Basic Information | |
---|---|
Family ID | F013113 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 274 |
Average Sequence Length | 43 residues |
Representative Sequence | VTLRERLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTIV |
Number of Associated Samples | 214 |
Number of Associated Scaffolds | 274 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 54.95 % |
% of genes near scaffold ends (potentially truncated) | 98.91 % |
% of genes from short scaffolds (< 2000 bps) | 94.53 % |
Associated GOLD sequencing projects | 204 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.891 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.518 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.182 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.474 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 274 Family Scaffolds |
---|---|---|
PF00892 | EamA | 75.91 |
PF00106 | adh_short | 4.01 |
PF01636 | APH | 2.55 |
PF13561 | adh_short_C2 | 1.82 |
PF13411 | MerR_1 | 1.46 |
PF12681 | Glyoxalase_2 | 1.09 |
PF07690 | MFS_1 | 1.09 |
PF00903 | Glyoxalase | 0.73 |
PF01619 | Pro_dh | 0.73 |
PF13470 | PIN_3 | 0.36 |
PF00196 | GerE | 0.36 |
PF00795 | CN_hydrolase | 0.36 |
PF09084 | NMT1 | 0.36 |
PF04932 | Wzy_C | 0.36 |
PF04794 | YdjC | 0.36 |
PF13649 | Methyltransf_25 | 0.36 |
PF01391 | Collagen | 0.36 |
PF01476 | LysM | 0.36 |
PF02733 | Dak1 | 0.36 |
COG ID | Name | Functional Category | % Frequency in 274 Family Scaffolds |
---|---|---|---|
COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.73 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.36 |
COG2376 | Dihydroxyacetone kinase | Carbohydrate transport and metabolism [G] | 0.36 |
COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.36 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.89 % |
Unclassified | root | N/A | 5.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090008|P3_DRAFT_NODE_235005_len_1825_cov_16_248768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1875 | Open in IMG/M |
2228664021|ICCgaii200_c0911704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104798867 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300000891|JGI10214J12806_10380986 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300000956|JGI10216J12902_102279339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300000956|JGI10216J12902_104503383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300000956|JGI10216J12902_104853274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
3300002028|A17_1003940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3831 | Open in IMG/M |
3300002028|A17_1266350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300003152|Ga0052254_1127358 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300003321|soilH1_10062008 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
3300004019|Ga0055439_10070500 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300004081|Ga0063454_100081018 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300004114|Ga0062593_100537075 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300004114|Ga0062593_102082056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
3300004479|Ga0062595_100178698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
3300004480|Ga0062592_101612141 | Not Available | 627 | Open in IMG/M |
3300004480|Ga0062592_101887378 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300004480|Ga0062592_101986671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
3300004480|Ga0062592_102486396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300004643|Ga0062591_101209004 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005093|Ga0062594_100321867 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300005093|Ga0062594_102237553 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300005166|Ga0066674_10281206 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005172|Ga0066683_10158868 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300005172|Ga0066683_10821405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 539 | Open in IMG/M |
3300005178|Ga0066688_10192935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
3300005179|Ga0066684_10228727 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300005181|Ga0066678_10128059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1567 | Open in IMG/M |
3300005184|Ga0066671_10178227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
3300005187|Ga0066675_10731294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
3300005187|Ga0066675_11256488 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005332|Ga0066388_100763577 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300005343|Ga0070687_100509881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 811 | Open in IMG/M |
3300005355|Ga0070671_100483443 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300005355|Ga0070671_101787202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300005363|Ga0008090_14194016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300005365|Ga0070688_101348439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
3300005434|Ga0070709_11539278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
3300005435|Ga0070714_102495772 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005438|Ga0070701_11320749 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005438|Ga0070701_11361068 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005439|Ga0070711_100266082 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300005439|Ga0070711_101072091 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300005439|Ga0070711_101126478 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300005445|Ga0070708_100920514 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300005446|Ga0066686_10556805 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005447|Ga0066689_10843567 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005447|Ga0066689_11031943 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005451|Ga0066681_10078294 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
3300005451|Ga0066681_10488966 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300005454|Ga0066687_10673620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
3300005454|Ga0066687_10790986 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300005518|Ga0070699_100140409 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
3300005518|Ga0070699_100798957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
3300005518|Ga0070699_102125618 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005529|Ga0070741_10484891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
3300005529|Ga0070741_10853980 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300005530|Ga0070679_101545857 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005544|Ga0070686_101317699 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005546|Ga0070696_101678389 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005549|Ga0070704_101655804 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005552|Ga0066701_10106690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1643 | Open in IMG/M |
3300005552|Ga0066701_10169765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1324 | Open in IMG/M |
3300005554|Ga0066661_10624955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300005554|Ga0066661_10880093 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005559|Ga0066700_11065184 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005561|Ga0066699_10304391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1135 | Open in IMG/M |
3300005563|Ga0068855_101761933 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300005566|Ga0066693_10426341 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005569|Ga0066705_10537455 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300005577|Ga0068857_100043074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4004 | Open in IMG/M |
3300005587|Ga0066654_10247999 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300005587|Ga0066654_10374671 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300005614|Ga0068856_100050960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4081 | Open in IMG/M |
3300005614|Ga0068856_101288676 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300005614|Ga0068856_102431827 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300005617|Ga0068859_102002792 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005764|Ga0066903_100289406 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
3300005764|Ga0066903_101798441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1170 | Open in IMG/M |
3300005764|Ga0066903_106203114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 625 | Open in IMG/M |
3300005764|Ga0066903_108654096 | Not Available | 518 | Open in IMG/M |
3300005834|Ga0068851_10563132 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300006046|Ga0066652_100795363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
3300006046|Ga0066652_102076639 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300006049|Ga0075417_10394042 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300006173|Ga0070716_100933046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
3300006175|Ga0070712_101611809 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300006573|Ga0074055_10000958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1003 | Open in IMG/M |
3300006606|Ga0074062_11679919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
3300006796|Ga0066665_10125804 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
3300006797|Ga0066659_11317380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300006800|Ga0066660_11472676 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300006845|Ga0075421_102030307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300006852|Ga0075433_11546991 | Not Available | 572 | Open in IMG/M |
3300006853|Ga0075420_100959648 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300006854|Ga0075425_102901685 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300006871|Ga0075434_101227421 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300006904|Ga0075424_102544928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300006931|Ga0097620_102231507 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300007265|Ga0099794_10535708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
3300009012|Ga0066710_100638909 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
3300009012|Ga0066710_101517714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Smaragdicoccus → Smaragdicoccus niigatensis | 1033 | Open in IMG/M |
3300009100|Ga0075418_11929517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300009101|Ga0105247_11186078 | Not Available | 607 | Open in IMG/M |
3300009137|Ga0066709_103037793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300009156|Ga0111538_10044986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5674 | Open in IMG/M |
3300009174|Ga0105241_12099383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300009176|Ga0105242_11952412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300009553|Ga0105249_12070502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300009553|Ga0105249_12172652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300009840|Ga0126313_11477052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300010038|Ga0126315_10124196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1507 | Open in IMG/M |
3300010038|Ga0126315_10239021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
3300010040|Ga0126308_10177408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1359 | Open in IMG/M |
3300010042|Ga0126314_10722761 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300010042|Ga0126314_11269189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300010043|Ga0126380_11605040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
3300010044|Ga0126310_10413094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 964 | Open in IMG/M |
3300010047|Ga0126382_11782760 | Not Available | 578 | Open in IMG/M |
3300010166|Ga0126306_10324641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1190 | Open in IMG/M |
3300010166|Ga0126306_11501721 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010325|Ga0134064_10294111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
3300010326|Ga0134065_10493555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
3300010329|Ga0134111_10576130 | Not Available | 502 | Open in IMG/M |
3300010333|Ga0134080_10364112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
3300010333|Ga0134080_10646639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300010335|Ga0134063_10677891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300010337|Ga0134062_10203481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
3300010371|Ga0134125_10161436 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
3300010371|Ga0134125_13018164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300010375|Ga0105239_11432623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
3300010400|Ga0134122_11228793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300011107|Ga0151490_1597846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300011997|Ga0120162_1042256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1164 | Open in IMG/M |
3300012096|Ga0137389_11721430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
3300012189|Ga0137388_11772798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300012198|Ga0137364_11134663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300012201|Ga0137365_10175316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1607 | Open in IMG/M |
3300012201|Ga0137365_11037596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300012208|Ga0137376_11475666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
3300012209|Ga0137379_10755444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
3300012285|Ga0137370_10333147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
3300012354|Ga0137366_10313434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
3300012354|Ga0137366_10607125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
3300012354|Ga0137366_10617035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
3300012356|Ga0137371_10656027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
3300012360|Ga0137375_10343041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
3300012360|Ga0137375_10859021 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300012482|Ga0157318_1034997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300012497|Ga0157319_1030367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
3300012532|Ga0137373_10134332 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
3300012893|Ga0157284_10297805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300012906|Ga0157295_10296234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300012912|Ga0157306_10272481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
3300012929|Ga0137404_10422084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1179 | Open in IMG/M |
3300012951|Ga0164300_10960211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
3300012955|Ga0164298_10168462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1250 | Open in IMG/M |
3300012958|Ga0164299_10139825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1324 | Open in IMG/M |
3300012958|Ga0164299_10186273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1186 | Open in IMG/M |
3300012960|Ga0164301_10763100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
3300012984|Ga0164309_11183775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300012985|Ga0164308_10555672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
3300012987|Ga0164307_10218466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
3300012989|Ga0164305_10173138 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300013105|Ga0157369_11169721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
3300013105|Ga0157369_11599039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
3300013307|Ga0157372_11244267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 860 | Open in IMG/M |
3300013307|Ga0157372_12598437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300013308|Ga0157375_13628916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300013764|Ga0120111_1079095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300013772|Ga0120158_10147123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1311 | Open in IMG/M |
3300013772|Ga0120158_10159810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1233 | Open in IMG/M |
3300013772|Ga0120158_10409539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300014058|Ga0120149_1076842 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300014969|Ga0157376_12021428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
3300014969|Ga0157376_12420440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300015203|Ga0167650_1116098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300015264|Ga0137403_10716873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 860 | Open in IMG/M |
3300015374|Ga0132255_100815757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1391 | Open in IMG/M |
3300017695|Ga0180121_10067545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1269 | Open in IMG/M |
3300018061|Ga0184619_10190215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
3300018061|Ga0184619_10461339 | Not Available | 565 | Open in IMG/M |
3300018067|Ga0184611_1303109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
3300018089|Ga0187774_10061487 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
3300018466|Ga0190268_10627355 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300018466|Ga0190268_12222287 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300018468|Ga0066662_10652747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
3300018468|Ga0066662_12841019 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300018482|Ga0066669_11125203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
3300019875|Ga0193701_1021548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1317 | Open in IMG/M |
3300019875|Ga0193701_1100115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
3300020003|Ga0193739_1050580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
3300021362|Ga0213882_10163390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 915 | Open in IMG/M |
3300021972|Ga0193737_1036749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
3300023069|Ga0247751_1080808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300024283|Ga0247670_1034575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
3300024323|Ga0247666_1006172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2668 | Open in IMG/M |
3300024325|Ga0247678_1038190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300025898|Ga0207692_10019228 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
3300025909|Ga0207705_11041266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
3300025913|Ga0207695_10986498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
3300025915|Ga0207693_10142321 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
3300025919|Ga0207657_11500822 | Not Available | 504 | Open in IMG/M |
3300025922|Ga0207646_10920665 | Not Available | 775 | Open in IMG/M |
3300025939|Ga0207665_10133570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1764 | Open in IMG/M |
3300025944|Ga0207661_11047244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
3300025960|Ga0207651_10735639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
3300025961|Ga0207712_10202090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1576 | Open in IMG/M |
3300025961|Ga0207712_11669187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300026035|Ga0207703_12171497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300026041|Ga0207639_10804975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
3300026075|Ga0207708_11038846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
3300026078|Ga0207702_12199724 | Not Available | 540 | Open in IMG/M |
3300026277|Ga0209350_1123692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300026295|Ga0209234_1294977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
3300026323|Ga0209472_1153484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
3300026330|Ga0209473_1261776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300026523|Ga0209808_1190131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300026529|Ga0209806_1252000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300026538|Ga0209056_10154008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1755 | Open in IMG/M |
3300026550|Ga0209474_10212737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
3300027561|Ga0209887_1046400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
3300027873|Ga0209814_10249921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
3300028573|Ga0265334_10341422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
3300028704|Ga0307321_1072392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
3300028707|Ga0307291_1061095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
3300028709|Ga0307279_10089856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300028711|Ga0307293_10233110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300028717|Ga0307298_10156435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300028721|Ga0307315_10100595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
3300028722|Ga0307319_10146783 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300028744|Ga0307318_10240994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
3300028778|Ga0307288_10285911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
3300028778|Ga0307288_10391314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300028784|Ga0307282_10200676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
3300028784|Ga0307282_10202231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
3300028784|Ga0307282_10210064 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300028784|Ga0307282_10266068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300028787|Ga0307323_10070554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
3300028796|Ga0307287_10279501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300028799|Ga0307284_10062694 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300028799|Ga0307284_10180047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300028811|Ga0307292_10024367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2152 | Open in IMG/M |
3300028814|Ga0307302_10046690 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
3300028814|Ga0307302_10145560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
3300028819|Ga0307296_10119328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1417 | Open in IMG/M |
3300028824|Ga0307310_10001708 | All Organisms → cellular organisms → Bacteria | 8198 | Open in IMG/M |
3300028878|Ga0307278_10124668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
3300028878|Ga0307278_10172185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
3300028880|Ga0307300_10122832 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300028881|Ga0307277_10374477 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300028884|Ga0307308_10478222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
3300031232|Ga0302323_100747023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1072 | Open in IMG/M |
3300031640|Ga0318555_10587108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
3300031671|Ga0307372_10539781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300031716|Ga0310813_10885402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
3300031716|Ga0310813_11340870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300031740|Ga0307468_102488488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300031792|Ga0318529_10452028 | Not Available | 598 | Open in IMG/M |
3300031798|Ga0318523_10230868 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300031819|Ga0318568_11053409 | Not Available | 502 | Open in IMG/M |
3300031835|Ga0318517_10383774 | Not Available | 635 | Open in IMG/M |
3300031852|Ga0307410_10829602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
3300031852|Ga0307410_11295424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300031954|Ga0306926_12431930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300032002|Ga0307416_100238892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1759 | Open in IMG/M |
3300032044|Ga0318558_10188704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1003 | Open in IMG/M |
3300032067|Ga0318524_10162800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
3300032068|Ga0318553_10413159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
3300032180|Ga0307471_103564552 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300032893|Ga0335069_12798908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300034417|Ga0364941_045615 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.65% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.55% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.09% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.09% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.09% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.73% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.73% |
Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.73% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.73% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.36% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.36% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.36% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.36% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.36% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.36% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.36% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.36% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.36% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.36% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002028 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17 | Environmental | Open in IMG/M |
3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P3_DRAFT_00607610 | 2088090008 | Soil | VREMSSLRERLARTPPGYRLSIGRILAIYAGLMVTLMLAALDQTIVATXXXSDAG |
ICCgaii200_09117041 | 2228664021 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLAALDQ |
INPhiseqgaiiFebDRAFT_1047988671 | 3300000364 | Soil | VTSLRERLARTPPGYRFSIGRVLTIYIGLMVTLLLAALDQTIV |
JGI10214J12806_103809861 | 3300000891 | Soil | VSLRRLAHKPPGYQFTIGKILAIYSGLMVALLLAALDQTIVATA |
JGI10216J12902_1022793391 | 3300000956 | Soil | LRERLARTPPGYRFSIGRILTIYAGLMVTLFLAALDQTIVATA |
JGI10216J12902_1045033832 | 3300000956 | Soil | MTTIAERLARKPPGYTLTIGRVLAIYSGLMVTLLLAALDQTIVA |
JGI10216J12902_1048532743 | 3300000956 | Soil | MNVRARLARTPPGYQYTIGRVLTIYAGLMVTLLLAALDQTIVA |
A17_10039401 | 3300002028 | Permafrost And Active Layer Soil | MTALRERLARTPEGYRFTIGRVLAIYAGLMTVLMLAALDQTIVATALPRI |
A17_12663501 | 3300002028 | Permafrost And Active Layer Soil | VTPIRERLARTPPGYRYSIGRILAIYSGLMVALLLAALD |
Ga0052254_11273581 | 3300003152 | Sediment | VSFAERLNRQPAGYSYTIGRILAIYAGLMVTLMLAALDQTIVATALP |
soilH1_100620083 | 3300003321 | Sugarcane Root And Bulk Soil | VSSFAERLAATPPGYRFSVGRVLLIYGALMVVLLLAALDQTI |
Ga0055439_100705002 | 3300004019 | Natural And Restored Wetlands | MTLRERLARRPPGYDLTIGRVLAIYLGLMATLLLAALDQTIVATALPR |
Ga0063454_1000810183 | 3300004081 | Soil | VSTLRQRLERTPPGYQFSKGRVLAIYSGLMVTLLLAALDQTIVATA |
Ga0062593_1005370751 | 3300004114 | Soil | VTPIRERLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTI |
Ga0062593_1020820561 | 3300004114 | Soil | MSLRERLGRTPPGYQYTIGRVLMIYAGLMVTLLLAALDQTIVATALP |
Ga0062595_1001786983 | 3300004479 | Soil | VNVRERLARQPPGYNFTIGRILAIYSGLMLTLLLAALDQTIVATALP |
Ga0062592_1016121412 | 3300004480 | Soil | MSVAARLAHTPAGYQYSIGRVLAIYSGLMMTLLLAALDQTIVATALP |
Ga0062592_1018873781 | 3300004480 | Soil | VSGLRERLARTPPGYRFSIGRVLAIYSGLMVALLLAALDQTIVATA |
Ga0062592_1019866711 | 3300004480 | Soil | VSAIRRRLARTPPGYHYSIGRVLAIYSGLMTALLLAALDQTIVA |
Ga0062592_1024863961 | 3300004480 | Soil | VSALRARLAHKPPGYRFTIGRVLAIYGAIMVALLLAALDQT |
Ga0062591_1012090041 | 3300004643 | Soil | MSIRARLAHTPPGYRYSIGRILAIYSGLMVTLFLAALDQTIV |
Ga0062594_1003218673 | 3300005093 | Soil | VTLRERLARTPPGYRFSIGRILAIYSGLMIALLLAALDQTIVATA |
Ga0062594_1022375531 | 3300005093 | Soil | MGSLRSRLARKPPGYRFTIGRILAIYSGLMVALFLAALDQTIVSTAL |
Ga0066674_102812062 | 3300005166 | Soil | LTLRQRLARTPPGYRFSIGRILAIYSGLMVTLLLAALDQTIVAT |
Ga0066683_101588683 | 3300005172 | Soil | VTLRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVATALPK |
Ga0066683_108214052 | 3300005172 | Soil | VRSRLRARLAAKPPGYRFTIGRILAIYAGLMATLLLAALDQTIVSTALP |
Ga0066688_101929353 | 3300005178 | Soil | VTTAVRARLARKPPGYEFTIGRVLAIYSGLMVTLLLAALDQTIVA |
Ga0066684_102287273 | 3300005179 | Soil | VTLRERLARQPPGYQYTIGRILAIYSGLMVALLLAALDQTIVATALP |
Ga0066678_101280594 | 3300005181 | Soil | VTSRLRERLAQQPPGYRYTVGRILAIYAGLMVTLLLAALDQTIVSTALP |
Ga0066671_101782271 | 3300005184 | Soil | MISRLRARLARKPPGYRFTIGRILIIYSGLMVALLLAALDQT |
Ga0066675_107312941 | 3300005187 | Soil | MNALRARLARKPPGYQFTIGRVLAIYSGLMVTLLLAALDQTI |
Ga0066675_112564881 | 3300005187 | Soil | LTLRQRLARTPPGYRFSIGRILAIYSGLMVTLLLAALDQTI |
Ga0066388_1007635771 | 3300005332 | Tropical Forest Soil | VSGLRGRLARTPPGYRYSIGRVLAIYSGLMVALLLAALDQTIVATALP |
Ga0070687_1005098812 | 3300005343 | Switchgrass Rhizosphere | VSLRERLARQPPGYDFTIGRILAIYSGLMLTLFLAALDQTI |
Ga0070671_1004834432 | 3300005355 | Switchgrass Rhizosphere | VASFRARLAQKPPGYRFTIGRVLAIYGAIMLALLLAALDQTIVA |
Ga0070671_1017872021 | 3300005355 | Switchgrass Rhizosphere | MKIRERLARRPPGYDLTIGRVLAIYLGLMVTLLLAALDQTIVAT |
Ga0008090_141940161 | 3300005363 | Tropical Rainforest Soil | MSLRERLARKPPGYRFTIGRILAIYAGLMVALFLAALDQTIV |
Ga0070688_1013484392 | 3300005365 | Switchgrass Rhizosphere | MSLRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVATA |
Ga0070709_115392782 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGLRARLERTPPGYHYSIGRVLAIYSGLMVALLLAALDQT |
Ga0070714_1024957721 | 3300005435 | Agricultural Soil | VTERLRQRLSRRPPGYEYTIGRILAIYSGLMVTLLLAALDQTIVATALP |
Ga0070701_113207492 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSIRERLARTPPGYRYSIGRILAIYSGLMVTLMLAALDQTIVATALP |
Ga0070701_113610682 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VASFRARLAQKPPGYRFTIGRVLAIYGAIMLALLLAALDQTIVATALP |
Ga0070711_1002660823 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSLRMRLARKPPGYRFTIGRILAIYSGLMVALFLAALDQTIVSTALP |
Ga0070711_1010720911 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAALRERLARTPPGYRFSIGRILAIYSALMVSMFLAAIDQTIVATA |
Ga0070711_1011264781 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLRERLHSRPPGYNLTIGRILAIYAGLMVTLALAALDQTIVATA |
Ga0070708_1009205141 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTIRERLARTPPGYRFSIGRILAIYSGLMVTLLLAALDQTIVATALP |
Ga0066686_105568051 | 3300005446 | Soil | VASLRARLARKPPGYRFTIGRVLAIYGAIMVALLLAALDQTIVATALP |
Ga0066689_108435672 | 3300005447 | Soil | MSMRERLARQPPGYQYTIGRILAIYSGLMVALLLAALDQTIV |
Ga0066689_110319432 | 3300005447 | Soil | MNIRERLAYQPPGYRFTIGRILAIYSGLMVTLLLAALDQTIVA |
Ga0066681_100782944 | 3300005451 | Soil | VSTLRQRLERTPPGYQYSIGRVLAIYSGLMVTLLLAALDQTIVATAL |
Ga0066681_104889661 | 3300005451 | Soil | MNLRERLARKPPGYQFTIGRVLAIYSGLMVALLLAALDQTIVATAL |
Ga0066687_106736202 | 3300005454 | Soil | MTAALRQRLARKPPGYRFTIGRILAMYAGLMVTLLLAALDQTIVSTALP |
Ga0066687_107909861 | 3300005454 | Soil | MRERLARTPPGYRFSIGRVLAIYAGLMVTLLLAALDQTIVATALP |
Ga0070699_1001404091 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLRERLARQPPGYDFTIGRILAIYSGLMVALLLAALDQT |
Ga0070699_1007989572 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLRARLARVPPGYRFSIGRVLSIYAGLMTVILLASLDQTI |
Ga0070699_1021256182 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIV |
Ga0070741_104848911 | 3300005529 | Surface Soil | MSYAERLSRKPAGYAFTMRRTLAIYVGLMVTLLLAALDQTIV |
Ga0070741_108539801 | 3300005529 | Surface Soil | VTGSLRARLERQPPGYPYSIGRILAIYAGLMVSMMLASLDQTIMATALPHVV |
Ga0070679_1015458571 | 3300005530 | Corn Rhizosphere | VASFRARLAQKPPGYRFTIGRVLAIYGAIMLALLLAALDQTIVATAL |
Ga0070686_1013176992 | 3300005544 | Switchgrass Rhizosphere | MNLRERLARQPPGYDFTIGRILAIYSGLMVALLLAALDQTIV |
Ga0070696_1016783891 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPIRARLARTPPGYQYSIGRILAIYSGLMIALLLAALDQTIVA |
Ga0070704_1016558042 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLADRLGRTPPGYTLTIGRVLAIYSGLMVTLLLAALDQTIVATA |
Ga0066701_101066903 | 3300005552 | Soil | MSMRERLARQPPGYQYTIGRILAIYSGLMVALLLAALDQTIVATA |
Ga0066701_101697653 | 3300005552 | Soil | MGSIRARLARKPPGYRFTIGRILAIYGALMLVLLLAALDQTIVATA |
Ga0066661_106249552 | 3300005554 | Soil | MGSLRERLARKPPGYRFTIGRILAIYAGLMVALLLAALDQTIVA |
Ga0066661_108800932 | 3300005554 | Soil | VNLRERLARKPPGYDYTIGRVLTIYAGLMVTLLLAALDQTI |
Ga0066698_110395191 | 3300005558 | Soil | VGPRSRLRRTLPGYRLPLGRVLAVYAALMVALLLAALDQTV |
Ga0066700_110651842 | 3300005559 | Soil | LSRQPPGYNYTIGRILAIYSGLMVTLLLAALDQTIV |
Ga0066699_103043911 | 3300005561 | Soil | VSLRARLRRQPPGYNFTIGRILAIYAGLMVTLALAALDQTIV |
Ga0068855_1017619331 | 3300005563 | Corn Rhizosphere | MIALGERLARKPEGYRFTIGRVLAIYAGLMTVLLLAALDQTIVATAL |
Ga0066693_104263411 | 3300005566 | Soil | MNALRARLARKPPGYQFTIGRVLAIYSGLMVTLLLAALDQTIVATALP |
Ga0066705_105374551 | 3300005569 | Soil | VSSRLRAWLAHKPEGYRFTKGRILAIYSGLMVTLLLAALDQTIVATALP |
Ga0068857_1000430741 | 3300005577 | Corn Rhizosphere | VASLRVRLARKPPGYRFTIGRVLAIYGAIMVALLLAALDQTIVAT |
Ga0066654_102479991 | 3300005587 | Soil | MNLRERLARKPPGYQFTIGRVLAIYSGLMVALLLAALDQTI |
Ga0066654_103746711 | 3300005587 | Soil | VSLRARLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTIVATA |
Ga0068856_1000509601 | 3300005614 | Corn Rhizosphere | VRLGERLRHKPAGYNYTIGRILAIYAGLMVTLALAALDQT |
Ga0068856_1012886761 | 3300005614 | Corn Rhizosphere | VSLKSRLQRQPPGYDFTIGRILAIYAGLMVTMLLAALDQTIVATA |
Ga0068856_1024318272 | 3300005614 | Corn Rhizosphere | VTVRERLARKPPGYQFTIGRILAIYSGLMVTLALAALDQTIVATALPRIV |
Ga0068859_1020027922 | 3300005617 | Switchgrass Rhizosphere | VTLRERLARTPPGYRFSIGRILAIYSGLMIALLLAALDQTIV |
Ga0066903_1002894064 | 3300005764 | Tropical Forest Soil | VSSLRERLARTPPGYRFSIGRILTIYAGLMVALLLA |
Ga0066903_1017984413 | 3300005764 | Tropical Forest Soil | VSIRGYLGRQPDGYTMTIGRILAIYSGLMVTLMLAALDQTIVATALPR |
Ga0066903_1062031142 | 3300005764 | Tropical Forest Soil | LSSFAERLARTPPGFRFSIGRTLAIYSGLMVTLLLAALDQTIVA |
Ga0066903_1086540962 | 3300005764 | Tropical Forest Soil | VTPLRTRLARTPEGYNYSIGRVLAIYLGLMMTLLLA |
Ga0068851_105631321 | 3300005834 | Corn Rhizosphere | VDLRARLRSKPPGYNLTIGRILAIYAGLMVTLALAALDQTIVATA |
Ga0066652_1007953631 | 3300006046 | Soil | VSTLRQRLERTPPGYQYSIGRVLAIYSGLMVTLLLAALDQTIVATALPK |
Ga0066652_1020766391 | 3300006046 | Soil | VTLRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVATALPKI |
Ga0075417_103940421 | 3300006049 | Populus Rhizosphere | VSGLRARLARTPPGYRYSIGRVLAIYSGLMVALLLAALDQTIVATA |
Ga0070716_1009330461 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLRGMTLSERLARKPPGYDYTIGRVLTIYAGLMVT |
Ga0070712_1016118091 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLRDRLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVATALP |
Ga0074055_100009582 | 3300006573 | Soil | VSLRERLNRQPPGYNFTIGRILAIYAGLMVTLLLAALDQTIVATAL |
Ga0074062_116799191 | 3300006606 | Soil | MNVRARLAHQPPGYEFTIGRILAIYSGLMVTLLLAALDQTIVA |
Ga0066665_101258041 | 3300006796 | Soil | MGSIRARLARKPPGYRFTIGRILAIYGALMLVLLLAALDQTIVATAL |
Ga0066659_113173801 | 3300006797 | Soil | VSLRERLARKPPGYDYTIGRVLTIYAGLMVTLLLAAL |
Ga0066660_114726762 | 3300006800 | Soil | VSLRERLARKPPGYDYTIGRVLTIYAGLMVTLLLAALDQT |
Ga0075421_1020303071 | 3300006845 | Populus Rhizosphere | VTPIRERLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTIVAT |
Ga0075433_115469911 | 3300006852 | Populus Rhizosphere | VSSLRAQLARTPPGYRYSIGRVLAIYSGLMVALLLA |
Ga0075420_1009596482 | 3300006853 | Populus Rhizosphere | VSALRARLAHKPPGYRFTIGRVLAIYGAIMVAILLAALDQTIVATALP |
Ga0075425_1029016851 | 3300006854 | Populus Rhizosphere | MGSLRERLARKPPGYRFTIGRILAIYAGLMTALFLAALDQTIVATALPR |
Ga0075434_1012274213 | 3300006871 | Populus Rhizosphere | MTLRDRLARQPPGYEFTIGRILAIYSGLMVALLLAALDQTI |
Ga0075424_1025449283 | 3300006904 | Populus Rhizosphere | MTLRDRLARQPPGYEFTIGRILAIYSGLMVALLLAALDQ |
Ga0097620_1022315071 | 3300006931 | Switchgrass Rhizosphere | VTLRERLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTIVAT |
Ga0099794_105357081 | 3300007265 | Vadose Zone Soil | VTTLRDRLAHTPPGYRFSIGRILAIYAGVMVTLMLAALDQTI |
Ga0066710_1006389091 | 3300009012 | Grasslands Soil | MPIRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTI |
Ga0066710_1015177143 | 3300009012 | Grasslands Soil | VTPRLRERLAQQPPGYRYTIGRILAIYAGLMVTLLLAALDQTIVSTA |
Ga0075418_119295172 | 3300009100 | Populus Rhizosphere | MSIREKLASKPPGYRFTIGRILAIYAGLMVTLLLA |
Ga0105247_111860781 | 3300009101 | Switchgrass Rhizosphere | MTLRERLARTPPGYEFTVGRVLSIYLGLMIVLMLA |
Ga0066709_1030377931 | 3300009137 | Grasslands Soil | VTSIKARLARKPPGYQFTIGRILAIYAGLMVTLLLAALDQTIVATAVPK |
Ga0111538_100449861 | 3300009156 | Populus Rhizosphere | VTAVHAWLHRQPPGYRLTFGRILAIYSGLMTALLLAS |
Ga0105241_120993832 | 3300009174 | Corn Rhizosphere | VTLRERLARTPPGYRFSIGRILAIYSGLMIALLLAAL |
Ga0105242_119524121 | 3300009176 | Miscanthus Rhizosphere | VASLRVRLARKPPGYRFTIGRVLAIYGAIMVALLLAALDQTIVATAL |
Ga0105249_120705022 | 3300009553 | Switchgrass Rhizosphere | MTLRERLARQPPGYDFTIGRILAIYSGLMVALLLAALDQTIVATALP |
Ga0105249_121726523 | 3300009553 | Switchgrass Rhizosphere | MRLRERLAHTPPGYRFSIGRILAIYSGLMVALLLAALD |
Ga0126313_114770523 | 3300009840 | Serpentine Soil | MRARFRDALRQKPPGYQFTIGRILAIYAGLMVTLLLAALDQTIV |
Ga0126315_101241961 | 3300010038 | Serpentine Soil | MRARFRDALRQKPPGYRFTIGRILAIYAGLMVTLLLAALDQTIVATALP |
Ga0126315_102390211 | 3300010038 | Serpentine Soil | LSSLAERLARTPPGFRFSIGRTLAIYSGLMVTLLLAALDQTIVATS |
Ga0126308_101774081 | 3300010040 | Serpentine Soil | VRSIRQRLAHKPPGYRFTIGRILAIYGGLMTVLAL |
Ga0126314_107227611 | 3300010042 | Serpentine Soil | MTLRERLARTPPGYRLSVGRILAIYSGLMTALLLAALDQTIVATAL |
Ga0126314_112691891 | 3300010042 | Serpentine Soil | MTARFRDALRQKPPGYQFTIGRILAIYSGLMVTLLLAALDQTIVATAL |
Ga0126380_116050401 | 3300010043 | Tropical Forest Soil | MSLGERLSRTPPGYEYTIGRVLTIYAGLMVTLLLAALDQTI |
Ga0126310_104130942 | 3300010044 | Serpentine Soil | MTAGFRDALRQKPPGYQFTIGRILAIYAGLMVTLLLAALDQTIVAT |
Ga0126382_117827602 | 3300010047 | Tropical Forest Soil | VSGLRARLARTPPGYRYSIGRVLAIYSGLMVALLLAALDQ |
Ga0126306_103246411 | 3300010166 | Serpentine Soil | MRARFRDALREKPPGYQFTIGRILAIYAGLMVTLLL |
Ga0126306_115017211 | 3300010166 | Serpentine Soil | MTLRERLARTPQGYRLSIGRVLLIYAGLMTALLLAA |
Ga0134064_102941111 | 3300010325 | Grasslands Soil | MTLRERLARTPPGYTYSIGRVLAIYSGLMVTLMLAALDQTI |
Ga0134065_104935552 | 3300010326 | Grasslands Soil | MRSRLRARLARKPPGYRFTIGRILLIYSGLMVTLLLAALDQTIVAT |
Ga0134111_105761301 | 3300010329 | Grasslands Soil | MSLRVRLARKPAGYDYTIGRVLTIYAGLMVTLLLAALD |
Ga0134080_103641121 | 3300010333 | Grasslands Soil | VTSRLRARLAAQPPGYRFTIGRILAIYAGLMATLLLAA |
Ga0134080_106466391 | 3300010333 | Grasslands Soil | VSLRERLRRQPPGYNFTIGRILAIYAGLMVTLALAALDQT |
Ga0134063_106778911 | 3300010335 | Grasslands Soil | VTSRLRARLARKPPGYRFTVGRILAIYSGLMVTLLLA |
Ga0134062_102034812 | 3300010337 | Grasslands Soil | VSTLRQRLERTPPGYQYSIGRVLAIYSGLMVTLLLAALDQTIVAT |
Ga0134125_101614361 | 3300010371 | Terrestrial Soil | MNLRERLARQPPGYDFTIGRILAIYSGLMVALLLAALDQTIVAT |
Ga0134125_130181642 | 3300010371 | Terrestrial Soil | MTLRERLARQPPGYDFTIGRILAIYSGLMVALLLAALDQTIVAT |
Ga0105239_114326232 | 3300010375 | Corn Rhizosphere | VSLRERLHSRPPGYNLTIGRILAIYAGLMVTLALAALDQTIVATALPR |
Ga0134122_112287932 | 3300010400 | Terrestrial Soil | VTLRERLARTPPGYRFSIGRILAIYSGLMIALLLAALDQTIVATAL |
Ga0151490_15978461 | 3300011107 | Soil | VSSIRERLARTPPGYRYSIGRILAIYSGLMVALLLAA |
Ga0120162_10422561 | 3300011997 | Permafrost | VNLRERLARQPPGYNFTIGRILAIYSGLMVTLLLAALDQTIVATAIPR |
Ga0137389_117214301 | 3300012096 | Vadose Zone Soil | VASLSERLAHKPPGYRFTIGRILAIYSGLMVTLLLAALDQTIVATALP |
Ga0137388_117727981 | 3300012189 | Vadose Zone Soil | VTTRLRARLARRPPGYDYTVGRVLAIYAGLMVTLLLAALDQTIV |
Ga0137364_111346632 | 3300012198 | Vadose Zone Soil | VSLRERLARTPPGYRFSIGRILAIYSGLMVTLLLAALDQTIVATAL |
Ga0137365_101753161 | 3300012201 | Vadose Zone Soil | MTLRDRLARKPPGYQFTIGRILAIYSGLMVALLLAALDQTI |
Ga0137365_110375961 | 3300012201 | Vadose Zone Soil | VTSRLRQRLAQQPPGYRYTIGRILAIYAGLMVTLLLAAL |
Ga0137376_114756661 | 3300012208 | Vadose Zone Soil | VASLRARLARTPPGYRFSIGRVLAIYGALMLALLLASLDQT |
Ga0137379_107554442 | 3300012209 | Vadose Zone Soil | LTLRQRLARTPPGYRFSIGRILAIYSGLMVTLLLAALDQTIVASALLKVVS* |
Ga0137370_103331471 | 3300012285 | Vadose Zone Soil | VTPLRERLARTPPGYTYSIGRVLAIYSGLMVTLLLAALDQTIVATALPK |
Ga0137366_103134341 | 3300012354 | Vadose Zone Soil | MGSLRERLAQKPPGYRFTIGRILAIYAGLMVALFLAALDQTI |
Ga0137366_106071252 | 3300012354 | Vadose Zone Soil | LSDVRGRLARTPPGFRFSIGRTLAIYAGLMVTLLLAALDQTIVAT |
Ga0137366_106170352 | 3300012354 | Vadose Zone Soil | VSAIRQRLERTPPGYRYSIGRVLAIYSGLMVTLLLA |
Ga0137371_106560272 | 3300012356 | Vadose Zone Soil | VASLRARLARTPPGYRFSIGRVLAIYGALMLALLLASLDQTIVAT |
Ga0137375_103430413 | 3300012360 | Vadose Zone Soil | VAALRARLAQKPPGYRYTIGRILTIYGALMVVLLLAALDQTIVATALP |
Ga0137375_108590212 | 3300012360 | Vadose Zone Soil | MSIRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVST |
Ga0157318_10349971 | 3300012482 | Arabidopsis Rhizosphere | MSSLRVRLATTPPGYTMPVGRILAIFAGLMVTLLL |
Ga0157319_10303671 | 3300012497 | Arabidopsis Rhizosphere | MPIRERLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTI |
Ga0137373_101343324 | 3300012532 | Vadose Zone Soil | VSALRERLERTPPGYRFSIGRVLAIYSGLMVTLLLAALDQTIVAT |
Ga0157284_102978051 | 3300012893 | Soil | MIALGERLARKPEGYRFTIGRVLAIYAGLMTVLLLAALDQTIVA |
Ga0157295_102962341 | 3300012906 | Soil | MTSIAERLARKPPGYELTIGRVLSIYLGLMVTLLLAALDQT |
Ga0157306_102724812 | 3300012912 | Soil | VASLRARLAHKPPGYRFTIGRVLAIYGALMLALLLASLDQ |
Ga0137404_104220842 | 3300012929 | Vadose Zone Soil | MTLRNRLARKPPGYQFTIGRILAIYSGLMVALLLAALDQTIVA |
Ga0164300_109602111 | 3300012951 | Soil | MTLRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQT |
Ga0164298_101684622 | 3300012955 | Soil | VNLRERLSRQPPGYNFTIGRILAIYAGLMVTLFLAALDQTI |
Ga0164299_101398253 | 3300012958 | Soil | VTIRERLARTPPGYRFSIGRILAIYSGLMVALLLA |
Ga0164299_101862733 | 3300012958 | Soil | MRLRERLARKPPGYEYTIGRVLTIYAGLMVTLLLAALDQTIVATALPR |
Ga0164301_107631001 | 3300012960 | Soil | MNIRERLERQPPGYNFTIGRILAIYSGLMVTLLLAALDQTIVATAL |
Ga0164309_111837751 | 3300012984 | Soil | VSVRERLARKPPGYQFTIGRVLAIYSGLMVALLLAALDQTIVATAL |
Ga0164308_105556721 | 3300012985 | Soil | VTIRERLARTPPGYRFSIGRILAIYSGLMVALLLAAL |
Ga0164307_102184663 | 3300012987 | Soil | VASIRARLARKPPGYRFTIGRVLAIYGAIMVALLLAALDQTIVATAL |
Ga0164305_101731381 | 3300012989 | Soil | VSVRERLARKPPGYQFTIGRVLAIYSGLMVALLLAALDQTI |
Ga0157369_111697212 | 3300013105 | Corn Rhizosphere | VSLRDRLHSRPPGYNLTIGRILAIYAGLMVTLALAALDQ |
Ga0157369_115990392 | 3300013105 | Corn Rhizosphere | VTVRERLARKPPGYQFTIGRILAIYAGLMVTLALAALDQTIVAT |
Ga0157372_112442672 | 3300013307 | Corn Rhizosphere | VSLRERLHSRPPGYNLTIGRILAIYAGLMVTLALAALDQTIVATALP |
Ga0157372_125984371 | 3300013307 | Corn Rhizosphere | VSLRERLSRQPPGYNFTIGRILAIYAGLMVTLFLAALDQT |
Ga0157375_136289161 | 3300013308 | Miscanthus Rhizosphere | VLDMSIRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVATSLP |
Ga0120111_10790951 | 3300013764 | Permafrost | MIALGERLARKPEGYRFTIGRVLAIYAGLMTVLMLAALD |
Ga0120158_101471231 | 3300013772 | Permafrost | VTPLRERLARTPPGYRFSIGRVLAIYAGLMVTLMLAALDQTIVATALPKV |
Ga0120158_101598102 | 3300013772 | Permafrost | VASLRARLARKPPGYRFTIGRVLAIYGALMLALLLASLDQTIVA |
Ga0120158_104095391 | 3300013772 | Permafrost | VSLRERLARKPPGYRFTIGRILAIYSGLMVTLLLAALDQTIVAA |
Ga0120149_10768421 | 3300014058 | Permafrost | MSIRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVSTALP |
Ga0157376_120214283 | 3300014969 | Miscanthus Rhizosphere | VRLGERLQHKPAGYNYTIGRILAIYAGLMVTLALAALDQTIVATALPRIV |
Ga0157376_124204401 | 3300014969 | Miscanthus Rhizosphere | VASLRARLAQKPPGYRFTIGRVLAIYGAIMVALLLAALDQTI |
Ga0167650_11160982 | 3300015203 | Glacier Forefield Soil | VSLKTRLAHQPPGYNFTIGRILAIYSGLMVTLLLAALDQTIVATALP |
Ga0137403_107168732 | 3300015264 | Vadose Zone Soil | MSLRERLARQPPGYDFTIGRILAIYSGLMVTLLLAALDQTIVATAL |
Ga0132255_1008157573 | 3300015374 | Arabidopsis Rhizosphere | MSVAARLAHTPAGYQYSIGRVLAIYSGLMVALLLAA |
Ga0180121_100675452 | 3300017695 | Polar Desert Sand | MGSLAGWRARLAHKPPGYRYTIGRILAIYAGLMVTLMLA |
Ga0184619_101902152 | 3300018061 | Groundwater Sediment | VRAMRERLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTIVA |
Ga0184619_104613391 | 3300018061 | Groundwater Sediment | VSTFRERLSRTPPGYRYSIGRVLAIYSGLMVALMLAALDQTIV |
Ga0184611_13031091 | 3300018067 | Groundwater Sediment | MTPIRARLARTPPGYQYSIGRILAIYSGLMIALLLAALDQTI |
Ga0187774_100614874 | 3300018089 | Tropical Peatland | VTPLRERLSRTPPGYTYSIGRVLAIYSGLMVTLLLAALDQTIVATALP |
Ga0190268_106273551 | 3300018466 | Soil | MGRLRARLARTPPGYRFTIGRVLAIYGAIMVAILLAALDQT |
Ga0190268_122222872 | 3300018466 | Soil | MGRLRVRLARTPPGYRFTIGRVLAIYGAIMVALLLAALDQTIV |
Ga0066662_106527472 | 3300018468 | Grasslands Soil | MTSRLRARLARKPPGYRFTIGRILLIYSGLMVALLLAALDQ |
Ga0066662_128410194 | 3300018468 | Grasslands Soil | MSPLQSLRGRLAHTPPGYQFSIGRILAIYSGLMVTLFLAARDQTIVAT |
Ga0066669_111252031 | 3300018482 | Grasslands Soil | VTTAVRARLARKPPGYEFTIGRVLAIYSGLMVTLLLAALDQTIVATA |
Ga0193701_10215481 | 3300019875 | Soil | MTLRERLARQPPGYQFTIGRILAIYAGLMVTLLLAALDQTI |
Ga0193701_11001151 | 3300019875 | Soil | MTPIRARLARTPPGYQYSIGRILAIYSGLMIALLLAAL |
Ga0193739_10505803 | 3300020003 | Soil | VSLRERLARKPPGYRYTVGRILVIYSGLMVTVFLAALDQTIVA |
Ga0213882_101633901 | 3300021362 | Exposed Rock | VTIRERLGRKPPGYDYTIGRVLAIYAGLMVTLALAALDQT |
Ga0193737_10367492 | 3300021972 | Soil | VASIRARLAHKPPGYRFTIGRVLAIYGAIMVALLLAALDQTIVAT |
Ga0247751_10808082 | 3300023069 | Soil | VASLRARLARTPPGYRFSIGRVLAIYGALMLALLLASI |
Ga0247670_10345752 | 3300024283 | Soil | VSFRERLARQPPGYNFTIGRILAIYAGLMVTLLLAAL |
Ga0247666_10061725 | 3300024323 | Soil | VSFRERLARQPPGYNFTIGRILAIYAGLMVTLLLAALDQTIVAT |
Ga0247678_10381901 | 3300024325 | Soil | VSGLRARLERTPPGYHYSIGRVLAIYSGLMVALLLAALDQ |
Ga0207692_100192281 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGLRARLERTPPGYHYSIGRVLAIYSGLMVALLLAALDQTIVAT |
Ga0207705_110412661 | 3300025909 | Corn Rhizosphere | VNLRARLRSKPPGYNLTIGRILAIYAGLMVTLALAALDQTIVATAL |
Ga0207695_109864981 | 3300025913 | Corn Rhizosphere | VSTIRERLERTPPGYPFSKGRVLAIYSGLMVTLLLAALDQTI |
Ga0207693_101423214 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPRLRAWLASKPEGYRFTKGRILAIYSGLMVTLLLA |
Ga0207657_115008221 | 3300025919 | Corn Rhizosphere | VEDVASFRARLAQKPPGYRFTIGRVLAIYGAIMLALL |
Ga0207646_109206651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLRERLGRRTPGYDYTIGRILSVYAVLMVTLLLASRAVSPA |
Ga0207665_101335704 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLRERLALKPPGYNFTIGRILAIYAGLMLTLLLAALDQTIVATA |
Ga0207661_110472442 | 3300025944 | Corn Rhizosphere | VSLRERLHSRPPGYNLTIGRILAIYAGLMVTLALAAL |
Ga0207651_107356391 | 3300025960 | Switchgrass Rhizosphere | VRLGERLRHKPAGYNYTIGRILAIYAGLMVTLALAALDQTIVATAL |
Ga0207712_102020904 | 3300025961 | Switchgrass Rhizosphere | VEDVASFRARLAQKPPGYRFTIGRVLPIYGAIMLALLRA |
Ga0207712_116691871 | 3300025961 | Switchgrass Rhizosphere | MRLRERLAHTPPGYRFSIGRILAIYSGLMVALLLAAL |
Ga0207703_121714972 | 3300026035 | Switchgrass Rhizosphere | VTLRERLARTPPGYRFSIGRILAIYSGLMVALLLAALDQTIV |
Ga0207639_108049752 | 3300026041 | Corn Rhizosphere | VSTLRERLERTPPGYPFSKGRVLAIYSGLMVTLLLAALDQTIVA |
Ga0207708_110388463 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIRERLAHTPPGYRYSIGRILAIYAGLMVTLFLAA |
Ga0207702_121997242 | 3300026078 | Corn Rhizosphere | VEDVASFRARLAQKPPGYRFTIGRVLAIYGAIMLALLL |
Ga0209350_11236922 | 3300026277 | Grasslands Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLAALDQT |
Ga0209234_12949772 | 3300026295 | Grasslands Soil | VSLRERLARTPPGYRFSIGRILAIYSGLMVTLLLAA |
Ga0209472_11534841 | 3300026323 | Soil | VSLRERLARKPPGYDYTIGRVLTIYAGLMVTLLLAALDQTIVATAL |
Ga0209473_12617761 | 3300026330 | Soil | MVSLRERLARKPPGYRFTIGRILAIYSGLMVALFLAALDQTIV |
Ga0209808_11901311 | 3300026523 | Soil | VSTLRQRLERTPPGYQYSIGRVLAIYSGLMVTLLLAALDQTIVA |
Ga0209806_12520002 | 3300026529 | Soil | MTLRDRLARRPPGYQYTIGRILAIYSGLMVALLLA |
Ga0209056_101540081 | 3300026538 | Soil | MGSIRARLARKPPGYRFTIGRILAIYGALMLVLLLAALDQTI |
Ga0209474_102127371 | 3300026550 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVAALDQTIVATALPR |
Ga0209887_10464002 | 3300027561 | Groundwater Sand | VSALRARLAQKPPGYRFTIGRVLAIYGAIMVAILLAALDQTIV |
Ga0209814_102499212 | 3300027873 | Populus Rhizosphere | MSIREKLASKPPGYRFTIGRILAIYAGLMVTLLLAALDQTIVSTSLPT |
Ga0265334_103414222 | 3300028573 | Rhizosphere | VKGVNIRERLARKPPGYDYTIGRVLAIYLGLMMALLL |
Ga0307321_10723921 | 3300028704 | Soil | MTPIRARLARTPPGYQYSIGRILAIYSGLMIALLLAALDQT |
Ga0307291_10610951 | 3300028707 | Soil | VSTLRERLERTPPGYPFSKGRVLAIYSGLMVTLLLAALD |
Ga0307279_100898561 | 3300028709 | Soil | VSTLRERLERTPPGYPFSKGRVLAIYSGLMVTLLLAAL |
Ga0307293_102331102 | 3300028711 | Soil | VASLAARLARKPPGYRFTIGRVLAIYGAIMLALLLAALD |
Ga0307298_101564351 | 3300028717 | Soil | MNLSERLARKPPGYQFTIGRILAIYSGLMVALLLA |
Ga0307315_101005951 | 3300028721 | Soil | MVSLRERLARKPPGYQFTIGRILAIYAGLMVTLLLAALDQTIVATALP |
Ga0307319_101467832 | 3300028722 | Soil | MGRLRSRLARTPPGYRFTIGRVLAIYGAIMVALLLAALDQTIV |
Ga0307318_102409942 | 3300028744 | Soil | VTPIRERLARTPPGYRYSIGRILAIYSGLMVALLLAALDQTIVATALP |
Ga0307288_102859111 | 3300028778 | Soil | MTPIRARLARTPPGYQYSIGRILAIYSGLMIALLLAALDQTIVATAL |
Ga0307288_103913142 | 3300028778 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLAALDQTIVATA |
Ga0307282_102006761 | 3300028784 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLAALD |
Ga0307282_102022312 | 3300028784 | Soil | MVSLRDRLARRPPGYQFTIGRILAIYAGLMVTLLLAALDQTIVATALP |
Ga0307282_102100641 | 3300028784 | Soil | VTPIRERLARTPPGYRYSIGRILAIYSGLMVALLLAALDQTIVATALPR |
Ga0307282_102660682 | 3300028784 | Soil | MIALRERLARTPPGYRFSIGRILAIYSGLMVTLLLAALDQ |
Ga0307323_100705541 | 3300028787 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLA |
Ga0307287_102795012 | 3300028796 | Soil | VTPIRERLARTPPGYRYSIGRILAIYSGLMVALLLAALDQTI |
Ga0307284_100626943 | 3300028799 | Soil | VKAIRVRLARTPPGYRYSIGRILAIYSGLMITLLLAAL |
Ga0307284_101800471 | 3300028799 | Soil | MVSLRDRLARRPPGYQFTIGRILAIYAGLMVTLLLAALDQTIVATALPR |
Ga0307292_100243671 | 3300028811 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLAALDQTIVATAL |
Ga0307302_100466904 | 3300028814 | Soil | VSTIGERLARTPPGYRYSIGRILAIYSGLMITLLLAALDQTI |
Ga0307302_101455603 | 3300028814 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLAALDQTIVAT |
Ga0307296_101193284 | 3300028819 | Soil | VTPIRERLARTPPGYRYSIGRILAIYSGLMVALLLAALDQTIVAT |
Ga0307310_1000170812 | 3300028824 | Soil | VTPIRQRLARTPPGYRYSIGRILAIYSGLMVALLLAALDQTIVATALPR |
Ga0307278_101246681 | 3300028878 | Soil | VGPRSRLRRTLPGYRLSLGRVLAVYAALMAALLLAALDQT |
Ga0307278_101721852 | 3300028878 | Soil | VKAIRVRLARTPPGYRYSIGRILAIYSGLMITLLLAALDQTIVA |
Ga0307300_101228321 | 3300028880 | Soil | MSIRERLARTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVATSLPAI |
Ga0307277_103744772 | 3300028881 | Soil | MDMSIRERLTRTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIV |
Ga0307308_104782222 | 3300028884 | Soil | MTLRERLARQPPGYQFTIGRILAIYSGLMVALLLAA |
Ga0302323_1007470232 | 3300031232 | Fen | VNLRERLGRQPPGYNYTIGRILAIYAGLMVTLLLAALDQTIVATALPK |
Ga0318555_105871081 | 3300031640 | Soil | VTLRERLGRTPPGYRFSIGRVLTIYAGLMVALLLAALD |
Ga0307372_105397812 | 3300031671 | Soil | MSLRERLGRRPPGYEYPIGRVLAIYLGLMVALMLGALDQTIVA |
Ga0310813_108854022 | 3300031716 | Soil | VASFRARLAQKPPGYRFTIGRVLAIYGAIMLALLLAALDQ |
Ga0310813_113408702 | 3300031716 | Soil | MSPRLRAWLASKPEGYRFTKGRILAIYSGLMVTLLLAALDQTIVATALP |
Ga0307468_1024884881 | 3300031740 | Hardwood Forest Soil | MSIRERLARTPPGYRYSIGRILAIYSGLMVTLLLA |
Ga0318529_104520281 | 3300031792 | Soil | MSIRERLAHTPPGYRYSIGRILAIYSGLMVTLLLAALDQTIVATALPR |
Ga0318523_102308683 | 3300031798 | Soil | VSTLRERLARTPPGYRFSIGRVLVIYAGLMVTLLLAALDQTIVATALPK |
Ga0318568_110534092 | 3300031819 | Soil | VSTLRERLARTPPGYRFSIGRVLVIYAGLMVTLLL |
Ga0318517_103837742 | 3300031835 | Soil | VSTLRERLARTPPGYRFSIGRVLVIYAGLMVTLLLAALDQTI |
Ga0307410_108296023 | 3300031852 | Rhizosphere | VSRLRERLARKPPGYRFTVGRILVIYSGLMVTVFLAALDQTIVATALPR |
Ga0307410_112954242 | 3300031852 | Rhizosphere | VNGLRARLARTPPGYRYSIGRVLAIYSGLMVALLLAALDQTIVATALPR |
Ga0306926_124319301 | 3300031954 | Soil | VSPLRERLARTPPGYRFSIGRVLAIYAGLMVTLLLAALDQTIVA |
Ga0307416_1002388921 | 3300032002 | Rhizosphere | MNVAERLARRPPGYEYTIGRVLSIYLGLMVTLLLAALDQT |
Ga0318558_101887041 | 3300032044 | Soil | VSFAERLNTRPPGYSYTIGRILAIYAGLMVTLMLAALDQTIVAT |
Ga0318524_101628002 | 3300032067 | Soil | MVTLRERLGRTPPGYRFSIGRVLTIYAGLMVALLLAALDQTI |
Ga0318553_104131592 | 3300032068 | Soil | VSFAERLNTRPPGYSYTIGRILAIYAGLMVTLMLAALDQTIVA |
Ga0307471_1035645521 | 3300032180 | Hardwood Forest Soil | VNVRARLAETPPGYALSLGRVLGIYSGLSIALLLASLDQTVVATV |
Ga0335069_127989082 | 3300032893 | Soil | VSVAERLSRHPPGYAFTIRRTLAIYVGLMVTLLLAALDQTIVTTA |
Ga0364941_045615_844_969 | 3300034417 | Sediment | MGRLRARLARTPPGYRFTIGRVLAIYGAIMVALLLAALDQTI |
⦗Top⦘ |