10007731All Organisms → cellular organisms → Bacteria → Proteobacteria4478Open in IMG/M
3300021082|Ga0210380_10424718Not Available608Open in IMG/M
3300021344|Ga0193719_10118434Not Available1151Open in IMG/M
3300021510|Ga0222621_1079644Not Available692Open in IMG/M
3300022694|Ga0222623_10003491All Organisms → cellular organisms → Bacteria → Proteobacteria5454Open in IMG/M
3300022694|Ga0222623_10169940Not Available848Open in IMG/M
3300022756|Ga0222622_10620863Not Available781Open in IMG/M
3300022756|Ga0222622_10802363Not Available688Open in IMG/M
3300023266|Ga0247789_1010313Not Available1463Open in IMG/M
3300025900|Ga0207710_10021183All Organisms → cellular organisms → Bacteria → Proteobacteria2783Open in IMG/M
3300025900|Ga0207710_10120896All Organisms → cellular organisms → Bacteria → Proteobacteria1251Open in IMG/M
3300025901|Ga0207688_10021123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3555Open in IMG/M
3300025905|Ga0207685_10093551All Organisms → cellular organisms → Bacteria → Proteobacteria1271Open in IMG/M
3300025907|Ga0207645_10231969All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300025914|Ga0207671_11448702Not Available531Open in IMG/M
3300025919|Ga0207657_10132414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2043Open in IMG/M
3300025920|Ga0207649_10913440Not Available689Open in IMG/M
3300025923|Ga0207681_11790966Not Available512Open in IMG/M
3300025925|Ga0207650_10417095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1113Open in IMG/M
3300025926|Ga0207659_11053290Not Available700Open in IMG/M
3300025928|Ga0207700_12033084Not Available502Open in IMG/M
3300025931|Ga0207644_11299872Not Available611Open in IMG/M
3300025932|Ga0207690_11710906Not Available525Open in IMG/M
3300025934|Ga0207686_11307989Not Available595Open in IMG/M
3300025936|Ga0207670_10948754Not Available722Open in IMG/M
3300025939|Ga0207665_11353320Not Available567Open in IMG/M
3300025960|Ga0207651_12130897Not Available503Open in IMG/M
3300025972|Ga0207668_11269034Not Available663Open in IMG/M
3300025972|Ga0207668_11378598Not Available635Open in IMG/M
3300026067|Ga0207678_11088051Not Available708Open in IMG/M
3300026118|Ga0207675_102707575Not Available504Open in IMG/M
3300026142|Ga0207698_12522173Not Available524Open in IMG/M
3300026496|Ga0257157_1098361Not Available512Open in IMG/M
3300026557|Ga0179587_11071272Not Available531Open in IMG/M
3300027181|Ga0208997_1005528All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1587Open in IMG/M
3300027616|Ga0209106_1001084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4583Open in IMG/M
3300027866|Ga0209813_10138430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria862Open in IMG/M
3300027866|Ga0209813_10148265Not Available838Open in IMG/M
3300027873|Ga0209814_10552229Not Available512Open in IMG/M
3300027903|Ga0209488_10250504All Organisms → cellular organisms → Bacteria → Proteobacteria1328Open in IMG/M
3300027903|Ga0209488_10411666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1000Open in IMG/M
3300027909|Ga0209382_10601946All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300027909|Ga0209382_10794749Not Available1008Open in IMG/M
3300027909|Ga0209382_11729997Not Available612Open in IMG/M
3300028587|Ga0247828_10865555Not Available579Open in IMG/M
3300028704|Ga0307321_1045016Not Available829Open in IMG/M
3300028710|Ga0307322_10031580Not Available1255Open in IMG/M
3300028710|Ga0307322_10108416Not Available718Open in IMG/M
3300028712|Ga0307285_10101649Not Available760Open in IMG/M
3300028716|Ga0307311_10091953Not Available841Open in IMG/M
3300028720|Ga0307317_10125489Not Available857Open in IMG/M
3300028722|Ga0307319_10115133Not Available865Open in IMG/M
3300028754|Ga0307297_10068573All Organisms → cellular organisms → Bacteria → Proteobacteria1124Open in IMG/M
3300028755|Ga0307316_10062633Not Available1263Open in IMG/M
3300028755|Ga0307316_10140853All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300028755|Ga0307316_10176269Not Available767Open in IMG/M
3300028771|Ga0307320_10168965Not Available850Open in IMG/M
3300028784|Ga0307282_10354630Not Available709Open in IMG/M
3300028784|Ga0307282_10642241Not Available514Open in IMG/M
3300028790|Ga0307283_10073867Not Available854Open in IMG/M
3300028791|Ga0307290_10018548Not Available2411Open in IMG/M
3300028793|Ga0307299_10128316Not Available952Open in IMG/M
3300028809|Ga0247824_10212490All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300028810|Ga0307294_10062088Not Available1111Open in IMG/M
3300028810|Ga0307294_10312159Not Available573Open in IMG/M
3300028814|Ga0307302_10677731Not Available512Open in IMG/M
3300028875|Ga0307289_10042767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1804Open in IMG/M
3300028875|Ga0307289_10059338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1536Open in IMG/M
3300028876|Ga0307286_10096287All Organisms → cellular organisms → Bacteria → Proteobacteria1036Open in IMG/M
3300031198|Ga0307500_10244851Not Available551Open in IMG/M
3300031226|Ga0307497_10083470All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300031547|Ga0310887_10072441All Organisms → cellular organisms → Bacteria → Proteobacteria1624Open in IMG/M
3300031720|Ga0307469_12385227Not Available516Open in IMG/M
3300031740|Ga0307468_100336610All Organisms → cellular organisms → Bacteria → Proteobacteria1117Open in IMG/M
3300031740|Ga0307468_100515235Not Available953Open in IMG/M
3300031847|Ga0310907_10659367Not Available575Open in IMG/M
3300031858|Ga0310892_10256556All Organisms → cellular organisms → Bacteria → Proteobacteria1082Open in IMG/M
3300031858|Ga0310892_10316307All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300031908|Ga0310900_10253903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1268Open in IMG/M
3300032012|Ga0310902_10088523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1626Open in IMG/M
3300032013|Ga0310906_10600417Not Available758Open in IMG/M
3300032013|Ga0310906_11274548Not Available536Open in IMG/M
3300032013|Ga0310906_11426400Not Available508Open in IMG/M
3300032180|Ga0307471_101203163Not Available922Open in IMG/M
3300032205|Ga0307472_101918218Not Available591Open in IMG/M
3300032261|Ga0306920_103621072Not Available569Open in IMG/M
3300034643|Ga0370545_160643Not Available521Open in IMG/M
3300034666|Ga0314788_042434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales868Open in IMG/M
3300034666|Ga0314788_193865Not Available520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.87%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere4.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.12%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.12%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.12%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.12%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.12%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.75%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.37%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.37%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.37%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.37%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.37%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.37%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.37%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_016281002124908016MTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRT
Iowa-Corn-GraphCirc_031602402140918013SoilMTKIVLAIALAMAAFATVPAAAGPYCQEDLXXXXX
cont_0186.000059202166559005SimulatedMTKFVIALALTIATLAAVPAAAGPYCQEDLGYGRTSSFGCGG
deepsgr_006446602199352025SoilMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
ICChiseqgaiiDRAFT_073447423300000033SoilMTMNKILVTIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
ICChiseqgaiiFebDRAFT_1126785123300000363SoilLALALATIATVPASAGPYCQEDLGYGRTSSFGCGG*
INPhiseqgaiiFebDRAFT_10060393123300000364SoilMTKFVVALALAFATLATVPAAAGPYCQEDLGYGRT
F24TB_1012091523300000550SoilMTKFVLALALAFAAAATVPASAGKGCQEDLGYGRTSSFGCGG*
JGI10213J12805_1007340233300000858SoilMTRIVLALALAIATLATVPASAGPCKEDLGYGRTSMGCGG*
JGI12053J15887_1000759033300001661Forest SoilMTKIVLALALAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
C688J35102_11982309123300002568SoilMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCGG*
JGI25405J52794_1016879313300003911Tabebuia Heterophylla RhizosphereMTKFVLALALAFAAAATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0063454_10141443533300004081SoilMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCG
Ga0062593_10041363223300004114SoilMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0062589_10034023013300004156SoilMTKFVLALVLALATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0062589_10072988613300004156SoilMTKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0062589_10146814523300004156SoilMTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0062590_10115518933300004157SoilPIKGETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0062595_10015554923300004479SoilMNKILVTIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0062595_10034438833300004479SoilSGLPPISTKSIQQETIMTKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0062595_10128188513300004479SoilMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0062591_10011999323300004643SoilMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066814_1001190423300005162SoilMINKIVLAIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066823_1000929323300005163SoilMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066815_1007016813300005164SoilNPIQEEITMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0066672_1087193223300005167SoilMITRITLALALMITLLANVPASAGPRCQEDLGYGRTSSWGCG*
Ga0070676_1147205323300005328Miscanthus RhizosphereMTKFVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066388_10022250143300005332Tropical Forest SoilMTKIVFALALTIAALATVPASAGKGCQEDLGYGRTSSFGCGG*
Ga0066388_10057641833300005332Tropical Forest SoilMTRIVLALALAMATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066388_10198435713300005332Tropical Forest SoilMTKIVFALALTIATLATVPASAGKGCQEDLGYGRTSSFGCGG*
Ga0070666_1065773023300005335Switchgrass RhizosphereMTKIVHAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0070660_10148176723300005339Corn RhizosphereMTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070668_10134876213300005347Switchgrass RhizosphereMTKIILALALVLATVATVPASAGPYCQEDWGYGRTSSFGCGG*
Ga0070668_10169220213300005347Switchgrass RhizosphereKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0070673_10037797113300005364Switchgrass RhizosphereSAETTYRSKETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070659_10043417933300005366Corn RhizospherePTNTGQRRMTMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070659_10188086723300005366Corn RhizosphereTLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070667_10013937043300005367Switchgrass RhizosphereMTKIVLAIALAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0070709_1099029913300005434Corn, Switchgrass And Miscanthus RhizosphereMTKFVVALALTLATLATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0070713_10055821733300005436Corn, Switchgrass And Miscanthus RhizosphereTLMTKLVLALALAFATLATVPASAGPSCQEDLGYGRTSSFGCGG*
Ga0070710_1029113523300005437Corn, Switchgrass And Miscanthus RhizosphereMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTGSFGCGG*
Ga0070701_1061354423300005438Corn, Switchgrass And Miscanthus RhizosphereMTKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGC
Ga0070711_10010289233300005439Corn, Switchgrass And Miscanthus RhizosphereMINKIVLAIALTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070663_10016143613300005455Corn RhizosphereRSKETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070663_10025625613300005455Corn RhizosphereRSKETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTGSFGCGG*
Ga0070678_10033199323300005456Miscanthus RhizosphereMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070685_1001770113300005466Switchgrass RhizosphereQRRMTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0070685_1021163223300005466Switchgrass RhizosphereMTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSG
Ga0070702_10115068423300005615Corn, Switchgrass And Miscanthus RhizosphereETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0068852_10147892913300005616Corn RhizosphereMTKLVLALALAFATLATVPASAGPSCQEDLGYGRTSSFGCGG*
Ga0068859_10279041023300005617Switchgrass RhizosphereMTKFVIALALTIATLAAVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0068864_10110473333300005618Switchgrass RhizosphereMTKFVIALALSIATLAAVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0066905_10004107043300005713Tropical Forest SoilMTKIVFALALAIAALATVPASAGKGCQEDLGYGRTSSFGCGG*
Ga0066905_10046484923300005713Tropical Forest SoilMTKLVLALALAFAAAAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066905_10052706013300005713Tropical Forest SoilMTKIVFALALAIAALATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066905_10090231633300005713Tropical Forest SoilMTKYVLALALAFAAVANVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066905_10168962323300005713Tropical Forest SoilMTKFVLALALALAAAATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066905_10172159033300005713Tropical Forest SoilMTKIVFALALAIAAFATVPASAGKGCQEDLGYGRTSSFGCGG*
Ga0066905_10176836223300005713Tropical Forest SoilMTKYVLALALAFAAVANVPASAGPYCQEDLGYGRTSSFGCRG*
Ga0066905_10193281523300005713Tropical Forest SoilMTRIVLALALAMAALATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0066905_10229536823300005713Tropical Forest SoilTTMTKIVFALALTIAALATVPASAGKGCQEDLGYGRTSSFGCGG*
Ga0068866_1125097723300005718Miscanthus RhizosphereGQRRMTMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0068861_10017358563300005719Switchgrass RhizosphereKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0066903_10090290333300005764Tropical Forest SoilMTKIILALALALATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066903_10091283213300005764Tropical Forest SoilMTKIVFALALTIAALATVPASAGKGCQEDLGYGRTSSFG
Ga0066903_10307296223300005764Tropical Forest SoilMIKFVVALALTFASLATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0066903_10359706423300005764Tropical Forest SoilMIKFVVALTLALASLATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0066903_10649371523300005764Tropical Forest SoilMTKYVLALALAFAAIANVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0081455_1010400823300005937Tabebuia Heterophylla RhizosphereMIKFVLALALTFASLATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0081540_122666423300005983Tabebuia Heterophylla RhizosphereMTKFVLALALAFAAVANVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0066656_1075551013300006034SoilMTKFVVALALALSTLATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0075365_1000258843300006038Populus EndosphereMTKFILALALALAAAATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0075365_1027779723300006038Populus EndosphereMTKLVLALTLAIATLATVPANAGGKYCQEDLGYGRTSSFGCGG*
Ga0075365_1037288433300006038Populus EndosphereNPIQEEITMTKIVLALALAFAAFATVPADAGPYCQEDLGYGRTSSFGCGG*
Ga0075365_1077917913300006038Populus EndosphereMTKLVLALALAFATIATAPASAGPYCQEDLGYGRTSSFGCGG*
Ga0075365_1097271613300006038Populus EndosphereMTRIVLALALAMATLATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0075365_1111138713300006038Populus EndosphereMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0075365_1112427823300006038Populus EndosphereMTKIVLALALAVAAFATVPAHAGKGCQEDLGYGRSSSFGCGG*
Ga0075365_1132610213300006038Populus EndosphereKETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0075024_10011422323300006047WatershedsMNKIILAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0075362_1019740623300006177Populus EndosphereMTKIVFALALAIAALATVPASAGKGCQEDLGYGRTSSFGC
Ga0075367_1024172213300006178Populus EndosphereMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFG
Ga0075367_1099995133300006178Populus EndosphereMINKIVLAIVLTVAALATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0075422_1052692423300006196Populus RhizosphereMINKIALAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0068871_10017065723300006358Miscanthus RhizosphereMTKLVLALALAFATLATAPASAGPSCQEDLGYGRTSSFGCGG*
Ga0074051_1171958023300006572SoilIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0066660_1001670353300006800SoilMITRISLALALMMTLLANVPASAGPRCQEDLGYGRTSSWGCG*
Ga0075428_10022573833300006844Populus RhizosphereMTRIVLALALAMATLATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0075428_10206686223300006844Populus RhizosphereKIVFALALAIAALATVPASAGKGCQEDLGYGRTSSFGCGG*
Ga0075428_10235964323300006844Populus RhizosphereMTKLVLALALAIATLATVPANAGGKYCQEDLGYGRTSSFGCGG*
Ga0075421_10169711213300006845Populus RhizosphereMTKIVLALALALATLATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0075435_10133234413300007076Populus RhizosphereAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0105250_1038574923300009092Switchgrass RhizosphereMTMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0105245_1007278733300009098Miscanthus RhizosphereMTMINKIVLAIVLTIATLAAVLASAGPYCQEDLGYGRTSSFGCGG*
Ga0105245_1168731523300009098Miscanthus RhizospherePTKTGQRRTTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0075418_1119410813300009100Populus RhizosphereMTKIVFALALAIAALAAVPASAGKGCQEDLGYGRTSSFG
Ga0099792_1041079123300009143Vadose Zone SoilMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0099792_1045901323300009143Vadose Zone SoilMTKMNKIMLAIVLAIATLAAVPATAGPYCQEDLGYGRTSSFGCGG*
Ga0111538_1072322013300009156Populus RhizosphereLKQRPIKGETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0075423_1117739823300009162Populus RhizosphereMTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0105241_1006967533300009174Corn RhizosphereMTMINKIVLAIVLTIATLSTVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0105242_1024021113300009176Miscanthus RhizosphereTTYRSKETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0105248_1153766223300009177Switchgrass RhizosphereLALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0105237_1006772813300009545Corn RhizosphereMTMINKIVLAIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0105237_1014161533300009545Corn RhizosphereMTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0105249_1187724013300009553Switchgrass RhizosphereQRRMTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0126308_1070986813300010040Serpentine SoilMTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0126311_1127134623300010045Serpentine SoilVLAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0126382_1141810023300010047Tropical Forest SoilMTKFVLALALAFAAVANVPAYAGPYCQEDLGYGRTSSFGCGG*
Ga0134067_1008267413300010321Grasslands SoilIMITRITLALALMITLLANVPASAGPRCQEDLGYGRTSSWGCG*
Ga0126376_1041926013300010359Tropical Forest SoilKYVLALALAFAAVANVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0126376_1206678523300010359Tropical Forest SoilALALAIAALATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0126377_1211225923300010362Tropical Forest SoilMTKIVFALALTIAALATVPASAGKGCQEDLGYGRTSSF
Ga0134125_1245805123300010371Terrestrial SoilMTMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0134125_1262590723300010371Terrestrial SoilMTMINKILLAIALTIATLATVPASAGPYCQEDLGYGR
Ga0134128_1224263433300010373Terrestrial SoilMTPIQQEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0105239_1011584043300010375Corn RhizosphereMTKLVLALALAFVTLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0134124_1078475313300010397Terrestrial SoilMTKLILALALAFATLATVPASAGPSCQEDLGYGRTSSFG
Ga0134124_1273317413300010397Terrestrial SoilPTNTGQRRTTMINKIVLAIALTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0134122_1174129413300010400Terrestrial SoilMTKIVLAIALAIAAFATVPAAAGPYCQEDLGYGRTSSFGC
Ga0134121_1241842523300010401Terrestrial SoilMTKLVLALALAFATLATVPASAGPSCQEDLGYGRT
Ga0120191_1011912423300012022TerrestrialMTKFVLALALAMATLATVPAAAGLYCQEDLGYGRTSSFGCGG*
Ga0137399_1089366323300012203Vadose Zone SoilMTKIVLAIVLAIATLATVPASARPSCQEDLGYGRTGNFGCGG*
Ga0150985_10858689113300012212Avena Fatua RhizosphereTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0150984_10711587613300012469Avena Fatua RhizosphereKNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0150984_12200408213300012469Avena Fatua RhizosphereMTMINKIALAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCGG*
Ga0157301_1040731813300012911SoilMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSF
Ga0157302_1007262013300012915SoilMTKIVLAIALASAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0137407_1019477523300012930Vadose Zone SoilMIMMTKVALAVALAIAALVAVPASAHPNHCQEDLGYGRTGSFGCGG*
Ga0162653_10001884613300012937SoilLMTKLVLALALAFATLATVPASAGPSCQEDLGYGRTSSFGCGG*
Ga0162653_10005704423300012937SoilMTKIVLALALAFVAFATVPAAAGPYCQEDLGYGRTSSFGC
Ga0162650_10003054913300012939SoilMTMINKIALAIVLTIATLAAVPASAGPHCQEDLGYGRTSSFGCGG*
Ga0164300_1012016533300012951SoilMTKLVLALALALATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0164299_1026606613300012958SoilMTKLVLALALAFATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0164302_1050350313300012961SoilLPPISTKSIQQETIMTKIVLAIALAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0164302_1067736513300012961SoilLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0164304_1164956323300012986SoilALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0164307_1114740213300012987SoilKILVTIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0164305_1119235313300012989SoilNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0157378_1267446813300013297Miscanthus RhizosphereMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFG
Ga0163162_1096856613300013306Switchgrass RhizosphereETIMTKFVIALALTIATLAAVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0163162_1145109813300013306Switchgrass RhizosphereALAFATLATVPASAGPYCQEDLGYGRTGSFGCGG*
Ga0157376_1045769413300014969Miscanthus RhizosphereTYRSKETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0132258_1124038623300015371Arabidopsis RhizosphereMTKMNRIILAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG*
Ga0132258_1160104943300015371Arabidopsis RhizosphereALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0132256_10034525243300015372Arabidopsis RhizosphereMTKFVLALALAFAAVANVPASAGPYCQEDLGYGRT
Ga0132257_10249997213300015373Arabidopsis RhizosphereMTMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSGFGCG
Ga0132255_10228935533300015374Arabidopsis RhizospherePSGLPPISTKSIQQETIMTKIVLAVALAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG*
Ga0163161_1154134613300017792Switchgrass RhizosphereMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0190266_1006404223300017965SoilMTKLVLALALAFATLATVPASAGPSCQEDLGYGRTSSFGCGG
Ga0190266_1034579023300017965SoilMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0190266_1050856513300017965SoilMTKFVLALVLALATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0187776_1075712733300017966Tropical PeatlandLALALTFASLATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0184605_1001446433300018027Groundwater SedimentMNKILLAIVLAIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0184605_1005057333300018027Groundwater SedimentMTKFVLALALAFATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0184608_1000342443300018028Groundwater SedimentMNKIMLAIVLAIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0184634_1000991923300018031Groundwater SedimentMNKIILAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0184634_1008127723300018031Groundwater SedimentMINKIVLAIILTIATLAAVPTSAGPYCQEDLGYGRTSSFGCGG
Ga0184620_1001863823300018051Groundwater SedimentMNKILLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0184640_1009991513300018074Groundwater SedimentMNKIILAIVLTIATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0184625_1006026813300018081Groundwater SedimentMNKILLTIVLAIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0066655_1055275113300018431Grasslands SoilMITRITLALALMITLLANVPASAGPRCQEDLGYGRTSSWGCG
Ga0190269_1008195533300018465SoilMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCGG
Ga0190274_1030171523300018476SoilMINKIVLAIILTIATLAAVPASAGPYCQEDLGYGRT
Ga0190274_1043609923300018476SoilMINKIVLAMILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0190274_1149217333300018476SoilTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0066669_1115131823300018482Grasslands SoilMTKFVVALALALSTLATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0190273_1167173523300018920SoilMTKLVLALALAFATLATVPASAGPYCQEDLGYGRT
Ga0173481_1030823613300019356SoilMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0173482_1009294813300019361SoilIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0173479_1041432213300019362SoilQRRMTMNKILVTIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0193705_105614723300019869SoilMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0193718_112128313300019999SoilMTKLVLALALAFATLATVPASAGPSCQEDLGYGRTSSFG
Ga0193697_104674423300020005SoilMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTS
Ga0193697_114457313300020005SoilMTKFVLALVLALATLAAVPASAGPYCQEDLGYGRTSSFGC
Ga0193696_102302813300020016SoilMTKLVLTLALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0210381_1001704633300021078Groundwater SedimentVADFSNPIQEEITMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0210382_1032086213300021080Groundwater SedimentRNPIQEEITMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0210380_1000773133300021082Groundwater SedimentMINKIVLAIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0210380_1042471813300021082Groundwater SedimentMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCCFSRD
Ga0193719_1011843423300021344SoilMTKMNKIMLAIVLAIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0222621_107964423300021510Groundwater SedimentYNPIQEEITMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0222623_1000349133300022694Groundwater SedimentMTKFVLALALTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0222623_1016994013300022694Groundwater SedimentQPGRRKPIYQPQETIMTKFVLALALAFATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0222622_1062086313300022756Groundwater SedimentMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGC
Ga0222622_1080236313300022756Groundwater SedimentMTKFVLALAFAIATLAAVPASAGPYCQEDLGYGRTS
Ga0247789_101031323300023266SoilMNKILVTIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207710_1002118333300025900Switchgrass RhizosphereMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGC
Ga0207710_1012089633300025900Switchgrass RhizosphereKTGQRRMTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207688_1002112343300025901Corn, Switchgrass And Miscanthus RhizosphereMTKLVLALALAFATLATVPASAGPSCQEDLGYGRTGSFGCGG
Ga0207685_1009355133300025905Corn, Switchgrass And Miscanthus RhizospherePTKTGQRRMTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207645_1023196923300025907Miscanthus RhizosphereMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTGSFGCGG
Ga0207671_1144870223300025914Corn RhizosphereMNKILVTIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCG
Ga0207657_1013241443300025919Corn RhizosphereMTKFVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207649_1091344013300025920Corn RhizosphereQNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0207681_1179096613300025923Switchgrass RhizosphereETKNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0207650_1041709533300025925Switchgrass RhizosphereLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0207659_1105329023300025926Miscanthus RhizosphereYRSKETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207700_1203308413300025928Corn, Switchgrass And Miscanthus RhizosphereKNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0207644_1129987223300025931Switchgrass RhizosphereMTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207690_1171090613300025932Corn RhizosphereTLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207686_1130798913300025934Miscanthus RhizospherePIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0207670_1094875413300025936Switchgrass RhizosphereETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207665_1135332013300025939Corn, Switchgrass And Miscanthus RhizosphereMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCG
Ga0207651_1213089723300025960Switchgrass RhizosphereGETLMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207668_1126903413300025972Switchgrass RhizosphereAILPTNTGQRRMTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSGFGCGG
Ga0207668_1137859833300025972Switchgrass RhizosphereKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0207678_1108805113300026067Corn RhizosphereNTGQRRMTMINKIVLAIVLTIATLATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0207675_10270757513300026118Switchgrass RhizospherePISTKSIQQETIMTKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0207698_1252217323300026142Corn RhizosphereMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSFGCG
Ga0257157_109836123300026496SoilPIQEEITMTKIVLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0179587_1107127223300026557Vadose Zone SoilTKIVLALVLAIAAFATVPAVAGPYCQEDLGYGRTSSFGCGG
Ga0208997_100552823300027181Forest SoilMTKIVLALALAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0209106_100108413300027616Forest SoilMPKIFLLLAFAIALSATVPATAGPHCQEDLGYGRTSSFGCGG
Ga0209813_1013843013300027866Populus EndosphereVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0209813_1014826523300027866Populus EndosphereMINKIVLAIVLTIAALATVPASAGPYCQEDLGYGRTSGFGCGG
Ga0209814_1055222923300027873Populus RhizosphereIMTKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0209488_1025050413300027903Vadose Zone SoilMTKMNKIMLAIVLAIATLAAVPATAGPYCQEDLGYGRTSSFGCGC
Ga0209488_1041166623300027903Vadose Zone SoilMSKIVMSKIVLAVVLAIATLATIPASARPNCQEDLGYGRTGMFGCGG
Ga0209382_1060194623300027909Populus RhizosphereMTKIVFALALAIAALAAVPASAGKGCQEDLGYGRTSSFGCGG
Ga0209382_1079474923300027909Populus RhizosphereMTKFVLALALAFAAAATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0209382_1172999723300027909Populus RhizosphereMTKFILALALALAAAATVPASAGPYCQEDLGYGRTSSFGCGG
Ga0247828_1086555513300028587SoilMTKIVHAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFGC
Ga0307321_104501623300028704SoilMTKIVLAIVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0307322_1003158023300028710SoilMTKFVLALALTFASLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307322_1010841613300028710SoilMTKFVIALALTIATLAAVPAAAGPYCQEDLGYGRTSS
Ga0307285_1010164913300028712SoilMTKFVIALALTIATLAAVPAAAGPYCQEDLGYGRTS
Ga0307311_1009195323300028716SoilMNKILLAIVLAIATLAAVPASAGPYCQEDLGYGRTSSFACGG
Ga0307317_1012548923300028720SoilMTKMNKMILAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307319_1011513313300028722SoilMINKIVLAIILTIATLAAVPASAGPYCQEDLGYGRTSGFGCGG
Ga0307297_1006857313300028754SoilLALVLAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0307316_1006263313300028755SoilMTKFVIALALTIATLAALPAAAGPYCQEDLGYGRTSSFGCGG
Ga0307316_1014085333300028755SoilKPIYQPQETIMTKFVLALALAFATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307316_1017626923300028755SoilGQRRMTMINKIVLAIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307320_1016896523300028771SoilMTKMNKIILAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307282_1035463023300028784SoilMINKIVLAIALTIATLAAVPASAGPYCQEDLGYGRTSGFGCGG
Ga0307282_1064224123300028784SoilQRRVTKMNKIMLAIVLAIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307283_1007386723300028790SoilMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSGFGCGG
Ga0307290_1001854823300028791SoilMNKMILAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307299_1012831613300028793SoilRRVTKMNKIMLAIVLAIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0247824_1021249013300028809SoilMTKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSSFG
Ga0307294_1006208823300028810SoilMINKIVLAIVLAIATLATVPASAGPYCQEDLGYGRTSGFGCGG
Ga0307294_1031215923300028810SoilMNKIILAIVLTIATLAAVPASAGPYCQEDLATDAPA
Ga0307302_1067773113300028814SoilMTKIVLALVLAIAAFATVPAVAGPYCQEDLGYGRTSSFGCGG
Ga0307289_1004276723300028875SoilMTKFVLALALAIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307289_1005933813300028875SoilDIKNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0307286_1009628713300028876SoilNKIVLAIILTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307500_1024485123300031198SoilMIMITKIALAVALAIAALAAVPVSAQPNHCQEDLGYGRTGSFGCGG
Ga0307497_1008347013300031226SoilVLAIVLVIATLATVPASARPSCQEDLGYGRTGSFGCG
Ga0310887_1007244113300031547SoilKLVLALALAFATLATVPASAGPSCQEDLGYGRTSSFGCGG
Ga0307469_1238522713300031720Hardwood Forest SoilMTKIVFALALAIAAFATVPASAGKGCQEDLGYGRTSSFGCGG
Ga0307468_10033661033300031740Hardwood Forest SoilQRRMTMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307468_10051523513300031740Hardwood Forest SoilMMTRIALAVALAIAVLAAVPASAHPNHCQEDLGYGRTGSFGCGG
Ga0310907_1065936713300031847SoilMINKIVLAIALTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0310892_1025655633300031858SoilQRRITMINKIVLAIVLTIATLAAVPASAGPYCQEDLGYGRTSSFGCGG
Ga0310892_1031630723300031858SoilMTKIVLAIALAMAAFATVPAAAGPYCQEDLGYGRTSS
Ga0310900_1025390333300031908SoilMTKLVLALALAFATLATVPASAGPYCQEDLGYGRTSSYGCGG
Ga0310902_1008852313300032012SoilTMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0310906_1060041733300032013SoilGRPSGLPPISTKSIQQETIMTKIVLAVALAMAAFATVPAAAGPYCQEDLGYGRTSSFGCG
Ga0310906_1127454813300032013SoilMNKILVTIILTIATLAAVPASAGPYCQEDLGYGRTSS
Ga0310906_1142640023300032013SoilTKNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0307471_10120316323300032180Hardwood Forest SoilMTKFVLALALAFAAVANVPASAGPYCQEDLGYGRTSSFGCGG
Ga0307472_10191821823300032205Hardwood Forest SoilMTKIVFALALAIAALATVPASAGKGCQEDLGYGRTSSFGCGG
Ga0306920_10362107223300032261SoilMKRIVLALAFALMAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0370545_160643_18_1583300034643SoilMIMMTKIALAVALAIAALAAVPVSAHPNHCQEDLGYGRTGSFGCGG
Ga0314788_042434_3_1553300034666SoilNPIQEEITMTKIVLALALAFAAFATVPAAAGPYCQEDLGYGRTSSFGCGG
Ga0314788_193865_81_2093300034666SoilMTKIVLAVALAIAAFATVPAAAGPYCQEDLGYGRTSSFGCGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.