Basic Information | |
---|---|
Family ID | F013116 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 274 |
Average Sequence Length | 43 residues |
Representative Sequence | VDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG |
Number of Associated Samples | 216 |
Number of Associated Scaffolds | 274 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.82 % |
% of genes near scaffold ends (potentially truncated) | 90.88 % |
% of genes from short scaffolds (< 2000 bps) | 94.16 % |
Associated GOLD sequencing projects | 205 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.577 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.927 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.496 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.336 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.29% β-sheet: 20.59% Coil/Unstructured: 69.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 274 Family Scaffolds |
---|---|---|
PF00196 | GerE | 4.74 |
PF13472 | Lipase_GDSL_2 | 3.28 |
PF13561 | adh_short_C2 | 2.55 |
PF05988 | DUF899 | 2.55 |
PF02909 | TetR_C_1 | 2.55 |
PF00583 | Acetyltransf_1 | 2.55 |
PF01266 | DAO | 2.19 |
PF07883 | Cupin_2 | 2.19 |
PF13419 | HAD_2 | 2.19 |
PF01411 | tRNA-synt_2c | 1.82 |
PF08241 | Methyltransf_11 | 1.46 |
PF04828 | GFA | 1.46 |
PF07311 | Dodecin | 1.46 |
PF13649 | Methyltransf_25 | 1.46 |
PF12680 | SnoaL_2 | 1.09 |
PF01494 | FAD_binding_3 | 1.09 |
PF00005 | ABC_tran | 1.09 |
PF02896 | PEP-utilizers_C | 1.09 |
PF16864 | Dimerisation2 | 1.09 |
PF12806 | Acyl-CoA_dh_C | 1.09 |
PF01230 | HIT | 1.09 |
PF01053 | Cys_Met_Meta_PP | 0.73 |
PF13193 | AMP-binding_C | 0.73 |
PF00561 | Abhydrolase_1 | 0.73 |
PF01242 | PTPS | 0.73 |
PF01641 | SelR | 0.73 |
PF12697 | Abhydrolase_6 | 0.73 |
PF01841 | Transglut_core | 0.73 |
PF00440 | TetR_N | 0.73 |
PF12727 | PBP_like | 0.73 |
PF03061 | 4HBT | 0.73 |
PF00891 | Methyltransf_2 | 0.73 |
PF04545 | Sigma70_r4 | 0.73 |
PF07366 | SnoaL | 0.73 |
PF13602 | ADH_zinc_N_2 | 0.36 |
PF00067 | p450 | 0.36 |
PF00436 | SSB | 0.36 |
PF03965 | Penicillinase_R | 0.36 |
PF07521 | RMMBL | 0.36 |
PF03070 | TENA_THI-4 | 0.36 |
PF00999 | Na_H_Exchanger | 0.36 |
PF01625 | PMSR | 0.36 |
PF02574 | S-methyl_trans | 0.36 |
PF01527 | HTH_Tnp_1 | 0.36 |
PF06441 | EHN | 0.36 |
PF13847 | Methyltransf_31 | 0.36 |
PF04542 | Sigma70_r2 | 0.36 |
PF02541 | Ppx-GppA | 0.36 |
PF13671 | AAA_33 | 0.36 |
PF07995 | GSDH | 0.36 |
PF00313 | CSD | 0.36 |
PF03848 | TehB | 0.36 |
PF14534 | DUF4440 | 0.36 |
PF02897 | Peptidase_S9_N | 0.36 |
PF13683 | rve_3 | 0.36 |
PF03547 | Mem_trans | 0.36 |
PF00551 | Formyl_trans_N | 0.36 |
PF14026 | DUF4242 | 0.36 |
PF02515 | CoA_transf_3 | 0.36 |
PF13191 | AAA_16 | 0.36 |
PF04030 | ALO | 0.36 |
PF00365 | PFK | 0.36 |
PF13279 | 4HBT_2 | 0.36 |
PF00872 | Transposase_mut | 0.36 |
PF08031 | BBE | 0.36 |
PF01757 | Acyl_transf_3 | 0.36 |
PF13450 | NAD_binding_8 | 0.36 |
PF10017 | Methyltransf_33 | 0.36 |
PF00753 | Lactamase_B | 0.36 |
PF05544 | Pro_racemase | 0.36 |
PF08240 | ADH_N | 0.36 |
PF04185 | Phosphoesterase | 0.36 |
PF13185 | GAF_2 | 0.36 |
PF05853 | BKACE | 0.36 |
PF12831 | FAD_oxidored | 0.36 |
PF12802 | MarR_2 | 0.36 |
PF06445 | GyrI-like | 0.36 |
PF04191 | PEMT | 0.36 |
PF04264 | YceI | 0.36 |
PF00248 | Aldo_ket_red | 0.36 |
PF01695 | IstB_IS21 | 0.36 |
PF13751 | DDE_Tnp_1_6 | 0.36 |
PF00202 | Aminotran_3 | 0.36 |
PF07730 | HisKA_3 | 0.36 |
PF01432 | Peptidase_M3 | 0.36 |
PF03109 | ABC1 | 0.36 |
COG ID | Name | Functional Category | % Frequency in 274 Family Scaffolds |
---|---|---|---|
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 2.55 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 2.55 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.19 |
COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.82 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.46 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.46 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.09 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.09 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.09 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.73 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.73 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.73 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.73 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.73 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.73 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.73 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 0.73 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.73 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.73 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.73 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.73 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.73 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.36 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.36 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.36 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.36 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.36 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.36 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.36 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.36 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.36 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.36 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.36 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.36 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.36 |
COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.36 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.36 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.36 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.36 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.36 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.36 |
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.36 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.36 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.36 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.36 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.36 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.36 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.36 |
COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 0.36 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.36 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.36 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.36 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.36 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.36 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.36 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.58 % |
Unclassified | root | N/A | 16.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573001|GZR05M101E12KE | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 502 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104958870 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10480930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300004152|Ga0062386_101825341 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300004157|Ga0062590_101298250 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005161|Ga0066807_1013519 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005172|Ga0066683_10208318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1208 | Open in IMG/M |
3300005329|Ga0070683_101259300 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005331|Ga0070670_100619568 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300005338|Ga0068868_100918359 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300005347|Ga0070668_101144326 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005354|Ga0070675_100819704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
3300005434|Ga0070709_11129274 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300005439|Ga0070711_100110223 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
3300005440|Ga0070705_101739955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Caldilineae → Caldilineales → Caldilineaceae → Caldilinea → Caldilinea aerophila | 528 | Open in IMG/M |
3300005467|Ga0070706_100247368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1665 | Open in IMG/M |
3300005561|Ga0066699_10027668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3230 | Open in IMG/M |
3300005610|Ga0070763_10193049 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300005616|Ga0068852_100927537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 888 | Open in IMG/M |
3300005764|Ga0066903_101666944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1212 | Open in IMG/M |
3300005764|Ga0066903_104727111 | Not Available | 725 | Open in IMG/M |
3300005841|Ga0068863_102661933 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005844|Ga0068862_101944838 | Not Available | 598 | Open in IMG/M |
3300006028|Ga0070717_10098696 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
3300006028|Ga0070717_10871685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 819 | Open in IMG/M |
3300006052|Ga0075029_101072389 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300006102|Ga0075015_100384701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 789 | Open in IMG/M |
3300006173|Ga0070716_100572400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 845 | Open in IMG/M |
3300006574|Ga0074056_10798067 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300006575|Ga0074053_11807983 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300006605|Ga0074057_11683211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 597 | Open in IMG/M |
3300006904|Ga0075424_101090758 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300006953|Ga0074063_13074922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mirabilis | 642 | Open in IMG/M |
3300006954|Ga0079219_11396135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
3300006954|Ga0079219_12462645 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300009098|Ga0105245_11185279 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300009143|Ga0099792_10382704 | Not Available | 857 | Open in IMG/M |
3300009147|Ga0114129_13326871 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009162|Ga0075423_11466213 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300009174|Ga0105241_10870818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 834 | Open in IMG/M |
3300009520|Ga0116214_1072364 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300009521|Ga0116222_1274792 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300009521|Ga0116222_1512530 | Not Available | 525 | Open in IMG/M |
3300009524|Ga0116225_1317186 | Not Available | 695 | Open in IMG/M |
3300009551|Ga0105238_10315369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1549 | Open in IMG/M |
3300009683|Ga0116224_10543675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
3300009698|Ga0116216_10304978 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300009792|Ga0126374_10061035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1969 | Open in IMG/M |
3300009792|Ga0126374_10439001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
3300010046|Ga0126384_11090894 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300010046|Ga0126384_12347795 | Not Available | 515 | Open in IMG/M |
3300010049|Ga0123356_10463605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1417 | Open in IMG/M |
3300010337|Ga0134062_10316394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 743 | Open in IMG/M |
3300010339|Ga0074046_10262699 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300010358|Ga0126370_10446541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1077 | Open in IMG/M |
3300010359|Ga0126376_12824419 | Not Available | 535 | Open in IMG/M |
3300010361|Ga0126378_11685034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
3300010366|Ga0126379_10197375 | Not Available | 1932 | Open in IMG/M |
3300010366|Ga0126379_12371740 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300010371|Ga0134125_10305136 | Not Available | 1767 | Open in IMG/M |
3300010371|Ga0134125_11271205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 803 | Open in IMG/M |
3300010373|Ga0134128_12566318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 562 | Open in IMG/M |
3300010373|Ga0134128_13140780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300010375|Ga0105239_11423358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300010376|Ga0126381_101972252 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300010379|Ga0136449_101219213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
3300010379|Ga0136449_104309898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300010396|Ga0134126_12625852 | Not Available | 547 | Open in IMG/M |
3300010397|Ga0134124_11692779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
3300010399|Ga0134127_12808530 | Not Available | 566 | Open in IMG/M |
3300010400|Ga0134122_12658323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 552 | Open in IMG/M |
3300010401|Ga0134121_12264564 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 581 | Open in IMG/M |
3300010403|Ga0134123_10234366 | Not Available | 1586 | Open in IMG/M |
3300010403|Ga0134123_11295243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 764 | Open in IMG/M |
3300012201|Ga0137365_10672951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
3300012212|Ga0150985_112793750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 926 | Open in IMG/M |
3300012897|Ga0157285_10150465 | Not Available | 692 | Open in IMG/M |
3300012905|Ga0157296_10304975 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300012907|Ga0157283_10425240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300012916|Ga0157310_10513021 | Not Available | 524 | Open in IMG/M |
3300012955|Ga0164298_10595917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
3300012957|Ga0164303_10784049 | Not Available | 653 | Open in IMG/M |
3300012960|Ga0164301_11811865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 513 | Open in IMG/M |
3300013102|Ga0157371_10562680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
3300013105|Ga0157369_12253897 | Not Available | 552 | Open in IMG/M |
3300013297|Ga0157378_10720559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
3300013307|Ga0157372_11645222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
3300014745|Ga0157377_10003569 | All Organisms → cellular organisms → Bacteria | 7041 | Open in IMG/M |
3300014969|Ga0157376_10148370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2112 | Open in IMG/M |
3300015371|Ga0132258_10725381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2503 | Open in IMG/M |
3300015372|Ga0132256_102709217 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300016319|Ga0182033_11055210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300016319|Ga0182033_12158565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
3300016357|Ga0182032_10970265 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300016371|Ga0182034_11253767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 646 | Open in IMG/M |
3300016371|Ga0182034_11833211 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300016404|Ga0182037_11594149 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300016422|Ga0182039_10682222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 904 | Open in IMG/M |
3300016422|Ga0182039_11909246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
3300016445|Ga0182038_11770149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300016445|Ga0182038_12025833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309 | 521 | Open in IMG/M |
3300017821|Ga0187812_1019233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2360 | Open in IMG/M |
3300017823|Ga0187818_10568698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300017928|Ga0187806_1203521 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300017933|Ga0187801_10344790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
3300017943|Ga0187819_10407134 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300017961|Ga0187778_10554666 | Not Available | 767 | Open in IMG/M |
3300017966|Ga0187776_10652330 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300017970|Ga0187783_11353294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 513 | Open in IMG/M |
3300017974|Ga0187777_10760873 | Not Available | 690 | Open in IMG/M |
3300017994|Ga0187822_10266600 | Not Available | 594 | Open in IMG/M |
3300017999|Ga0187767_10149183 | Not Available | 699 | Open in IMG/M |
3300018058|Ga0187766_10229258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1181 | Open in IMG/M |
3300018058|Ga0187766_10473363 | Not Available | 840 | Open in IMG/M |
3300018058|Ga0187766_11356060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
3300018060|Ga0187765_10119452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1458 | Open in IMG/M |
3300018085|Ga0187772_10236539 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300018431|Ga0066655_11150608 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300019361|Ga0173482_10140396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 929 | Open in IMG/M |
3300020082|Ga0206353_10504778 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300020150|Ga0187768_1076854 | Not Available | 753 | Open in IMG/M |
3300021358|Ga0213873_10199467 | Not Available | 620 | Open in IMG/M |
3300021374|Ga0213881_10083926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1369 | Open in IMG/M |
3300021377|Ga0213874_10136863 | Not Available | 845 | Open in IMG/M |
3300021384|Ga0213876_10056262 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
3300021384|Ga0213876_10367586 | Not Available | 765 | Open in IMG/M |
3300021384|Ga0213876_10591433 | Not Available | 590 | Open in IMG/M |
3300021388|Ga0213875_10183669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
3300021388|Ga0213875_10595401 | Not Available | 534 | Open in IMG/M |
3300021402|Ga0210385_10537560 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300021403|Ga0210397_10995025 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300021407|Ga0210383_10523517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1023 | Open in IMG/M |
3300021420|Ga0210394_11365193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 604 | Open in IMG/M |
3300021420|Ga0210394_11512396 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021432|Ga0210384_10114926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 2413 | Open in IMG/M |
3300021478|Ga0210402_11950799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 513 | Open in IMG/M |
3300021560|Ga0126371_11548997 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300022886|Ga0247746_1084628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300023077|Ga0247802_1070806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300025907|Ga0207645_10377816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
3300025916|Ga0207663_10208661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 1414 | Open in IMG/M |
3300025917|Ga0207660_11380431 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300025927|Ga0207687_11224852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
3300025928|Ga0207700_11839919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 532 | Open in IMG/M |
3300025932|Ga0207690_10943157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
3300025935|Ga0207709_10555997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 903 | Open in IMG/M |
3300025935|Ga0207709_11217567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300025936|Ga0207670_10351762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
3300026067|Ga0207678_12006896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 503 | Open in IMG/M |
3300026075|Ga0207708_11720628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
3300026121|Ga0207683_11085735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
3300026335|Ga0209804_1337330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 507 | Open in IMG/M |
3300026542|Ga0209805_1027365 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
3300027070|Ga0208365_1060700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300027297|Ga0208241_1020649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
3300027497|Ga0208199_1068466 | Not Available | 746 | Open in IMG/M |
3300027604|Ga0208324_1006713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3921 | Open in IMG/M |
3300027884|Ga0209275_10019069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3047 | Open in IMG/M |
3300027915|Ga0209069_10215276 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300028587|Ga0247828_10881299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola | 575 | Open in IMG/M |
3300028589|Ga0247818_10357253 | Not Available | 979 | Open in IMG/M |
3300028592|Ga0247822_11092486 | Not Available | 662 | Open in IMG/M |
3300028708|Ga0307295_10212330 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300028906|Ga0308309_10530621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. HBU65207 | 1019 | Open in IMG/M |
3300030336|Ga0247826_10204635 | Not Available | 1353 | Open in IMG/M |
3300030336|Ga0247826_10601525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 843 | Open in IMG/M |
3300030902|Ga0308202_1100749 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300031092|Ga0308204_10175201 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300031226|Ga0307497_10639308 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300031543|Ga0318516_10613792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
3300031543|Ga0318516_10637941 | Not Available | 607 | Open in IMG/M |
3300031544|Ga0318534_10317941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300031544|Ga0318534_10505528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
3300031544|Ga0318534_10776518 | Not Available | 539 | Open in IMG/M |
3300031545|Ga0318541_10481617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
3300031546|Ga0318538_10347566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
3300031546|Ga0318538_10395061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
3300031549|Ga0318571_10093951 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300031549|Ga0318571_10268795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 632 | Open in IMG/M |
3300031549|Ga0318571_10363312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
3300031564|Ga0318573_10302280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
3300031572|Ga0318515_10166141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1179 | Open in IMG/M |
3300031572|Ga0318515_10263503 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300031572|Ga0318515_10626420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300031573|Ga0310915_10292678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1150 | Open in IMG/M |
3300031668|Ga0318542_10246061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 909 | Open in IMG/M |
3300031679|Ga0318561_10573584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300031681|Ga0318572_10302818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
3300031681|Ga0318572_10406070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
3300031682|Ga0318560_10493532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
3300031713|Ga0318496_10070303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 1843 | Open in IMG/M |
3300031716|Ga0310813_10368552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
3300031719|Ga0306917_10528515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
3300031720|Ga0307469_11992398 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031723|Ga0318493_10374695 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300031724|Ga0318500_10478908 | Not Available | 624 | Open in IMG/M |
3300031747|Ga0318502_10250239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1034 | Open in IMG/M |
3300031751|Ga0318494_10064248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 1964 | Open in IMG/M |
3300031751|Ga0318494_10889352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 522 | Open in IMG/M |
3300031769|Ga0318526_10173400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
3300031769|Ga0318526_10205346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 805 | Open in IMG/M |
3300031770|Ga0318521_10441159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309 | 779 | Open in IMG/M |
3300031770|Ga0318521_10741194 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031770|Ga0318521_11042695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
3300031771|Ga0318546_10170544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1475 | Open in IMG/M |
3300031771|Ga0318546_10751315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 686 | Open in IMG/M |
3300031778|Ga0318498_10524599 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031779|Ga0318566_10161628 | Not Available | 1111 | Open in IMG/M |
3300031792|Ga0318529_10146518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
3300031797|Ga0318550_10638216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309 | 511 | Open in IMG/M |
3300031798|Ga0318523_10678523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300031798|Ga0318523_10680313 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300031799|Ga0318565_10377154 | Not Available | 688 | Open in IMG/M |
3300031805|Ga0318497_10133260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1351 | Open in IMG/M |
3300031805|Ga0318497_10585639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
3300031819|Ga0318568_10125647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1554 | Open in IMG/M |
3300031820|Ga0307473_10295336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
3300031821|Ga0318567_10040841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2359 | Open in IMG/M |
3300031821|Ga0318567_10582533 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300031831|Ga0318564_10464426 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300031832|Ga0318499_10232494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 717 | Open in IMG/M |
3300031832|Ga0318499_10338525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300031832|Ga0318499_10391329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300031833|Ga0310917_10603947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
3300031846|Ga0318512_10081186 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300031846|Ga0318512_10182883 | Not Available | 1021 | Open in IMG/M |
3300031860|Ga0318495_10352607 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300031879|Ga0306919_10729429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
3300031879|Ga0306919_11393784 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300031890|Ga0306925_11444571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
3300031890|Ga0306925_11548716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 647 | Open in IMG/M |
3300031893|Ga0318536_10301788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 812 | Open in IMG/M |
3300031894|Ga0318522_10031021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1808 | Open in IMG/M |
3300031896|Ga0318551_10406618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
3300031896|Ga0318551_10609885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium mesophilum → Rubellimicrobium mesophilum DSM 19309 | 630 | Open in IMG/M |
3300031910|Ga0306923_10777658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1059 | Open in IMG/M |
3300031910|Ga0306923_11034127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
3300031910|Ga0306923_12284438 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031912|Ga0306921_10159908 | Not Available | 2637 | Open in IMG/M |
3300031941|Ga0310912_10752086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 754 | Open in IMG/M |
3300031942|Ga0310916_10529347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1003 | Open in IMG/M |
3300031962|Ga0307479_10990042 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300031962|Ga0307479_11442363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 646 | Open in IMG/M |
3300032001|Ga0306922_11393990 | Not Available | 705 | Open in IMG/M |
3300032008|Ga0318562_10531320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 681 | Open in IMG/M |
3300032009|Ga0318563_10436787 | Not Available | 708 | Open in IMG/M |
3300032009|Ga0318563_10535314 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300032035|Ga0310911_10244459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1027 | Open in IMG/M |
3300032041|Ga0318549_10299242 | Not Available | 725 | Open in IMG/M |
3300032044|Ga0318558_10307442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
3300032044|Ga0318558_10413112 | Not Available | 672 | Open in IMG/M |
3300032065|Ga0318513_10097795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1370 | Open in IMG/M |
3300032065|Ga0318513_10136086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetomorum → unclassified Candidatus Magnetomorum → Candidatus Magnetomorum sp. HK-1 | 1167 | Open in IMG/M |
3300032066|Ga0318514_10245797 | Not Available | 942 | Open in IMG/M |
3300032068|Ga0318553_10011051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3964 | Open in IMG/M |
3300032068|Ga0318553_10649399 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300032076|Ga0306924_11513164 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300032076|Ga0306924_12515809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
3300032090|Ga0318518_10548645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium roseum | 591 | Open in IMG/M |
3300032090|Ga0318518_10671074 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300032160|Ga0311301_11648421 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300032261|Ga0306920_103079233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 627 | Open in IMG/M |
3300032261|Ga0306920_103437277 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300032261|Ga0306920_104408814 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300032770|Ga0335085_10331349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1791 | Open in IMG/M |
3300032783|Ga0335079_11181969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium roseum | 770 | Open in IMG/M |
3300032892|Ga0335081_12520062 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300032898|Ga0335072_10097957 | All Organisms → cellular organisms → Bacteria | 3759 | Open in IMG/M |
3300032898|Ga0335072_10388543 | Not Available | 1504 | Open in IMG/M |
3300033158|Ga0335077_10998041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
3300033290|Ga0318519_10679387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
3300033550|Ga0247829_10940161 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300033803|Ga0314862_0018851 | Not Available | 1328 | Open in IMG/M |
3300033808|Ga0314867_072564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.01% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.01% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.01% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.01% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.19% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.19% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 2.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.46% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.09% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.09% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.09% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.09% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.09% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.73% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.73% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.73% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.36% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.36% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.36% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.36% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.36% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.36% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD2_07379770 | 2189573001 | Grass Soil | VNYIQVLRFRDGKHVSFNLMFDRLTMLEQLGLVPTSAVAA |
INPhiseqgaiiFebDRAFT_1049588701 | 3300000364 | Soil | DVPPTGRCVKVDYIQVLRFRDGKHLSFNLMFDRLTMLEQLGLVPAPAEAA* |
JGIcombinedJ51221_104809302 | 3300003505 | Forest Soil | VTVDYIHVLRYRDGKHVSFNLIFDRLQMLEQLGIIPAPAPTG* |
Ga0062386_1018253411 | 3300004152 | Bog Forest Soil | GEIPPTGRSIRVPYTHVLRYRDGLHISFSLLFDRLEMLEQLGVVPVPANAR* |
Ga0062590_1012982501 | 3300004157 | Soil | DYLQVLGFRDGKHVSFNLMFDRLSMLEQLGLVPTPDSDEARGSRP* |
Ga0066807_10135192 | 3300005161 | Soil | VNLDYIQMLRFREGKHVSFNLMFDRLQMVEQLGLIPAPAA* |
Ga0066683_102083183 | 3300005172 | Soil | PVAVPYVQVLRFRDGQHASFNLMYDRLLMLGQLGLIPAPA* |
Ga0070683_1012593001 | 3300005329 | Corn Rhizosphere | TGRSVAVEYVQVLRFRDGQHASFSLVFDRLQMLEQLGLVAAPTAA* |
Ga0070670_1006195681 | 3300005331 | Switchgrass Rhizosphere | VDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA* |
Ga0068868_1009183591 | 3300005338 | Miscanthus Rhizosphere | VRVDYIQVLRFREGKHCSFNLMFDRLLMLEQLGLIPAPAA* |
Ga0070668_1011443263 | 3300005347 | Switchgrass Rhizosphere | TGRSVRLDYIQVLHFRNGKHVSFNLMFDRLLMLEQLGLIPAPTA* |
Ga0070675_1008197041 | 3300005354 | Miscanthus Rhizosphere | RSVRLDYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAPAPAP* |
Ga0070709_111292743 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VEVDYIQVLRFRDGKHVSFNLMFDRLTMLEQLGLVPTSAAAA* |
Ga0070711_1001102231 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PPTGQPVAVPYVQVLRFRDGQHTSFNLMFDRLLMLEQLGLIPAAA* |
Ga0070705_1017399551 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GRSVKVDYIQVLRFRNGKHVSFNLMFDRLLMLEQLGLVPAPAA* |
Ga0070706_1002473681 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DYIHVLRYRDGMHVSFNLLFDRLLMLEQLGLIPAPAPAG* |
Ga0066699_100276685 | 3300005561 | Soil | YIQVITFRNGRCIAANLMFDRLQLLEQLGLVPAPATSG* |
Ga0070763_101930492 | 3300005610 | Soil | IAPTGRPVTVDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPVSTG* |
Ga0068852_1009275372 | 3300005616 | Corn Rhizosphere | PATGRRTAVDYIHVLRYRDGLHVSFNLVFDRLQMLEQLGLIPGPAPAR* |
Ga0066903_1016669443 | 3300005764 | Tropical Forest Soil | GDIPPTGRPVTVGYIQVLRFRDGKHVSFNLMFDRLLMLEQLGIPALAAAG* |
Ga0066903_1047271111 | 3300005764 | Tropical Forest Soil | RVGYVQVLRFRDGKHTSFNLMFDRLLMLEQLDLMPAATHAG* |
Ga0068863_1026619331 | 3300005841 | Switchgrass Rhizosphere | HNGPLPTPAGDIPPTGCPVTVGYIQVLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG |
Ga0068862_1019448381 | 3300005844 | Switchgrass Rhizosphere | PTGRAVRLDYLQVLRFRDGTHVAFNLSFDRLAMLEQLGP* |
Ga0070717_100986961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IPPTGRSVSLDYIQVLRFCDGKHASFNLMFDRLLMLEQLDLMPAATSAG* |
Ga0070717_108716853 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IQVLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG* |
Ga0075029_1010723892 | 3300006052 | Watersheds | VDYIHVLRYRDGKHISFNLIFDRLLMLQQLGIIPAPAPTG* |
Ga0075015_1003847012 | 3300006102 | Watersheds | VNIDYIQVHRLRDGNQVSFHLVFDRFEMLEQLGLIPAPAGGGLLD* |
Ga0070716_1005724003 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG* |
Ga0074056_107980671 | 3300006574 | Soil | PMGDFQPTGGSVKLPYIQVLRFREGKHVSFNLMFDRLQMVEQLGLIPAPAA* |
Ga0074053_118079832 | 3300006575 | Soil | MGDFQPTGGSVKLPYIQVLRFREGKHVSFNLMFDRLQMVEQLGLIPAPAA* |
Ga0074057_116832111 | 3300006605 | Soil | QVLRFRDGKHASFNLMFDRLQMLEQLGLVTPPAPAR* |
Ga0075424_1010907582 | 3300006904 | Populus Rhizosphere | KVKVDYIQVLRYRDGLCVSANLMFDRMELLEQLGLVPAPAAAG* |
Ga0074063_130749221 | 3300006953 | Soil | GDIPPTGRAVSLDYIQVLRFRDGKHVSFKLMFDQLLMLEQLGLIPAAVPAG* |
Ga0079219_113961352 | 3300006954 | Agricultural Soil | ATGRRTAVDYIHVLRYRDGLHVSFSLLFDRLQMLEQLGLIPAPAPAR* |
Ga0079219_124626451 | 3300006954 | Agricultural Soil | SVTLDYIQVIRFRDGKHSSFHLAFDRLLMLEQLGLMPAHALAA* |
Ga0105245_111852792 | 3300009098 | Miscanthus Rhizosphere | VKAQYVNVLRFGDGRFVSGDLMFDRLALLEQLGLVPQPAVG* |
Ga0099792_103827042 | 3300009143 | Vadose Zone Soil | PVAVPYVQVLRFRDGRHVSFNLVYDRLLMLEQLGLIPAAV* |
Ga0114129_133268711 | 3300009147 | Populus Rhizosphere | GRSVCLDYVRLVRVHDGKQVSLDLMFDRLLMLEQLGLVQP* |
Ga0075423_114662131 | 3300009162 | Populus Rhizosphere | RPVEVDYIQVLQFRDGKHRSFHLMFDRLLMLEQLGLVPAPDGSGRSG* |
Ga0105241_108708181 | 3300009174 | Corn Rhizosphere | VTVDYIQVLRFRDGKHASFSLMFDRLLMLEQLGLIPAPAAAG* |
Ga0116214_10723642 | 3300009520 | Peatlands Soil | VLRYRDGLHVSFNLVFDRLLMLEQLGLVPAPAALQ* |
Ga0116222_12747921 | 3300009521 | Peatlands Soil | VLRFRDGKHISFNLIFDRLAMLEQLGLIPAPAPAG* |
Ga0116222_15125301 | 3300009521 | Peatlands Soil | VLRYRDGLHLSFNLVFDQLLMLEQLDLVPAPAAVQ* |
Ga0116225_13171861 | 3300009524 | Peatlands Soil | VPPTRPFVKVDYIQVLRFRDGKHLSFNLMFDRLMMLEQLGLVPAPAEAA* |
Ga0105238_103153692 | 3300009551 | Corn Rhizosphere | QVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG* |
Ga0116224_105436752 | 3300009683 | Peatlands Soil | DYIQVLRFRDGKYVSFNLMYDRLLLLEQLGLVRAQQPAG* |
Ga0116216_103049782 | 3300009698 | Peatlands Soil | GRAVSLPYIHVLRFRGGLHASFNLIFDRLLMLEQLGVIPAPAVAQ* |
Ga0126374_100610353 | 3300009792 | Tropical Forest Soil | MGDIAPTGRSIQVDYIQVLRFRGGKHVSFHLMFDQLMMLEQLGLVPTPAAAA* |
Ga0126374_104390011 | 3300009792 | Tropical Forest Soil | VDYIHVLRYRDGKHVLFNLLFDRLLMLEQLGLVPAPAPAG* |
Ga0126384_110908941 | 3300010046 | Tropical Forest Soil | RIVYLQVLRFRDGKHISFSLMFDRLQLLEQLGLGPAPALAGS* |
Ga0126384_123477952 | 3300010046 | Tropical Forest Soil | LRFRDGRHVSFNLMFDRLMMLEQLGLVLTTAAAA* |
Ga0123356_104636052 | 3300010049 | Termite Gut | MTYVQVLRFRDGKHVSFNLMFDRLAMLEQLGLAPTPAVAGEATS* |
Ga0134062_103163941 | 3300010337 | Grasslands Soil | VQVLRFRDGKHASFNLMFDRLLMLEQLGLIPAPA* |
Ga0074046_102626993 | 3300010339 | Bog Forest Soil | HVLRYRDGKHVSLDLMFDRLMMLEQLGLVPTPALAG* |
Ga0126370_104465413 | 3300010358 | Tropical Forest Soil | MGDIAPTGRSIQVDYIQVLRFRGGKHVSFHLMFDQLMMLEQLGLVPKPAAAA* |
Ga0126376_128244193 | 3300010359 | Tropical Forest Soil | ITPTGRHIAVNYTHVLRYRDGKHTSFNLIFDRLQMLEQLGLVSEPARAT* |
Ga0126378_116850342 | 3300010361 | Tropical Forest Soil | GRPVTIYYLQVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPAPAG* |
Ga0126379_101973751 | 3300010366 | Tropical Forest Soil | TGRSVEVDYIQVLRFRDGKHVSFNLLFDRLMMLEQLGLAPTPAAAA* |
Ga0126379_123717402 | 3300010366 | Tropical Forest Soil | YIQVLRFRDGKHISFNLMFDRLLMLEQLGILPAAAPAG* |
Ga0134125_103051362 | 3300010371 | Terrestrial Soil | HVLRYRDGLHVSFNLLFDRLQMLEQLGLIPAPAPAR* |
Ga0134125_112712052 | 3300010371 | Terrestrial Soil | VNYIQVLRFRDGKHVSFNLMFDRLTMLEQLGLVPTSAAAA* |
Ga0134128_125663182 | 3300010373 | Terrestrial Soil | VELDYIQVLHFREGKHQSFNLMFDRLLMLEQLGLLPVSG* |
Ga0134128_131407802 | 3300010373 | Terrestrial Soil | DYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAPAPAP* |
Ga0105239_114233581 | 3300010375 | Corn Rhizosphere | PPTGRSVEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA* |
Ga0126381_1019722521 | 3300010376 | Tropical Forest Soil | YIQVLRFRGGKHVSFHLMFDQLMMLEQLGLVPAPAAAA* |
Ga0136449_1012192133 | 3300010379 | Peatlands Soil | LRYRDGKHISFNLIFDRLLMLEQLGIIPAPAPTG* |
Ga0136449_1043098981 | 3300010379 | Peatlands Soil | TVDYVQVLRFRDGKYVSFNLMYDRLLLLEQLGLIRAQQPAG* |
Ga0134126_126258522 | 3300010396 | Terrestrial Soil | PPTGRAVRVDYIQVLRFRDGTHVSFNLSFDRLAMLEQLGS* |
Ga0134124_116927791 | 3300010397 | Terrestrial Soil | VQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAPAPAP* |
Ga0134127_128085301 | 3300010399 | Terrestrial Soil | PTGRAVAVDYVQVLRFRDGRHVAFNLSFDRLLMLEQLGLGG* |
Ga0134122_126583231 | 3300010400 | Terrestrial Soil | IPPTGRAVDLDYIQVLRFRDGRHVSSNLMFDRMLMLEQLGLVPAPNT* |
Ga0134121_122645642 | 3300010401 | Terrestrial Soil | PVTVGYIQVLHFRDGQHVSFSLMYDRLLMLEQLGLFPAPATTG* |
Ga0134123_102343662 | 3300010403 | Terrestrial Soil | RLDYIQVLHFRNGKHVSFNLMFDRLLMLEQLGLIPAPTA* |
Ga0134123_112952432 | 3300010403 | Terrestrial Soil | PTGQPVAVPYVQVLRFRDGQHTSFNLMFDRLLMLEQLGLIPAPA* |
Ga0137365_106729511 | 3300012201 | Vadose Zone Soil | VIIQVLRFRDGLHASFNLMFDRLLMLEQLGLVPAAA* |
Ga0150985_1127937501 | 3300012212 | Avena Fatua Rhizosphere | PPTGRSVKAPYMQVLRFRGDKCVSADLMYDRLELLEQLGLVPQAAAS* |
Ga0157285_101504651 | 3300012897 | Soil | IQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPAAAG* |
Ga0157296_103049752 | 3300012905 | Soil | PVSLDYIQVLRFRDGQHVSFNLMFDRLLMLEQLGLIPAPAG* |
Ga0157283_104252401 | 3300012907 | Soil | SVDYIQVLRFRDGKHVSFNLMFDRLLMLEQLGLILAPAQAAGRG* |
Ga0157310_105130212 | 3300012916 | Soil | PTGRAVAVDYIQVLRFRHGRHVAFNLSFDRLLMLEQLGLAG* |
Ga0164298_105959171 | 3300012955 | Soil | PTGRPVSVGYIQVLSFRDGKHASFNLMFDRLLMLEQLQLMPVAAHGG* |
Ga0164303_107840493 | 3300012957 | Soil | QVLHFRNGKHVSFNLMFDRLLMLEQLGLIPAPTA* |
Ga0164301_118118652 | 3300012960 | Soil | VPYVQVLRFRDGQHTFFNLMFDRLLMLEQLGLIPAPA* |
Ga0157371_105626802 | 3300013102 | Corn Rhizosphere | VLRFRDGRHVSFNLMFDRLLMLEQLGLVPAPAADG* |
Ga0157369_122538972 | 3300013105 | Corn Rhizosphere | QVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA* |
Ga0157378_107205592 | 3300013297 | Miscanthus Rhizosphere | QVLRFRDGKHVSFHLMFDRLAMLEQLGFVPMSAAA* |
Ga0157372_116452222 | 3300013307 | Corn Rhizosphere | DYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG* |
Ga0157377_100035691 | 3300014745 | Miscanthus Rhizosphere | GRAVRLDYIQVLRFRDGKHASFHLMFDRLLMLEQLGLAG* |
Ga0157376_101483704 | 3300014969 | Miscanthus Rhizosphere | PTGRSVEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA* |
Ga0132258_107253811 | 3300015371 | Arabidopsis Rhizosphere | VDYIQVLRFRDGKHVSLNLMFDRLTMLEQLGLVPTSAAAA* |
Ga0132256_1027092172 | 3300015372 | Arabidopsis Rhizosphere | GRPVKVDYIQVLHFRDGKHVSFNLTFDRLLMLEQLGLVPAPAAAA* |
Ga0182033_110552101 | 3300016319 | Soil | RAVNLDYIHVLHFRGGEHVSFNLMFDRLLMLEQLALIPAPAPAA |
Ga0182033_121585651 | 3300016319 | Soil | GDIPPTGRPVTLDYLQVLRFRDGSHVLFNLMYDRLLLLEQLGLIPAPAATG |
Ga0182032_109702651 | 3300016357 | Soil | IPPTGRFVEVDYVHVLRYRDGKHVSFNLMFDRLMMLEQLGVVPAPALELG |
Ga0182034_112537671 | 3300016371 | Soil | QVLRFRDGKHVSFNLMFDRLLMLEQLGLIPTPGVAA |
Ga0182034_118332111 | 3300016371 | Soil | LRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG |
Ga0182037_115941491 | 3300016404 | Soil | TGRPVRIAYIQVLRFRDGKHVSFNLMFDRLSMLEQLGLIPAPLPTAR |
Ga0182039_106822221 | 3300016422 | Soil | VAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLFTAPVR |
Ga0182039_119092462 | 3300016422 | Soil | PTGDVPPTGRFVKVDYIQVLRFRDGKHLSFNLMFDRLTMLEQLALVPMPAEAA |
Ga0182038_117701491 | 3300016445 | Soil | VLHYRDGKHVSFSLSYDRLQMIEQLGLIPAPAPAS |
Ga0182038_120258331 | 3300016445 | Soil | RQVTVDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS |
Ga0187812_10192331 | 3300017821 | Freshwater Sediment | VDYIHVLRYRDGQHISFNLMFDRLLILEQLGLVPAPAATG |
Ga0187818_105686981 | 3300017823 | Freshwater Sediment | IHVLRYRDGLHVSFSLLFDRLLMLEQLGLVPAPAAAG |
Ga0187806_12035212 | 3300017928 | Freshwater Sediment | VAVDYVHVLRYRDGLHISFTLVFDRLLMLEQLGLIPAPASAS |
Ga0187801_103447901 | 3300017933 | Freshwater Sediment | YFQVLRFRDGKHISFNLMYDRLALLEQLGIIPAPAPTS |
Ga0187819_104071341 | 3300017943 | Freshwater Sediment | VDYTHVLRFRDGKHASFNLTFDRLMMLEQLGLVPTPALAG |
Ga0187778_105546661 | 3300017961 | Tropical Peatland | RSVSVPYIHLLRFREGFHVSFNLVFDRLQLLEQLGLVPTPAPTG |
Ga0187776_106523302 | 3300017966 | Tropical Peatland | PTGRPVRIAYIHVLRFRDGKHISFNLMFDRLSMLEQLGLIPASVPDG |
Ga0187783_113532942 | 3300017970 | Tropical Peatland | VAVDYIQVLRFRDGKHISFNLMYDRLLLLEQLGVIPAPPAG |
Ga0187777_107608731 | 3300017974 | Tropical Peatland | IHVLRYRDGLHAAFNLSFDRLVMLEQLGLIPAPAAEL |
Ga0187822_102666002 | 3300017994 | Freshwater Sediment | MQVLRFRDGKHTSFNLMFDRLEMLEQLGLSPVAAQAG |
Ga0187767_101491832 | 3300017999 | Tropical Peatland | GRSVTADYIQVLGFRDGQNVSFHLMYDRLHLLEQLGLIPAAAQAG |
Ga0187766_102292583 | 3300018058 | Tropical Peatland | PYIHVLRYRDGLHAAFNLSFDRLVMLEQLGLIPVPAAAQ |
Ga0187766_104733631 | 3300018058 | Tropical Peatland | VDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG |
Ga0187766_113560601 | 3300018058 | Tropical Peatland | PAGPIPPTGRAVAADYIQVLRFRDGLVVSFNLMFDLLRMLEQLDLVPAFAPAD |
Ga0187765_101194521 | 3300018060 | Tropical Peatland | IPPTGRRISLEYIQVLRFRHGRHVSFNLMFDRLEMLEQLGLIPAPAQAG |
Ga0187772_102365391 | 3300018085 | Tropical Peatland | PAGDIPPTGRTVAVDYIQVLRFRDGKHTSFNLMYDRLLLLEQLGLIPAPPPG |
Ga0066655_111506081 | 3300018431 | Grasslands Soil | SPMGDVPPTGRLVRIAYIQVLRFRIEKHVSFKLLFGRFAMLEQLGLIPTPAAG |
Ga0173482_101403961 | 3300019361 | Soil | IQVLRFREGKHVSFNLMFDRLQMVEQLGLIPAAAA |
Ga0206353_105047781 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGRRTAVDYIHVLRYRDGLHVSFNLVFDRLQMLEQLGLIPGPAPAR |
Ga0187768_10768541 | 3300020150 | Tropical Peatland | VSVPYIHVLRYRDGLHAAFNLSFDRLVMLEQLGLIPVPAAAQ |
Ga0213873_101994672 | 3300021358 | Rhizosphere | VPYVHVLRYRDGLHVSFNLMFDRLLMLEQLGLMPAPSRTE |
Ga0213881_100839261 | 3300021374 | Exposed Rock | AVGYVHVLRYRDGKHVSFNLLFDRLQMLEQLGLVPAPAPAPAS |
Ga0213874_101368631 | 3300021377 | Plant Roots | PTGRAVSLPYIHVLRYREGLHASFNLSFDRLQMLEQLGLMPAREPAVR |
Ga0213876_100562621 | 3300021384 | Plant Roots | PPTARAVSVPYIHVLRYRDGLHVSFNLAFDRLSMLEQLGLIPAPAPSR |
Ga0213876_103675861 | 3300021384 | Plant Roots | DVPPTGRTVSVPYIHTLRYRDGLHVSFNLSFDRLLMLEQLGLVPAPAVAR |
Ga0213876_105914331 | 3300021384 | Plant Roots | RVQLDYIQVIRFRDGKHSSFHLAFDRLLMLEQLGLMAAPAVGA |
Ga0213875_101836692 | 3300021388 | Plant Roots | LDYIQVIRYRDGKHASFNLMFDRLLMLEQLGLAPSPDGA |
Ga0213875_105954011 | 3300021388 | Plant Roots | GRAVSLPYIQVLRYRDGLHASFNLAFDRLAMLEQLGLIPAPAAAP |
Ga0210385_105375601 | 3300021402 | Soil | PTGHSVELDYVHVLRFRDGKHASFNLMFDRLMMLEQLGLVPMPAAAE |
Ga0210397_109950251 | 3300021403 | Soil | DVPPTGRSVEVDYTHVLRYRDGKHVSFNLMFDRLMMLEQLGLVPTPALAG |
Ga0210383_105235171 | 3300021407 | Soil | GRPVALDYIQVLRYRDGLHISFNLIFDRLAMLEQLGLIPAPAPTG |
Ga0210394_113651932 | 3300021420 | Soil | PGSRVAVPYVQVLRFRDGQHASFNLMFDRLLMLEQLGLIPAPA |
Ga0210394_115123961 | 3300021420 | Soil | TGRPVRIAYIQVLRFRDGKHVSFNLMFDRLSMLEQLGLVLAPQHTDG |
Ga0210384_101149261 | 3300021432 | Soil | MSSSARRFRDGKHVSFNLLSDRLLMLEQLGLIPAPAPAPAS |
Ga0210402_119507991 | 3300021478 | Soil | VLRYRDGLHASFNLMFDRLLMLEQLGLIPAPAPAS |
Ga0126371_115489971 | 3300021560 | Tropical Forest Soil | PTGRPVRIAYIQVLRFRHGKHASFDLMFDRLEMLEQLGLAILPSTTG |
Ga0247746_10846282 | 3300022886 | Soil | GRHVSLDYVQVLRIRDGRHISFNLMFDRLLMLEQLGLVPAPADA |
Ga0247802_10708061 | 3300023077 | Soil | VEIDYIQVLRFRDGKHTSFNLMFDRLLMLEQLGLVPAPAADG |
Ga0207645_103778162 | 3300025907 | Miscanthus Rhizosphere | DYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG |
Ga0207663_102086612 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PPTGQPVAVPYVQVLRFRDGQHTSFNLMFDRLLMLEQLGLIPAAA |
Ga0207660_113804311 | 3300025917 | Corn Rhizosphere | DIAATGRRTAVDYIHVLRYRDGLHVSFNLLFDRLQMLEQLGLIPAPAPAR |
Ga0207687_112248521 | 3300025927 | Miscanthus Rhizosphere | YIQVLRFRDGKHTSFNLMFDRLLMLEQLGLVPAPAADG |
Ga0207700_118399191 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLDYIQVLRFRDGKHVSFNLMFDQLLMLGQLGLIPAPAPAG |
Ga0207690_109431572 | 3300025932 | Corn Rhizosphere | RLDYLQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAAAGR |
Ga0207709_105559971 | 3300025935 | Miscanthus Rhizosphere | LDYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVAAAAPAA |
Ga0207709_112175671 | 3300025935 | Miscanthus Rhizosphere | VRLDYIQVLHFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAG |
Ga0207670_103517623 | 3300025936 | Switchgrass Rhizosphere | VEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPMSAAA |
Ga0207678_120068961 | 3300026067 | Corn Rhizosphere | GDLAPTGRAVRLDYIQVLRFRDGTHVSFNLSFDRLAMLEQLGP |
Ga0207708_117206282 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLDYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVAAAAPAA |
Ga0207683_110857352 | 3300026121 | Miscanthus Rhizosphere | RPVEIDYIQVLRFREGKHASFNLMFDRLLMLEQLGLVPAPAADG |
Ga0209804_13373302 | 3300026335 | Soil | IQVITFRNGRCIAANLMFDRLQLLEQLGLVPAPATSG |
Ga0209805_10273655 | 3300026542 | Soil | RRVQGDYIQVITFRNGRCIAANLMFDRLQLLEQLGLVPAPATSG |
Ga0208365_10607001 | 3300027070 | Forest Soil | PPTGQPVAVPYVQVLRFRDGQHASFNLMFDRLLMLEQLGLIPAPAPTG |
Ga0208241_10206493 | 3300027297 | Forest Soil | QVLRYRDGLHISFNLIFDRLAMLEQLGLIPVPAPTG |
Ga0208199_10684662 | 3300027497 | Peatlands Soil | TGRAVSLPYIHVLRFRGGLHASFNLIFDRLLMLEQLGVIPAPAVAQ |
Ga0208324_10067132 | 3300027604 | Peatlands Soil | VLRYRDGLHVSFNLVFDRLLMLEQLGLVPAPAALQ |
Ga0209275_100190693 | 3300027884 | Soil | SVEVDYTHVLRYRDGKHVSFNLMFDRLMMLEQLGLVPTPALAG |
Ga0209069_102152761 | 3300027915 | Watersheds | LHSPAGDIPPTGHSVQVNYIQVLRIREGRHVSFNLIFDRLLMFEQLGLVPAQTPAG |
Ga0247828_108812991 | 3300028587 | Soil | RISYVQVLRFRDGRHVSFNLMFDRLSMLEQLGVVQAPAPRA |
Ga0247818_103572532 | 3300028589 | Soil | GVLHGADGDIPPTGRFVQLDYIQVLRFRAGKHVSFHLMFDRLLMLEQLGLAPVPVSPR |
Ga0247822_110924861 | 3300028592 | Soil | AGDLPPTGRAVRLDYLQVLRFRDGTHVAFNLSFDRLAMLEQLGP |
Ga0307295_102123301 | 3300028708 | Soil | GRPVKVDYIQVLHFRDGKHSSFNLMFDRLLMLEQLGLIPAPALDG |
Ga0308309_105306211 | 3300028906 | Soil | HVLRYRDGKHVSFNLMFDRLMMLEQLGLVPTPALAG |
Ga0247826_102046352 | 3300030336 | Soil | IQVLRFRDGRHLEFNLMFDRLLMLEQLGLAPAPAGE |
Ga0247826_106015252 | 3300030336 | Soil | VRLDYLQVLRFRDGKHTSFHLSFDRLAMLEQLGLVPEPAPAITGGTAPAR |
Ga0308202_11007492 | 3300030902 | Soil | IAYIQVLRFRDGKHVSFNLGFDRLEMLEQLGLVPAPAATS |
Ga0308204_101752011 | 3300031092 | Soil | IAYIQVLRFRDGKHVSFNLSFDRLEMLEQLGLVPAPAATS |
Ga0307497_106393081 | 3300031226 | Soil | GRPVRLDYVQVLRFRDGRHVSFNLMFDRLLMLEQLGLVPAAAPAP |
Ga0318516_106137921 | 3300031543 | Soil | PPTGRPVTVGYIQVLHFRDGRHVSFNLMYDRLLLLEQLGLIPSPAPAS |
Ga0318516_106379411 | 3300031543 | Soil | YIHVLRYRDGLHASFNLMFDRLLMLEQLGLIPAPAPAG |
Ga0318534_103179411 | 3300031544 | Soil | PGPAGDIPPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV |
Ga0318534_105055282 | 3300031544 | Soil | LQVLRFRDGNHVMFNLMYDRLLLLEQLGLIPAPAATG |
Ga0318534_107765182 | 3300031544 | Soil | IHVLRYRDGLHVSFNLLFDRLLMLEQLGLVPAPAATG |
Ga0318541_104816172 | 3300031545 | Soil | DYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG |
Ga0318538_103475662 | 3300031546 | Soil | ANYIQVLRFRDGMIAALNLMFDQLELLEQLGLVPDPAQTG |
Ga0318538_103950611 | 3300031546 | Soil | GRPVTVPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLT |
Ga0318571_100939512 | 3300031549 | Soil | AVQGAVDYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLLPAPAPAG |
Ga0318571_102687951 | 3300031549 | Soil | TGRPVTVPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLA |
Ga0318571_103633121 | 3300031549 | Soil | DYVHVLHYRDGKHVSFSLSYDRLQMIEQLGLIPAPAPAS |
Ga0318573_103022802 | 3300031564 | Soil | VSLDYVHVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPAAGP |
Ga0318515_101661411 | 3300031572 | Soil | DYIHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG |
Ga0318515_102635031 | 3300031572 | Soil | VSLDYIHVLHFRDGEHVSFNLMFDRLLMLEQLGLIPAPAPAAQ |
Ga0318515_106264201 | 3300031572 | Soil | VQVLRFRAGKHASFNLMFDRLLMLEQLGLLPAPAPAP |
Ga0310915_102926782 | 3300031573 | Soil | IPPTGRPVTVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG |
Ga0318542_102460612 | 3300031668 | Soil | PPTGRPVAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG |
Ga0318561_105735842 | 3300031679 | Soil | VVHVLRYRDGKHVSFNLLFDRLSMLEQLGLLPAPAPAG |
Ga0318572_103028181 | 3300031681 | Soil | AVHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLMPAPAPTS |
Ga0318572_104060702 | 3300031681 | Soil | IEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG |
Ga0318560_104935322 | 3300031682 | Soil | PVSVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG |
Ga0318496_100703032 | 3300031713 | Soil | AGDIPPTGRPVTVPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLV |
Ga0310813_103685522 | 3300031716 | Soil | SVSVAYMQVLRFRDGKHASFHLMFDRLSMLEQLGLVPIAH |
Ga0306917_105285152 | 3300031719 | Soil | PVTLDYLQVLRFRDGNHVMFNLMYDRLLLLEQLGLIPAPAATG |
Ga0307469_119923981 | 3300031720 | Hardwood Forest Soil | VDYVQVLRFRGGKHVSFHLMFDRLVMLEQLGFVPAPTPAG |
Ga0318493_103746953 | 3300031723 | Soil | TGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV |
Ga0318500_104789081 | 3300031724 | Soil | GDIAATGRPVAVHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS |
Ga0318502_102502393 | 3300031747 | Soil | IHVLRYRDGQHVSFNLMFDRLLMLEQLGLLTAPVR |
Ga0318494_100642481 | 3300031751 | Soil | PGPSGEIPPTGRPVTVPYIQVLRFRDGQHASFNLMYDRLLMLEHLGLV |
Ga0318494_108893521 | 3300031751 | Soil | GRAVNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATAQ |
Ga0318526_101734002 | 3300031769 | Soil | VAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG |
Ga0318526_102053462 | 3300031769 | Soil | VNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATAQ |
Ga0318521_104411592 | 3300031770 | Soil | VDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS |
Ga0318521_107411942 | 3300031770 | Soil | PTGRAVSLDYIHVLRFRGGEHVSFNLMFDRLLMLEQLGLIPAPAPAV |
Ga0318521_110426951 | 3300031770 | Soil | LQVLRFRDGKHVSFNLMFDRLSMLEQLGLVPAPTAVD |
Ga0318546_101705444 | 3300031771 | Soil | DIPPTGRRVAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLLTAPVR |
Ga0318546_107513151 | 3300031771 | Soil | PGPAGDIPATGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV |
Ga0318498_105245992 | 3300031778 | Soil | PAGDIPPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV |
Ga0318566_101616281 | 3300031779 | Soil | SVAIDYIQVLRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG |
Ga0318529_101465181 | 3300031792 | Soil | IHVLRYRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG |
Ga0318550_106382162 | 3300031797 | Soil | TVDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS |
Ga0318523_106785231 | 3300031798 | Soil | TGRPVAVDYVHVLHYRDGKHVSFNLSYDRLQMIEQLGVIPAPAPAS |
Ga0318523_106803131 | 3300031798 | Soil | YIQVLRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG |
Ga0318565_103771542 | 3300031799 | Soil | PPTDRAVSLDYIHLLRLRDGEHVSFNLMFARLLMLEQLGLIRVPAPAAQ |
Ga0318497_101332601 | 3300031805 | Soil | VDYIHVLRYRDGQHVSFNLMFDRLLMLEQLGLLTAPVR |
Ga0318497_105856391 | 3300031805 | Soil | VDYVQVLRFRDGKHVSFNLMFDRLSMLEQLGLVPAPTGVD |
Ga0318568_101256473 | 3300031819 | Soil | AVNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATA |
Ga0307473_102953361 | 3300031820 | Hardwood Forest Soil | ATGRPVTVDYIQVLRFRDGKHASFSLIYDRLLMLEQLGLIPAPAG |
Ga0318567_100408411 | 3300031821 | Soil | PTGRAVNVEYVHVLRFRDGLHISFNLMFDRLLMLEQLGLVPAPATAQ |
Ga0318567_105825332 | 3300031821 | Soil | VDYIQVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPPAE |
Ga0318564_104644261 | 3300031831 | Soil | PTGRSVEVDYIQVLRFRDGKHVSFHLMFDRLAMLEQLGLVPTSATA |
Ga0318499_102324943 | 3300031832 | Soil | AATGRAVAVDYIHVLRYRDGLHVSFNLIFDRLAMLEQLGLIPAPAPAG |
Ga0318499_103385252 | 3300031832 | Soil | VSVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG |
Ga0318499_103913291 | 3300031832 | Soil | IQALRFRDGRHASFNLMYDRLLLLEQLGLVPAPAG |
Ga0310917_106039471 | 3300031833 | Soil | AVDYIHVLRYRDGKHVSFNLLFDRLSMLEQLGLLPAPAPAG |
Ga0318512_100811861 | 3300031846 | Soil | IAATGRPIAVHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS |
Ga0318512_101828832 | 3300031846 | Soil | GRRVTLDYIAVNRYRDGKVASVNLMYDQLLLLEQLGLIPAPQPAG |
Ga0318495_103526071 | 3300031860 | Soil | VDYIQVLRFRDGKHISFNLMFDRLLMLEQLGLLPAEAPAG |
Ga0306919_107294291 | 3300031879 | Soil | VLRFHDGKHVSFNLLFDRLSMLEQLGLAPAPAEAG |
Ga0306919_113937842 | 3300031879 | Soil | DIAPTGRQVAVDYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLLPAPAPAG |
Ga0306925_114445711 | 3300031890 | Soil | TGRPVAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG |
Ga0306925_115487162 | 3300031890 | Soil | TGRAVSLDYIHVLHFRDGEHVSFNLMFDRLLMLEQLGLIPAPAPAA |
Ga0318536_103017882 | 3300031893 | Soil | VHYIHVLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS |
Ga0318522_100310213 | 3300031894 | Soil | HYIHMLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS |
Ga0318551_104066181 | 3300031896 | Soil | PVAVDYIQVLRFRGGKHISFNLMFDRLLMLEQLGLLPAAAAAG |
Ga0318551_106098851 | 3300031896 | Soil | GRQVTVDYIQVLRFRDGKHISFNLMYDRLLMLEQLGLLPAPAAAS |
Ga0306923_107776581 | 3300031910 | Soil | VDYIQVLRFRDGKHLSFNLMFDRLTMLEQLALVPMPAEAA |
Ga0306923_110341271 | 3300031910 | Soil | IQVLRFRGGKHVSFNLMFDRLLMLEQLGLLPAAAAAG |
Ga0306923_122844381 | 3300031910 | Soil | PTGRPVRIAYIQVLRFRDGKHVSFNLMFDRLSMLEQLGLIPAPLPTAR |
Ga0306921_101599082 | 3300031912 | Soil | MTITPTLIVSDVPPTGRSVSVGYIQVLRFQNGKHALFNLMFDRLQLQEQLGLIPGAPPVR |
Ga0310912_107520861 | 3300031941 | Soil | EVDYIQVLRFRDGKHVSFNLMYDRLLMLEQLGLIPTPGVAA |
Ga0310916_105293471 | 3300031942 | Soil | DIPPTGRRVAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLFTAPVR |
Ga0307479_109900421 | 3300031962 | Hardwood Forest Soil | GRPVRIAYVQVLRFRDGKHVSFNLMFDRLSMFEQLGLVPAPLSTAGETPVT |
Ga0307479_114423632 | 3300031962 | Hardwood Forest Soil | QVLRFRSGKHVSFNLVFDRLSMLEQLGLVPAPQHTDG |
Ga0306922_113939902 | 3300032001 | Soil | HVLRYRDGKHVSFNLLFDRLQMLEQLGLMPAPAPTS |
Ga0318562_105313202 | 3300032008 | Soil | GEIPPTGRPVTVPYIQVLRFRDGQHASFNLMYDRLLMLEHLGLV |
Ga0318563_104367871 | 3300032009 | Soil | DYIHVLRYRDGLHVSFYLMFDRLLMLEQLGLIPAPAPAG |
Ga0318563_105353141 | 3300032009 | Soil | SVDYIHVLRFRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAQ |
Ga0310911_102444591 | 3300032035 | Soil | PTGRHVTANYIQVVRFRDGMIAALNLMFDQLELLEQLGLVPDPAQTG |
Ga0318549_102992422 | 3300032041 | Soil | TGRSVAVDYIQVLRFRDGKHVSFNLVFDRLQMLEQLELLPAPAPARG |
Ga0318558_103074422 | 3300032044 | Soil | GRPVTVDYIEVLGFRDGKHVSFNLMYDRLLLLEQLGLIPAPLAG |
Ga0318558_104131122 | 3300032044 | Soil | DVVHRDGLHVSFNLMFDRLLMLEQLGLIPAPAPAG |
Ga0318513_100977953 | 3300032065 | Soil | PVAVHYIHMLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS |
Ga0318513_101360861 | 3300032065 | Soil | GDVPPTDRAVSLDYIHLLRLRDGEHVSFNLMFARLLMLEQLGLIRVPAPAAQ |
Ga0318514_102457971 | 3300032066 | Soil | VSIDYVNVLRFKDGKHVSFSLTFDRLAMLEQLGLIPPPAPGGR |
Ga0318553_100110514 | 3300032068 | Soil | PTGRRVAVDYVHVLRYRDGQHISFNLMFDRLLMLEQLGLLTAPVR |
Ga0318553_106493991 | 3300032068 | Soil | GALPGPAGDIAPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV |
Ga0306924_115131642 | 3300032076 | Soil | TGCSVSVDYIQVLRFRDGKHVSFNLMFDRLLMLEQLGLIPAPPAE |
Ga0306924_125158092 | 3300032076 | Soil | AGDIAPTGRQVAVDYIHVLRYRDGKHVSFNLLFDRLSMLEQLGLLPAPAPAG |
Ga0318518_105486452 | 3300032090 | Soil | GDIAATGRAVAVDYIHVLRYRDGLHVSFNLIFDRLAMLEQLGLIPAPAPAG |
Ga0318518_106710742 | 3300032090 | Soil | VHYIHMLRYRDGKHVSFNLLFDRLQMLEQLGLIPAPAPTS |
Ga0311301_116484211 | 3300032160 | Peatlands Soil | TGRAVSLPYIHVLRFRGGLHASFNLIFDRLLMLEQLGVIPAPRLARGSR |
Ga0306920_1030792332 | 3300032261 | Soil | GPAVDIPPTGRPVTVPYIQVLRFRDGLHASFSLMYDRLLMLEHLGLV |
Ga0306920_1034372773 | 3300032261 | Soil | RPVAVDYIHVLRYRDGLHVSFNLMFDRLLMLEQLGHIPAPAPAG |
Ga0306920_1044088141 | 3300032261 | Soil | GYIQVLRFREGKHVSFHLMFDRLAMLEQLGLVPAPAA |
Ga0335085_103313491 | 3300032770 | Soil | VDYIHVPCFRDGRHISVNLITDRLLMLEQFGLIPAPAPAV |
Ga0335079_111819692 | 3300032783 | Soil | VPRFRDGKHISFNLIFDRLLMLYPLGLYPLGLIRAQAPAD |
Ga0335081_125200622 | 3300032892 | Soil | VPYIQVLRFRDGRHASFNLMYDRLLMLEHLGLVPA |
Ga0335072_100979572 | 3300032898 | Soil | VDYIHVLRYREGKHVSFNLLFDRLLMLEQLGILPTTVPAR |
Ga0335072_103885433 | 3300032898 | Soil | DYIQVLRYRDGKHVSFNLMYDQLLLLEQLGLIPAQQPAG |
Ga0335077_109980412 | 3300033158 | Soil | YIPPTGRPVTVDYIQVLRFRDGRHVCFNLMYDRLLMLEQLGLIPAPAAS |
Ga0318519_106793871 | 3300033290 | Soil | NVTLEYIQVLHFRDGMTVSFNLMFDRLELLEQLGLVADPAQMG |
Ga0247829_109401611 | 3300033550 | Soil | PPTGRSVSVPYLQVLRFRDGKHILFNLMFDRLLMLEQLGLVPAPVPMG |
Ga0314862_0018851_1161_1283 | 3300033803 | Peatland | VDYVNVLRFKDGKHVSFSLTFDRLAMLEQLGLVPAPPPAG |
Ga0314867_072564_650_799 | 3300033808 | Peatland | RSVSVPYIHVLRFREGFHVSFNLIFDRLLLLEQLGLVPTPTPHRVIRTA |
⦗Top⦘ |