NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012874

Metagenome / Metatranscriptome Family F012874

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012874
Family Type Metagenome / Metatranscriptome
Number of Sequences 276
Average Sequence Length 41 residues
Representative Sequence MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINV
Number of Associated Samples 103
Number of Associated Scaffolds 276

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.95 %
% of genes near scaffold ends (potentially truncated) 52.90 %
% of genes from short scaffolds (< 2000 bps) 73.91 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.652 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow
(17.754 % of family members)
Environment Ontology (ENVO) Unclassified
(34.420 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(38.768 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.75%    β-sheet: 0.00%    Coil/Unstructured: 56.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 276 Family Scaffolds
PF00005ABC_tran 2.17
PF12224Amidoligase_2 2.17
PF01645Glu_synthase 2.17
PF13183Fer4_8 1.81
PF00528BPD_transp_1 1.81
PF13416SBP_bac_8 1.45
PF13549ATP-grasp_5 1.45
PF13607Succ_CoA_lig 1.45
PF00583Acetyltransf_1 1.09
PF04290DctQ 1.09
PF00817IMS 1.09
PF00106adh_short 1.09
PF00534Glycos_transf_1 1.09
PF12897Asp_aminotransf 1.09
PF040292-ph_phosp 0.72
PF00137ATP-synt_C 0.72
PF01636APH 0.72
PF02646RmuC 0.72
PF00561Abhydrolase_1 0.72
PF14622Ribonucleas_3_3 0.72
PF03576Peptidase_S58 0.72
PF02470MlaD 0.72
PF08545ACP_syn_III 0.72
PF07238PilZ 0.72
PF00890FAD_binding_2 0.72
PF02915Rubrerythrin 0.72
PF00072Response_reg 0.72
PF05170AsmA 0.72
PF08450SGL 0.72
PF00483NTP_transferase 0.72
PF01297ZnuA 0.72
PF00294PfkB 0.72
PF05573NosL 0.72
PF02662FlpD 0.72
PF00300His_Phos_1 0.36
PF02585PIG-L 0.36
PF02572CobA_CobO_BtuR 0.36
PF13458Peripla_BP_6 0.36
PF08666SAF 0.36
PF08264Anticodon_1 0.36
PF04024PspC 0.36
PF12418AcylCoA_DH_N 0.36
PF16868NMT1_3 0.36
PF16363GDP_Man_Dehyd 0.36
PF01219DAGK_prokar 0.36
PF132794HBT_2 0.36
PF00463ICL 0.36
PF12146Hydrolase_4 0.36
PF00180Iso_dh 0.36
PF00355Rieske 0.36
PF00109ketoacyl-synt 0.36
PF00430ATP-synt_B 0.36
PF01381HTH_3 0.36
PF02934GatB_N 0.36
PF13371TPR_9 0.36
PF02274ADI 0.36
PF13242Hydrolase_like 0.36
PF00753Lactamase_B 0.36
PF01977UbiD 0.36
PF13442Cytochrome_CBB3 0.36
PF00476DNA_pol_A 0.36
PF02604PhdYeFM_antitox 0.36
PF01144CoA_trans 0.36
PF02608Bmp 0.36
PF02538Hydantoinase_B 0.36
PF00793DAHP_synth_1 0.36
PF00892EamA 0.36
PF01416PseudoU_synth_1 0.36
PF01966HD 0.36
PF003892-Hacid_dh 0.36
PF03692CxxCxxCC 0.36
PF00589Phage_integrase 0.36
PF14522Cytochrome_C7 0.36
PF03328HpcH_HpaI 0.36
PF16199Radical_SAM_C 0.36
PF01894UPF0047 0.36
PF01261AP_endonuc_2 0.36
PF00482T2SSF 0.36
PF08402TOBE_2 0.36
PF00990GGDEF 0.36
PF02517Rce1-like 0.36
PF08821CGGC 0.36
PF00202Aminotran_3 0.36
PF05973Gp49 0.36
PF05157T2SSE_N 0.36
PF10518TAT_signal 0.36
PF07885Ion_trans_2 0.36
PF13173AAA_14 0.36
PF02627CMD 0.36
PF00196GerE 0.36
PF11006DUF2845 0.36
PF00850Hist_deacetyl 0.36
PF07949YbbR 0.36
PF132392TM 0.36
PF14559TPR_19 0.36
PF01740STAS 0.36
PF00211Guanylate_cyc 0.36
PF10035DUF2179 0.36
PF01955CbiZ 0.36
PF00144Beta-lactamase 0.36
PF12804NTP_transf_3 0.36
PF02911Formyl_trans_C 0.36
PF04909Amidohydro_2 0.36
PF05670NFACT-R_1 0.36
PF06315AceK_kinase 0.36
PF02321OEP 0.36
PF00348polyprenyl_synt 0.36
PF14358DUF4405 0.36
PF01625PMSR 0.36
PF02518HATPase_c 0.36
PF02629CoA_binding 0.36
PF11812DUF3333 0.36
PF09339HTH_IclR 0.36
PF00291PALP 0.36
PF00724Oxidored_FMN 0.36
PF13193AMP-binding_C 0.36
PF01370Epimerase 0.36
PF14241Obsolete Pfam Family 0.36
PF08245Mur_ligase_M 0.36
PF08843AbiEii 0.36
PF03462PCRF 0.36
PF09835DUF2062 0.36
PF13847Methyltransf_31 0.36
PF02852Pyr_redox_dim 0.36
PF16177ACAS_N 0.36
PF01891CbiM 0.36
PF00488MutS_V 0.36
PF02663FmdE 0.36
PF01326PPDK_N 0.36
PF00011HSP20 0.36
PF07610DUF1573 0.36
PF11845DUF3365 0.36
PF11799IMS_C 0.36
PF12706Lactamase_B_2 0.36
PF13386DsbD_2 0.36
PF02142MGS 0.36
PF07969Amidohydro_3 0.36
PF01061ABC2_membrane 0.36
PF13394Fer4_14 0.36
PF07582Obsolete Pfam Family 0.36
PF13230GATase_4 0.36
PF12838Fer4_7 0.36
PF10133CooT 0.36
PF01244Peptidase_M19 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 276 Family Scaffolds
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 2.17
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 2.17
COG2045Phosphosulfolactate phosphohydrolase or related enzymeCoenzyme transport and metabolism [H] 1.45
COG3191L-aminopeptidase/D-esteraseAmino acid transport and metabolism [E] 1.45
COG0389Nucleotidyltransferase/DNA polymerase DinP involved in DNA repairReplication, recombination and repair [L] 1.09
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.72
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 0.72
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.72
COG1322DNA anti-recombination protein (rearrangement mutator) RmuCReplication, recombination and repair [L] 0.72
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 0.72
COG1908Coenzyme F420-reducing hydrogenase, delta subunitEnergy production and conversion [C] 0.72
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 0.72
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.72
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.72
COG4314Nitrous oxide reductase accessory protein NosLInorganic ion transport and metabolism [P] 0.72
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.36
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.36
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 0.36
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.36
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 0.36
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.36
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.36
COG0223Methionyl-tRNA formyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.36
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.36
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 0.36
COG0310ABC-type Co2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.36
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.36
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.36
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.36
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.36
COG0711FoF1-type ATP synthase, membrane subunit b or b'Energy production and conversion [C] 0.36
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 0.36
COG0818Diacylglycerol kinaseLipid transport and metabolism [I] 0.36
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.36
COG1193dsDNA-specific endonuclease/ATPase MutS2Replication, recombination and repair [L] 0.36
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.36
COG1293Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domainsTranslation, ribosomal structure and biogenesis [J] 0.36
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.36
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.36
COG1744Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupNSignal transduction mechanisms [T] 0.36
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.36
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.36
COG1865Adenosylcobinamide amidohydrolaseCoenzyme transport and metabolism [H] 0.36
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 0.36
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.36
COG2109ATP:corrinoid adenosyltransferaseCoenzyme transport and metabolism [H] 0.36
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.36
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.36
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.36
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.36
COG2191Formylmethanofuran dehydrogenase subunit EEnergy production and conversion [C] 0.36
COG2224Isocitrate lyaseEnergy production and conversion [C] 0.36
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.36
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.36
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.36
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.36
COG2367Beta-lactamase class ADefense mechanisms [V] 0.36
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 0.36
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.36
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.36
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.36
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.36
COG4579Isocitrate dehydrogenase kinase/phosphataseSignal transduction mechanisms [T] 0.36
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.36
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.36
COG4856Cyclic di-AMP synthase regulator CdaR, YbbR domainSignal transduction mechanisms [T] 0.36
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.36
COG5561Predicted metal-binding protein, contains CGGC domainFunction unknown [S] 0.36

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.01 %
UnclassifiedrootN/A28.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000242|TDF_OR_ARG05_123mDRAFT_1008647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2699Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1091393Not Available582Open in IMG/M
3300000568|Draft_10666689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3647Open in IMG/M
3300002180|JGI24724J26744_10110942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae965Open in IMG/M
3300003988|Ga0055475_10237099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium579Open in IMG/M
3300004001|Ga0055450_10077143Not Available1173Open in IMG/M
3300004001|Ga0055450_10096501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina1055Open in IMG/M
3300004007|Ga0055476_10215374Not Available666Open in IMG/M
3300004008|Ga0055446_10023520All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1329Open in IMG/M
3300004008|Ga0055446_10163909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria646Open in IMG/M
3300004028|Ga0055447_10137256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae744Open in IMG/M
3300004028|Ga0055447_10145337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium728Open in IMG/M
3300004030|Ga0055444_10013920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2263Open in IMG/M
3300004030|Ga0055444_10335262Not Available587Open in IMG/M
3300004147|Ga0055515_10223548All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005145|Ga0068713_1063169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1317Open in IMG/M
3300005182|Ga0069000_10058289All Organisms → cellular organisms → Bacteria → Proteobacteria887Open in IMG/M
3300005215|Ga0069001_10049803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria973Open in IMG/M
3300005252|Ga0068712_1014938All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae4434Open in IMG/M
3300005254|Ga0068714_10000083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales192981Open in IMG/M
3300005588|Ga0070728_10030373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3780Open in IMG/M
3300005588|Ga0070728_10102706All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300005589|Ga0070729_10177589All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300005589|Ga0070729_10684391All Organisms → cellular organisms → Bacteria → Proteobacteria552Open in IMG/M
3300005589|Ga0070729_10686553All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria550Open in IMG/M
3300005590|Ga0070727_10065526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2140Open in IMG/M
3300005590|Ga0070727_10763232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria542Open in IMG/M
3300005600|Ga0070726_10034039All Organisms → cellular organisms → Bacteria2958Open in IMG/M
3300005600|Ga0070726_10144136All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300005600|Ga0070726_10672528All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005612|Ga0070723_10033186All Organisms → cellular organisms → Bacteria1959Open in IMG/M
3300005612|Ga0070723_10270376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae794Open in IMG/M
3300005825|Ga0074476_1602354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria691Open in IMG/M
3300005920|Ga0070725_10141805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1039Open in IMG/M
3300005920|Ga0070725_10515646All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006467|Ga0099972_10198302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium589Open in IMG/M
3300006467|Ga0099972_10311415All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300006467|Ga0099972_10831869All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria644Open in IMG/M
3300006467|Ga0099972_10860508All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300006467|Ga0099972_11182035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1758Open in IMG/M
3300006467|Ga0099972_11522778Not Available1654Open in IMG/M
3300006467|Ga0099972_11988869All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300006467|Ga0099972_12052977All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300006467|Ga0099972_13021138Not Available953Open in IMG/M
3300006467|Ga0099972_13196808Not Available2064Open in IMG/M
3300006467|Ga0099972_13217760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria952Open in IMG/M
3300007102|Ga0102541_1116523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales840Open in IMG/M
3300007102|Ga0102541_1257603All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300007784|Ga0102955_1004707All Organisms → cellular organisms → Bacteria2837Open in IMG/M
3300007784|Ga0102955_1007868All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300007784|Ga0102955_1034058Not Available1189Open in IMG/M
3300007784|Ga0102955_1047476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae1033Open in IMG/M
3300007784|Ga0102955_1084705All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300007784|Ga0102955_1226591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont541Open in IMG/M
3300009027|Ga0102957_1220086All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300009033|Ga0102956_1001675All Organisms → cellular organisms → Bacteria → Proteobacteria7446Open in IMG/M
3300009033|Ga0102956_1004353All Organisms → cellular organisms → Bacteria4438Open in IMG/M
3300009033|Ga0102956_1025097All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.1824Open in IMG/M
3300009033|Ga0102956_1028312All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300009033|Ga0102956_1231532Not Available622Open in IMG/M
3300009033|Ga0102956_1316701Not Available541Open in IMG/M
3300009079|Ga0102814_10844518Not Available507Open in IMG/M
3300009138|Ga0102959_1094379All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300009145|Ga0102961_1052933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria961Open in IMG/M
3300009145|Ga0102961_1054552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria949Open in IMG/M
3300010330|Ga0136651_10208424All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300010353|Ga0116236_10044653All Organisms → cellular organisms → Bacteria4808Open in IMG/M
3300010392|Ga0118731_100056805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1547Open in IMG/M
3300010392|Ga0118731_100334816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2017Open in IMG/M
3300010392|Ga0118731_100875667Not Available2283Open in IMG/M
3300010392|Ga0118731_101192184All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria702Open in IMG/M
3300010392|Ga0118731_101257581All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2497Open in IMG/M
3300010392|Ga0118731_101264406Not Available511Open in IMG/M
3300010392|Ga0118731_101670985All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300010392|Ga0118731_102004239All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → unclassified Desulfobacter → Desulfobacter sp.1030Open in IMG/M
3300010392|Ga0118731_102311005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1670Open in IMG/M
3300010392|Ga0118731_102565364All Organisms → cellular organisms → Bacteria8515Open in IMG/M
3300010392|Ga0118731_103740915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3441Open in IMG/M
3300010392|Ga0118731_105468616All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.1667Open in IMG/M
3300010392|Ga0118731_105568879Not Available636Open in IMG/M
3300010392|Ga0118731_110042279Not Available837Open in IMG/M
3300010392|Ga0118731_111865635All Organisms → cellular organisms → Bacteria2544Open in IMG/M
3300010392|Ga0118731_112792046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1053Open in IMG/M
3300010392|Ga0118731_114598100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria849Open in IMG/M
3300010392|Ga0118731_114989225Not Available629Open in IMG/M
3300010430|Ga0118733_100100939All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis5825Open in IMG/M
3300010430|Ga0118733_100237818All Organisms → cellular organisms → Bacteria → Proteobacteria3603Open in IMG/M
3300010430|Ga0118733_100403897All Organisms → cellular organisms → Bacteria2707Open in IMG/M
3300010430|Ga0118733_100558485Not Available2276Open in IMG/M
3300010430|Ga0118733_100686026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2040Open in IMG/M
3300010430|Ga0118733_100883976All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300010430|Ga0118733_101221572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 31501Open in IMG/M
3300010430|Ga0118733_101532123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1329Open in IMG/M
3300010430|Ga0118733_101768543All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300010430|Ga0118733_102657453Not Available988Open in IMG/M
3300010430|Ga0118733_103008414All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300010430|Ga0118733_103153753All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300010430|Ga0118733_104259498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria765Open in IMG/M
3300010430|Ga0118733_105238910All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300010430|Ga0118733_106730061Not Available599Open in IMG/M
3300010430|Ga0118733_106798569Not Available596Open in IMG/M
3300010430|Ga0118733_107614759Not Available561Open in IMG/M
3300010430|Ga0118733_108421584Not Available533Open in IMG/M
3300010430|Ga0118733_109449526Not Available502Open in IMG/M
3300013099|Ga0164315_10019168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5407Open in IMG/M
3300013101|Ga0164313_10136995All Organisms → cellular organisms → Bacteria2068Open in IMG/M
(restricted) 3300013138|Ga0172371_10059891All Organisms → cellular organisms → Bacteria3867Open in IMG/M
3300015370|Ga0180009_10058873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2309Open in IMG/M
3300017990|Ga0180436_10670452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria775Open in IMG/M
3300019710|Ga0194009_1034364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria622Open in IMG/M
3300019719|Ga0193977_1024729Not Available708Open in IMG/M
3300019741|Ga0194020_1032071All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300019756|Ga0194023_1092398Not Available610Open in IMG/M
3300021297|Ga0210369_1037246Not Available594Open in IMG/M
3300021511|Ga0190284_1137102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria515Open in IMG/M
3300021514|Ga0190293_1003004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5722Open in IMG/M
3300022201|Ga0224503_10003056All Organisms → cellular organisms → Bacteria4881Open in IMG/M
3300022201|Ga0224503_10016382All Organisms → cellular organisms → Bacteria → Proteobacteria2132Open in IMG/M
3300022201|Ga0224503_10032628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1544Open in IMG/M
3300022201|Ga0224503_10143837All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300022202|Ga0224498_10004791All Organisms → cellular organisms → Bacteria3555Open in IMG/M
3300022202|Ga0224498_10008955All Organisms → cellular organisms → Bacteria2641Open in IMG/M
3300022202|Ga0224498_10080814All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300022206|Ga0224499_10044673Not Available1451Open in IMG/M
3300022206|Ga0224499_10073377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1147Open in IMG/M
3300022206|Ga0224499_10118529Not Available899Open in IMG/M
3300022206|Ga0224499_10125623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria872Open in IMG/M
3300022206|Ga0224499_10214821All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300022217|Ga0224514_10011945All Organisms → cellular organisms → Bacteria2734Open in IMG/M
3300022217|Ga0224514_10012880All Organisms → cellular organisms → Bacteria2644Open in IMG/M
3300022217|Ga0224514_10032690Not Available1714Open in IMG/M
3300022217|Ga0224514_10114969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-15932Open in IMG/M
3300022217|Ga0224514_10152884Not Available811Open in IMG/M
3300022217|Ga0224514_10191746Not Available728Open in IMG/M
3300022217|Ga0224514_10249052All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300022217|Ga0224514_10417986All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria500Open in IMG/M
3300022218|Ga0224502_10009818All Organisms → cellular organisms → Bacteria3474Open in IMG/M
3300022218|Ga0224502_10012710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3068Open in IMG/M
3300022218|Ga0224502_10020841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2426Open in IMG/M
3300022218|Ga0224502_10027602Not Available2110Open in IMG/M
3300022218|Ga0224502_10041637All Organisms → cellular organisms → Bacteria1718Open in IMG/M
3300022218|Ga0224502_10051428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1546Open in IMG/M
3300022218|Ga0224502_10408347Not Available527Open in IMG/M
3300022218|Ga0224502_10428861Not Available514Open in IMG/M
3300022220|Ga0224513_10004528All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis5344Open in IMG/M
3300022220|Ga0224513_10014505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2885Open in IMG/M
3300022220|Ga0224513_10104254Not Available1084Open in IMG/M
3300022220|Ga0224513_10270570All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria674Open in IMG/M
3300022306|Ga0224509_10008557All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales3245Open in IMG/M
3300022306|Ga0224509_10086925All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300022306|Ga0224509_10292754Not Available591Open in IMG/M
3300022308|Ga0224504_10019280All Organisms → cellular organisms → Bacteria2636Open in IMG/M
3300022389|Ga0210318_1047253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria765Open in IMG/M
3300022391|Ga0210374_1051970Not Available752Open in IMG/M
3300022391|Ga0210374_1147515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria514Open in IMG/M
3300022396|Ga0210364_1164343Not Available519Open in IMG/M
3300022552|Ga0212118_10527214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosalsimonadaceae → Desulfosalsimonas → Desulfosalsimonas propionicica622Open in IMG/M
(restricted) 3300023089|Ga0233408_10117409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria578Open in IMG/M
(restricted) 3300023210|Ga0233412_10179550All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria914Open in IMG/M
(restricted) 3300024519|Ga0255046_10292096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300025156|Ga0209834_10273165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosalsimonadaceae → Desulfosalsimonas → Desulfosalsimonas propionicica624Open in IMG/M
3300025561|Ga0210119_1011941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1567Open in IMG/M
3300025561|Ga0210119_1016638Not Available1342Open in IMG/M
3300025561|Ga0210119_1039623All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300025561|Ga0210119_1052409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae → Desulfofustis → Desulfofustis glycolicus776Open in IMG/M
3300025566|Ga0210140_1135933Not Available515Open in IMG/M
3300025583|Ga0210085_1061649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1055Open in IMG/M
3300025599|Ga0210074_1037476All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1367Open in IMG/M
3300025599|Ga0210074_1152296Not Available611Open in IMG/M
3300025950|Ga0210134_1007061All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300025958|Ga0210069_1000233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae10441Open in IMG/M
3300025958|Ga0210069_1002052All Organisms → cellular organisms → Bacteria2555Open in IMG/M
3300025968|Ga0210103_1000883All Organisms → cellular organisms → Bacteria5801Open in IMG/M
3300025968|Ga0210103_1003598All Organisms → cellular organisms → Bacteria2829Open in IMG/M
3300025969|Ga0210080_1000610All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis4103Open in IMG/M
3300025984|Ga0210082_1011758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1328Open in IMG/M
3300025991|Ga0210128_1012793All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300026059|Ga0208540_1001859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1956Open in IMG/M
3300026106|Ga0209927_1012415All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300026126|Ga0209957_1003204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3714Open in IMG/M
3300026126|Ga0209957_1006329All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis2655Open in IMG/M
3300026131|Ga0209928_1050405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1628Open in IMG/M
3300027536|Ga0209163_1090829Not Available778Open in IMG/M
3300027592|Ga0209270_1003663All Organisms → cellular organisms → Bacteria → Proteobacteria12900Open in IMG/M
3300027592|Ga0209270_1040556All Organisms → cellular organisms → Bacteria1700Open in IMG/M
3300027690|Ga0209164_1000236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria167696Open in IMG/M
3300027758|Ga0209379_10041310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1796Open in IMG/M
3300027790|Ga0209273_10077826Not Available1490Open in IMG/M
3300027790|Ga0209273_10089432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1371Open in IMG/M
3300027820|Ga0209578_10040226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2432Open in IMG/M
3300027828|Ga0209692_10230972Not Available838Open in IMG/M
3300027828|Ga0209692_10373008Not Available615Open in IMG/M
3300027845|Ga0209271_10010599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3622Open in IMG/M
3300027845|Ga0209271_10035528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont2063Open in IMG/M
3300027858|Ga0209013_10059655All Organisms → cellular organisms → Bacteria2634Open in IMG/M
3300027858|Ga0209013_10107635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1812Open in IMG/M
3300027917|Ga0209536_100372711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1784Open in IMG/M
3300027917|Ga0209536_100661248All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300027917|Ga0209536_101193248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium933Open in IMG/M
(restricted) 3300028045|Ga0233414_10554420All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300028420|Ga0210366_10227579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae720Open in IMG/M
3300028598|Ga0265306_10781781Not Available529Open in IMG/M
3300028600|Ga0265303_10253299Not Available1363Open in IMG/M
3300032231|Ga0316187_10050911All Organisms → cellular organisms → Bacteria3308Open in IMG/M
3300032231|Ga0316187_10063857All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis2917Open in IMG/M
3300032231|Ga0316187_10071658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2738Open in IMG/M
3300032231|Ga0316187_10243836Not Available1380Open in IMG/M
3300032231|Ga0316187_10413539All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1018Open in IMG/M
3300032231|Ga0316187_10575473Not Available840Open in IMG/M
3300032231|Ga0316187_10739843Not Available727Open in IMG/M
3300032231|Ga0316187_10933270Not Available638Open in IMG/M
3300032231|Ga0316187_11418152Not Available506Open in IMG/M
3300032251|Ga0316198_10284228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria940Open in IMG/M
3300032251|Ga0316198_10489201All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300032252|Ga0316196_10055699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera → unclassified Leisingera → Leisingera sp. ANG-M11858Open in IMG/M
3300032252|Ga0316196_10132292Not Available1144Open in IMG/M
3300032252|Ga0316196_10158233Not Available1028Open in IMG/M
3300032252|Ga0316196_10164188All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300032252|Ga0316196_10193429Not Available910Open in IMG/M
3300032258|Ga0316191_10056504All Organisms → cellular organisms → Bacteria2900Open in IMG/M
3300032258|Ga0316191_10116703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1953Open in IMG/M
3300032258|Ga0316191_10191395Not Available1493Open in IMG/M
3300032258|Ga0316191_10355091All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis1067Open in IMG/M
3300032258|Ga0316191_10375906All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300032258|Ga0316191_10403755Not Available995Open in IMG/M
3300032258|Ga0316191_10478179All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria906Open in IMG/M
3300032258|Ga0316191_10503107Not Available881Open in IMG/M
3300032258|Ga0316191_10532409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium855Open in IMG/M
3300032258|Ga0316191_10593462Not Available805Open in IMG/M
3300032258|Ga0316191_11194091Not Available550Open in IMG/M
3300032258|Ga0316191_11367482Not Available511Open in IMG/M
3300032259|Ga0316190_10082547All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2263Open in IMG/M
3300032259|Ga0316190_10422254Not Available904Open in IMG/M
3300032259|Ga0316190_11115716Not Available514Open in IMG/M
3300032260|Ga0316192_10153001Not Available1609Open in IMG/M
3300032260|Ga0316192_10258940Not Available1201Open in IMG/M
3300032260|Ga0316192_10272692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1166Open in IMG/M
3300032260|Ga0316192_10425404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium907Open in IMG/M
3300032260|Ga0316192_10441210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria889Open in IMG/M
3300032260|Ga0316192_10598137Not Available747Open in IMG/M
3300032260|Ga0316192_10614882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium735Open in IMG/M
3300032260|Ga0316192_10725864Not Available669Open in IMG/M
3300032260|Ga0316192_10832236Not Available620Open in IMG/M
3300032260|Ga0316192_10973314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont568Open in IMG/M
3300032260|Ga0316192_11074820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria537Open in IMG/M
3300032262|Ga0316194_10031150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3547Open in IMG/M
3300032262|Ga0316194_10180001Not Available1356Open in IMG/M
3300032262|Ga0316194_10181971Not Available1348Open in IMG/M
3300032263|Ga0316195_10066753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1858Open in IMG/M
3300032263|Ga0316195_10147845Not Available1229Open in IMG/M
3300032263|Ga0316195_10402305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria725Open in IMG/M
3300032272|Ga0316189_10046921Not Available3714Open in IMG/M
3300032272|Ga0316189_10069710All Organisms → cellular organisms → Bacteria2936Open in IMG/M
3300032272|Ga0316189_10107918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2263Open in IMG/M
3300032272|Ga0316189_10153963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1838Open in IMG/M
3300032272|Ga0316189_10214159Not Available1519Open in IMG/M
3300032272|Ga0316189_10229979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1458Open in IMG/M
3300032272|Ga0316189_10283647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1293Open in IMG/M
3300032272|Ga0316189_10405537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1055Open in IMG/M
3300032272|Ga0316189_10753044Not Available742Open in IMG/M
3300032272|Ga0316189_11524088Not Available503Open in IMG/M
3300032276|Ga0316188_10113812All Organisms → cellular organisms → Bacteria → Proteobacteria1329Open in IMG/M
3300032276|Ga0316188_10138346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum1208Open in IMG/M
3300032276|Ga0316188_10220453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria962Open in IMG/M
3300032276|Ga0316188_10248317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria908Open in IMG/M
3300033429|Ga0316193_10017064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium5565Open in IMG/M
3300033429|Ga0316193_10262037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1371Open in IMG/M
3300033429|Ga0316193_10280471All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300033429|Ga0316193_10606218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria872Open in IMG/M
3300033429|Ga0316193_11045228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria649Open in IMG/M
3300033429|Ga0316193_11621111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont513Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow17.75%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment14.86%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment13.04%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine10.51%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands10.51%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment7.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.25%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.90%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture2.54%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.09%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.09%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.09%
Marine Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent1.09%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine1.09%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.72%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat0.72%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.72%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.72%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.72%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.72%
Marine SedimentEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.36%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.36%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.36%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.36%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.36%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.36%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.36%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.36%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300000568Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:EngineeredOpen in IMG/M
3300002180Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7EnvironmentalOpen in IMG/M
3300003988Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2EnvironmentalOpen in IMG/M
3300004001Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1EnvironmentalOpen in IMG/M
3300004007Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2EnvironmentalOpen in IMG/M
3300004008Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2EnvironmentalOpen in IMG/M
3300004028Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2EnvironmentalOpen in IMG/M
3300004030Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2EnvironmentalOpen in IMG/M
3300004147Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2EnvironmentalOpen in IMG/M
3300005145Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaGEngineeredOpen in IMG/M
3300005182Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2EnvironmentalOpen in IMG/M
3300005215Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2EnvironmentalOpen in IMG/M
3300005252Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaGEngineeredOpen in IMG/M
3300005254Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaGEngineeredOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005825Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBBEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300007102Combined Assembly of Marine Sediment Inoculum and EnrichmentsEngineeredOpen in IMG/M
3300007784Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MGEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009033Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009138Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MGEnvironmentalOpen in IMG/M
3300009145Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MGEnvironmentalOpen in IMG/M
3300010330Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaGEnvironmentalOpen in IMG/M
3300010353AD_USCAcaEngineeredOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013138 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12mEnvironmentalOpen in IMG/M
3300014312Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1EnvironmentalOpen in IMG/M
3300015370Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaGEnvironmentalOpen in IMG/M
3300017990Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaGEnvironmentalOpen in IMG/M
3300019710Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_5-6_MGEnvironmentalOpen in IMG/M
3300019719Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_4-5_MGEnvironmentalOpen in IMG/M
3300019741Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_6-7_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300021297Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021351Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021511Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-1-2_MGEnvironmentalOpen in IMG/M
3300021514Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MGEnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022389Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022391Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022396Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022552Guaymas_combined assemblyEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025156Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025561Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025566Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025583Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025599Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025950Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025958Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025968Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025969Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025984Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025991Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026059Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026106Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026126Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026131Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027536Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027592Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027690Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028420Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032259Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2EnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TDF_OR_ARG05_123mDRAFT_100864723300000242MarineMPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEISISNA*
TDF_OR_ARG05_123mDRAFT_109139313300000242MarineMPAKAGIQNHLKILDSRLRGNDAKGGFKTFYETIKN*
Draft_1066668913300000568Hydrocarbon Resource EnvironmentsIQNILKTLDSGLRRNDAKLEFSTFYETIKYGSLMR*
JGI24724J26744_1011094213300002180MarinePAKAGIQNHLKLLDSRLRGNDVKGRFKTLCETISI*
Ga0055475_1023709923300003988Natural And Restored WetlandsMPAKAGIQNYFKTLDSRLRGNDVKKRFKTFYETVNIGFLQTTI*
Ga0055450_1007714323300004001Natural And Restored WetlandsMAAKAGIQKYLKTLDSRIRGNDVKGRFKTFYETIKIEDLCQSLRSA
Ga0055450_1009650133300004001Natural And Restored WetlandsNSVMPAKAGIKNYLKTLDSCLRRHDAKGRFKAFYKTINSSLSK*
Ga0055476_1021537423300004007Natural And Restored WetlandsMPAKAGIQNHLKILDSRLRGNDVKGRFKTFYETITSGGHKNNA*
Ga0055446_1002352023300004008Natural And Restored WetlandsMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYQTINLGAPSNH*
Ga0055446_1016390923300004008Natural And Restored WetlandsMPAKVGIQKYLKTLDSRLRGNDAKGYFKTFCEFVNLEPRNFGTEF*
Ga0055447_1013725623300004028Natural And Restored WetlandsMPAKAGIQNYLETLGSRLRGNDVKGRFKTFYETINLQFTIPR*
Ga0055447_1014533723300004028Natural And Restored WetlandsMPAKAGIQNYLISLGSRLRGNDAKGHFKTFYETIIVGRLMFIF*
Ga0055444_1001392023300004030Natural And Restored WetlandsMPAKAGIKNYLKTLDSCLRRHDAKGRFRAFYKTINSSLSK*
Ga0055444_1033526223300004030Natural And Restored WetlandsMPAKAGIQNYLISLDSRLRGNDAKGVFKTFYETINLKSSIIMGAPNG*
Ga0055515_1022354823300004147Natural And Restored WetlandsRNSVMPAKAGIQNHLKILDSRLRGNDVKGRFKTFYETITSGGHKNNA*
Ga0068713_106316923300005145Enrichment CultureMPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYETIKYGAHKI*
Ga0069000_1005828923300005182Natural And Restored WetlandsMPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETINVGRLMFIF*
Ga0069001_1004980313300005215Natural And Restored WetlandsMPAKAGIQNYLETLGSRLRGNDVKGRFKIFYETINLQFTIPR*
Ga0068712_101493883300005252Enrichment CultureMPAKAGIQNHLKSLDSRLRGNDAKGVFSTYYETIKSFIFNI*
Ga0068714_100000831643300005254Enrichment CultureMPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYKTIKYGAHKI*
Ga0070728_1003037343300005588Marine SedimentMPAKAGIQKHLKTLGFRLHGNDAKGRFETFYESINIEFSISYA*
Ga0070728_1010270613300005588Marine SedimentVMPAKAGIQNYLKTLDSRLRENDAKGRFKTFYETISL*
Ga0070729_1017758923300005589Marine SedimentMPAKAGIQNYLKTLDSRLRENDAKGRFKTFYETISL*
Ga0070729_1068439123300005589Marine SedimentMPAKAGIQNYLKTLDSGLRGNDVKGRFKTFYETIINKTG*
Ga0070729_1068655313300005589Marine SedimentSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINI*
Ga0070727_1006552623300005590Marine SedimentMPAKAGIQKHLKTLDFRLHGNDAKGRFETFYESINIEFSISYA*
Ga0070727_1076323213300005590Marine SedimentMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIILAKV
Ga0070726_1003403923300005600Marine SedimentMPAKAGIQKHLKTLGFRLRGNDAKGRFETFYESINIEFSISYA*
Ga0070726_1014413623300005600Marine SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIN
Ga0070726_1067252813300005600Marine SedimentKVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGCFKTFYETINPLL*
Ga0070723_1003318633300005612Marine SedimentMPGKAGIQNYLKTLGSRLRGNDAKGRFKTFFNFVIIFYNSG*
Ga0070723_1027037623300005612Marine SedimentSVMPAKAGIQNYLKTLDSRLRGNDVKGRFKAFYETIKTF*
Ga0074476_160235423300005825Sediment (Intertidal)MPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIFFEY*
Ga0070725_1014180523300005920Marine SedimentMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIIMDQNP*
Ga0070725_1051564623300005920Marine SedimentQNYLKTLDSRFRENDVKGRFKTFYETINIESHPMPE*
Ga0099972_1019830223300006467MarineIQNYLKTLDSRLRGNDAKGGFKTFYETINLRSSIPACPGWV*
Ga0099972_1031141513300006467MarineMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFNEAIKID
Ga0099972_1083186913300006467MarineMHAPAGIQKHLKILDFRLRGNDAKGGFKTFYETINI
Ga0099972_1086050823300006467MarineMPATAGIQNHLNILDSRLRGNDAKGGFKTFYETINTSV*
Ga0099972_1118203523300006467MarineMPAKAGIQNYLKKLDSRLRGNDAKGRFKTFYETIKFQYDM*
Ga0099972_1152277823300006467MarineMPAKAGIQNHLKILDSRLRGYDDKVGFKTFYETFNIDILND
Ga0099972_1198886923300006467MarineMPAKAGIQNYLKTLDSRLSGNDAKGRFKTFYETINVGR
Ga0099972_1205297713300006467MarineMPAKAGIQNYLKTLDSRLRGNDAKGCFKTFYETIKFRILIFFGI*
Ga0099972_1302113823300006467MarineVRNSVMPAKAGIQNHLKILDSRLRGIDAKGGFKTFYETIKTQIQNRL*
Ga0099972_1319680813300006467MarineMPAKADIQSYLKTLDSRLRENDAKGCFKAFYETINVGR
Ga0099972_1321776013300006467MarineMPVKAGIQNHLKILDSRLRRNDAKGDFKTFYETINIENYLYFGA*
Ga0102541_111652313300007102Marine SedimentMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETINVGL
Ga0102541_125760313300007102Marine SedimentMPAKAGIQNYLKKLYSRLRGNDVKGRFKTFYETINIQFRLIRIKTP
Ga0102955_100470713300007784SoilGIQNYLKILDSRLRGNDAKGHFKTFYETINVGRLMFIF*
Ga0102955_100595313300007784SoilNSVMPAKAGIQNYLKTLDSRLRGNDAKGVFKTFYDTINLKSSIIMGAPDG*
Ga0102955_100786833300007784SoilMPAKAGIQNYLKTLDSSLRGNDVKGRFKAFYETTTLNIE*
Ga0102955_103405813300007784SoilVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL*
Ga0102955_104747613300007784SoilSVMPAKAGIQNYLKTLDSRLRGNDVKGRIKPFTKPSNFK*
Ga0102955_108470513300007784SoilMPAKAGIQKYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF*
Ga0102955_122659113300007784SoilMPAKAGIQNYLKTLDSRLRGNDAKGRFKISYETINIRRSMLEV
Ga0102957_122008613300009027Pond WaterAGIQNYLKTLDSRLRGNDVKGRFKTFYETIKIGPHDKIAGQFLI*
Ga0102957_132889113300009027Pond WaterMPAKAGIQNYLKILDSRLRGNDVEGRFKTFYETISVECSMLDVHLPS
Ga0102956_100167593300009033SoilMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFRGKFV
Ga0102956_100435343300009033SoilMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFEILN*
Ga0102956_102509733300009033SoilMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINVEHRIMLSLRS
Ga0102956_102831223300009033SoilMPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINC*
Ga0102956_123153213300009033SoilKVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF*
Ga0102956_131670133300009033SoilMPAKAGIQNYLKTLDSCLRGHDAKGRFKTFYETINVV
Ga0102814_1084451813300009079EstuarineMPAKAGIQNYSKTLDSRLRGNDAKGRFKTYYETSRLQIEYPRNATDLN*
Ga0102959_109437913300009138SoilMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYESINIDDTTLYRYLQDY*
Ga0102961_105293313300009145SoilRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKIYYETINVLDA*
Ga0102961_105455213300009145SoilMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIN
Ga0136651_1020842423300010330Marine Hydrothermal VentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENIIY*
Ga0116236_1004465343300010353Anaerobic Digestor SludgeMPTKAGIQNILKCLASRLRGNDKEDDSSTFYETIKMAIYEY*
Ga0118731_10005680523300010392MarineMPAKAGIQNYLKTLGSRLRGNDVKGRFKTFYKTINLQFTIPR*
Ga0118731_10033481613300010392MarineMPAKAGIQNYLISLGSRLRGNDAKGRFKTFYEAINIDDATLYLF*
Ga0118731_10087566723300010392MarineMPAKAGIQNYLKILDSRLRGNDAKGGFKIFYETIKVKY*
Ga0118731_10119218423300010392MarineMPAKAGIQKYLKTLNSRLRGNDAKGRFETFYESINIEISISNA*
Ga0118731_10125758113300010392MarineVRNSVMPAKAGIQNYLKILDSRLRGNDVKGCFKTYYETI*
Ga0118731_10126440613300010392MarineMPAKAGIQNYLKTLGSRLRGNDVKGRFKTFYETIKLE
Ga0118731_10167098533300010392MarineMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINV
Ga0118731_10200423913300010392MarineMPAKAGIQNYLKTLDFRLRGNDVKRRFKIYYGNINFSIRNIELNQEI*
Ga0118731_10231100533300010392MarineMPAKAGIQNHLIILDSRLRGNDAKGGFKTFYETINYRIKKSV*
Ga0118731_10256536423300010392MarineMPAKAGIQNHLKILDSRLRGKDAKGGFKTFYETINPEP*
Ga0118731_10374091513300010392MarineIPAKAGIQNYLKTLDSRLRGNDAKRRFKTFYGTFNII*
Ga0118731_10546861633300010392MarineMPAKAGIQNHLKILDSRLRGNDAKEGFKTFYETINVRDKTAWDC*
Ga0118731_10556887923300010392MarineGIQNYLKTLDLRFRENDVKGRFKTFYETINIESHPMPE*
Ga0118731_11004227933300010392MarineMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKG*
Ga0118731_11186563523300010392MarineMPAKAGIQNHLKILDSRLRGKDAKGGFKTFYETINDQ*
Ga0118731_11279204613300010392MarineMPAKAGIQNHLKILDSRLRGNDAKGGFKTYYETITLDSL*
Ga0118731_11459810023300010392MarineMPAKAGIQKYLKTLDSRLRGNDAKGRFETFNESINIEFSISNAQIF*
Ga0118731_11498922513300010392MarineMPAKAGIQKYLKTLDSRLRGNDAKGHFKTIYESIN
Ga0118733_10010093953300010430Marine SedimentMPAKAGIQNYLKILDSRLRGNDVKGGFKTFYETINIEIWNLFVF*
Ga0118733_10023781853300010430Marine SedimentMPAKAGIQNHLKILDSRLRGNNAKGGLKTFYETIKN*
Ga0118733_10040389713300010430Marine SedimentMPAKAGIQNYLKTLDFRLRGNDAKRRFKTFYGTIKIGCS
Ga0118733_10055848523300010430Marine SedimentMPAKAGIQNHLKILDSRLRGNDTKEGFKTFYETIII*
Ga0118733_10068602623300010430Marine SedimentMPAKAGIQNYLKILDSRLRGHDVKGRIKTFYDIIKII*
Ga0118733_10088397613300010430Marine SedimentMPAKAGIQNHLKILDSRLRGNDAKEGFKTFYETIN
Ga0118733_10122157213300010430Marine SedimentMPAKAGIQNYLKVLDSRLRGNDAKGGFKAFYETIKSKI*
Ga0118733_10153212333300010430Marine SedimentMPAKAGIQNHLKILDSRLRGNDAKGGFKTFYETINIQ*
Ga0118733_10176854323300010430Marine SedimentMPAKAGIQNYLKILDSRLRGNDVKGRFKTFYKTIYL*
Ga0118733_10265745323300010430Marine SedimentMPAKAGIQNYLNTLDSRLRGNDANGRFKTFYETINV
Ga0118733_10300841413300010430Marine SedimentPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINPIP*
Ga0118733_10315375313300010430Marine SedimentKAGIQNYLKTLGSRLRGNDVKGRFKTFYKTINLQFTIPR*
Ga0118733_10425949823300010430Marine SedimentMPAKAGIQKYLKTLDSRLRGNDAKGRFETFNESINIEFSISNA*
Ga0118733_10523891023300010430Marine SedimentSVLPAKAGIQNYLKTLDFRLRGNDAKGRFKTFYETINIDDATLYRL*
Ga0118733_10673006113300010430Marine SedimentNSVMSAKAGIQKYLKTLDSRLRGNDVKGRIKTLYETIKFGI*
Ga0118733_10679856913300010430Marine SedimentMPAKAGIQDYLKTLDSRLRGNDVKGRIKTFYETIKFGI*
Ga0118733_10761475913300010430Marine SedimentMHAKAGIQNYLKILDSRLRGNDAKGGFKTFYETIKIPSTKTRISN
Ga0118733_10842158413300010430Marine SedimentMPAKADIQNYLKTLDSRLRGNDAKGRFKTFYETINF
Ga0118733_10944952623300010430Marine SedimentAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKIEN*
Ga0164315_1001916833300013099Marine SedimentMPAKAGIQKRLKILDSRLRGNDTNGRFQTFYEGIIVNRNK*
Ga0164313_1013699513300013101Marine SedimentLTDSQKVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENIIY*
(restricted) Ga0172371_1005989143300013138FreshwaterMPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYETIIIGDGHAA*
Ga0075345_105072913300014312Natural And Restored WetlandsPAKAGVHNMLRLLDSRFRGNDEKGAFKTFYETISIEI*
Ga0180009_1005887323300015370GroundwaterMPAKAGIQPRFSVVKSLDSRLRGNDNKGAFPTFYETIITLKN*
Ga0180436_1067045223300017990Hypersaline Lake SedimentMPAKAGIQKYMNLLDYRLRGNDAGRQFPTFYRKEN
Ga0194009_103436423300019710SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQSSFVIPL
Ga0193977_102472923300019719SedimentMPAKAGIQNYLNTLDSRLRGNDAKGVFKTFYETINLKSSIIMGSPDG
Ga0194020_103207113300019741SedimentMPAKADIQNYLKSLDSRLRGNDVKGRFRTYYETIKINFRSRISAGVN
Ga0194023_109239813300019756FreshwaterMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKSDIPKKG
Ga0210369_103724613300021297EstuarineMPAKAGIQNSLKTLDCRIRGNDAKGRFKTFYENIKIPLAIGFIQR
Ga0210365_1063110523300021351EstuarineMPAKAGIQNHLKILDSRLRGNDVKGRFKAFYETIKINYSFHDPSIWWYT
Ga0190284_113710213300021511Hydrothermal Vent Microbial MatMPAKAGIQKYLNILDSRLRGNDAKERFETFYDFVNIQ
Ga0190293_100300423300021514Hydrothermal Vent Microbial MatMPAKAGIQKRLKILDSRLRGNDTNGRFQTFYEGIIVNRNK
Ga0224503_1000305673300022201SedimentMPAKAGIQKYLKTQDFRLRGNDAKGRFKTFYETINIGRSMFAFTVPAT
Ga0224503_1001638213300022201SedimentMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINIDYATLY
Ga0224503_1003262823300022201SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL
Ga0224503_1014383713300022201SedimentRNSVMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYESINIDDTTLYRYLQDY
Ga0224498_1000479133300022202SedimentMPAKAGIQNYLKTLDSSLRGNDVKGRFKAFYETTTLNIE
Ga0224498_1000895533300022202SedimentMPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETINVGRLMFIF
Ga0224498_1008081423300022202SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF
Ga0224499_1004467333300022206SedimentMPAKAGIQNYLETLGSRLRGNDVKGRFKTFYETINLQFTIPR
Ga0224499_1007337713300022206SedimentKVRNSVMPAKAGIQNYLISLDSRLRGNDAKGGFKTFYETINTD
Ga0224499_1011852913300022206SedimentVMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYDTINIDDATLYRF
Ga0224499_1012562323300022206SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIE
Ga0224499_1021482123300022206SedimentMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYESINIDDATLYRYLQDY
Ga0224514_1001194513300022217SedimentMPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETIIVGRLMFIF
Ga0224514_1001288023300022217SedimentMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYDTINIDDATLYRF
Ga0224514_1003269023300022217SedimentMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINIDYATLYRF
Ga0224514_1011496923300022217SedimentAKAGIQNYLKTLDSRLRGNDAEGRFKTFYETIKLSLAKSLES
Ga0224514_1015288423300022217SedimentMPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETIN
Ga0224514_1019174613300022217SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKIFYQTIQFGPTRKRG
Ga0224514_1024905223300022217SedimentMPAKAGIQNYLKTLDSCLRGNDVKGRFKTFYETII
Ga0224514_1041798623300022217SedimentMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETIKVGL
Ga0224502_1000981833300022218SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQHSICSRCQPA
Ga0224502_1001271033300022218SedimentMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINF
Ga0224502_1002084143300022218SedimentKVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKIYYETINVLDA
Ga0224502_1002760233300022218SedimentMPAKAGIQNYLKTLDSRLRGNDAKGVFKTFYDTINLKSSIIMGSPDG
Ga0224502_1004163713300022218SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYEGINFKFC
Ga0224502_1005142813300022218SedimentKVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFQTFYDTINIDDATLYRF
Ga0224502_1040834723300022218SedimentMLAKAGIQNYLKTLDSRIRGNDAKGRFKIFYETINIQ
Ga0224502_1042886123300022218SedimentLTNPQKARNSVMPAKAGIQKYLKTLGSRLHGNDVKGCIKTFYETIIIYY
Ga0224513_1000452843300022220SedimentMPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINC
Ga0224513_1001450513300022220SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIRRSIC
Ga0224513_1010425423300022220SedimentAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL
Ga0224513_1027057023300022220SedimentMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFEILN
Ga0224509_1000855753300022306SedimentMPAKADIQSYLKTLDSRLRENDAKGRFKAFYETINVDNFVKSR
Ga0224509_1008692523300022306SedimentRNSVMPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINLER
Ga0224509_1029275423300022306SedimentPAKVGIQNYLKTLDSRLRGNDAKGRFKTFYDTINF
Ga0224504_1001928013300022308SedimentMPAKAGIQKYLKTPGYRLRRNDVKGRFKTIYESIKFERLKMI
Ga0210318_104725313300022389EstuarineMPAKAGIQNYLKTLDSRLRGNDAKGLFETFYGTIRVKYYKFMHF
Ga0210374_105197023300022391EstuarineMPAKAGIQNYFKTLDSRLRGNDVKGRFKTIYKTSKFRKKESREIP
Ga0210374_114751523300022391EstuarineMAAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIN
Ga0210364_116434313300022396EstuarineMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKINPNNIFV
Ga0212118_1052721423300022552Marine Hydrothermal VentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENII
(restricted) Ga0233408_1011740923300023089SeawaterMLAKADIQKYLKTLTSRLGGNDAKGRFETFYEFSNIDKPV
(restricted) Ga0233412_1017955023300023210SeawaterMPAKAGIQKYLKTLDSRLRGNDAKGRFETFYESINIEISISNA
(restricted) Ga0255046_1029209613300024519SeawaterMPAKAGIQNYLKTLDSRLRENDAKGRFKTFYETISL
Ga0209834_1027316523300025156Marine Hydrothermal VentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYENIIY
Ga0210119_101194133300025561Natural And Restored WetlandsMPVKAGIQNYLKTLDSRLRGNDAKGVFKTFYDTINLKSSIIMGAPDG
Ga0210119_101663813300025561Natural And Restored WetlandsAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINIDYATLYRF
Ga0210119_103962313300025561Natural And Restored WetlandsVMPAKAGIQNYLKTLDSRLRGSDAKGCFKTFYETINLER
Ga0210119_105240913300025561Natural And Restored WetlandsMPAKAGIQNYLKTLDSRLRRNDAKGRFKTFYETINLQYSFPFFPV
Ga0210140_113593313300025566Natural And Restored WetlandsMPAKAGIQNYLKKLYSRLRGNDAKGRFKTFYEGIKN
Ga0210085_106164943300025583Natural And Restored WetlandsNSVMPAKAGIKNYLKTLDSCLRRHDAKGRFKAFYKTINSSLSK
Ga0210074_103747623300025599Natural And Restored WetlandsPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYQTINLGAPSNH
Ga0210074_115229613300025599Natural And Restored WetlandsMPAKAGIQNYLISLDSRLRGNDAKGVFKTFYETINLKSSIIMGAPNG
Ga0210134_100706113300025950Natural And Restored WetlandsAKAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIQFSSIF
Ga0210069_1000233123300025958Natural And Restored WetlandsKAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIAI
Ga0210069_100205213300025958Natural And Restored WetlandsAKAGVHNMLRLLDSRFRGNDEKGAFKTFYETIKVGF
Ga0210103_100088353300025968Natural And Restored WetlandsKAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIQFSSIF
Ga0210103_100359833300025968Natural And Restored WetlandsKAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIGIIE
Ga0210080_100061013300025969Natural And Restored WetlandsVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIRKGGRL
Ga0210082_101175833300025984Natural And Restored WetlandsMPAKAGIQNHLKILDSRLRGNDVKERFKAFYETINVD
Ga0210128_101279343300025991Natural And Restored WetlandsMPAKAGIQNYLISLDSRLRGNDAKGVFKTFYETINLKSSIIMG
Ga0208540_100185933300026059Natural And Restored WetlandsAGVHNMLRLLDSRFRGNDEKGAFKTFYETINIRPSTFKYF
Ga0209927_101241513300026106SoilKVRNSVMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINFEILN
Ga0209957_100320463300026126SoilMPVKAGIQNYLKTLDSRLRGNDAKGVFKTFYETINHE
Ga0209957_100632913300026126SoilARNSVMPAKAGIQNYLKTLDSRLRGNDAKGCFKTFYETINC
Ga0209928_105040513300026131SoilMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIDIQRSM
Ga0209163_109082923300027536Enrichment CultureMPAKAGIQNHMKSLDSRLRGNDAKGVFSTFYETITVDHPGRYGFM
Ga0209270_1003663183300027592Enrichment CultureMPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYETIKYGAHKI
Ga0209270_104055643300027592Enrichment CultureGIQNHPKSLDSRLRGNDGYGTFSTFYETIKDASFTF
Ga0209164_10002361433300027690Enrichment CultureMPAKAGIQNHLKSLDSRLRGNDAKGVFSTFYKTIKYGAHKI
Ga0209379_1004131023300027758Marine SedimentMPAKAGIQKYLKTLDSRLRGNDAKGRFETFYESINIEFSISYA
Ga0209273_1007782613300027790Marine SedimentMPAKAGIQNYLKTLDSRLRGNDAKGHFKTFYETINVGRSMFIF
Ga0209273_1008943223300027790Marine SedimentMPAKAGIQKHLKTLGFRLRGNDAKGRFETFYESINIEFSISYA
Ga0209578_1004022623300027820Marine SedimentMPAKAGIQKHLKTLGFRLHGNDAKGRFETFYESINIEFSISYA
Ga0209692_1023097223300027828Marine SedimentMPAKAGIQNYLISLDSRLRGNDAKGAFKTFYETINIE
Ga0209692_1037300823300027828Marine SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQSS
Ga0209271_1001059933300027845Marine SedimentMPAKAGIQKHLKTLDFRLHGNDAKGRFETFYESINIEFSISYA
Ga0209271_1003552833300027845Marine SedimentAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIKVNRWTFLAI
Ga0209013_1005965513300027858MarineAKAGIQKCLKILDSRLRGNDANGRFQTFYEGIIFIK
Ga0209013_1010763543300027858MarineMPAKAGIQNYLKLLDSRLRGNDGKGRFKTFYETIN
Ga0209536_10037271123300027917Marine SedimentMPAKADIQNYLKLLDSRLRGKDTKRGFKAFYEAIKL
Ga0209536_10066124813300027917Marine SedimentMPAKAGIQKYLKTLDSRLRRNDVKGRFKAFYKTIN
Ga0209536_10119324833300027917Marine SedimentMPAKAGIQKYLKILDSRLRGNDAKGRFKTFYETINIVDATLYRF
(restricted) Ga0233414_1055442023300028045SeawaterMPAKAVQNYLKTLDSRLHGNDVKGRFKTFYETIKIGSMLNTNVANVE
Ga0210366_1022757913300028420EstuarineMPAKAGIQNYLKTLDCRLRGNDTKGRFKTFYETIKIRCW
Ga0265306_1078178123300028598SedimentMPAKAGIQNYLKILDSRLRGDDVKGRIKTFYETIKIE
Ga0265303_1025329923300028600SedimentAKAGIQNLLKILDSRLRGNDAKGGFKTFYETINIP
Ga0316187_1005091123300032231Worm BurrowMPAKAGIQKYLKTLNSRLRWNEVKGRFKTFYETINI
Ga0316187_1006385713300032231Worm BurrowMPAKAGIQNYLKTLDSSLLGNDVKGRFKAFYETTTLNIE
Ga0316187_1007165833300032231Worm BurrowMPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEISISNA
Ga0316187_1024383613300032231Worm BurrowMPAKAGIQNYLKTLDTCLRGNDLKKRIKAFYETIKISN
Ga0316187_1041353913300032231Worm BurrowMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETISIVS
Ga0316187_1057547313300032231Worm BurrowKVRNSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL
Ga0316187_1073984323300032231Worm BurrowMPAKAGIQNYLKTLGSRIRGNDVKGRFKTFYETIKIEIKI
Ga0316187_1093327023300032231Worm BurrowMPAEAGIQNYLKTLDSRLRGNDVKGRFKTFCEGIKL
Ga0316187_1141815213300032231Worm BurrowMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIRRSVL
Ga0316198_1028422823300032251SedimentIPAKVGIQNYLKTLDSRLRGNDAKGRFKTFYETIKIAP
Ga0316198_1048920113300032251SedimentIQKYLKTLDSRLRGNDAKGRFKTFYETIRFDGLTFPG
Ga0316196_1005569923300032252SedimentMPAKAGIQNYLKILDSRLRGNDTKGRFKIYYETINVLDA
Ga0316196_1013229223300032252SedimentMPAKAGIQNYLETLGSRLRGHDVKGRFKTFYETIYLQFTIPR
Ga0316196_1015823333300032252SedimentMLAKAGIQNYLKTLDSRIRGNDAKGRFKIFYETINIQSS
Ga0316196_1016418823300032252SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYDTINVEHRIMMSLRSAI
Ga0316196_1019342913300032252SedimentMPAKAGIQNYLKKLDSRLRGNDAKGRFKTFYEPINIQFRFI
Ga0316196_1046633823300032252SedimentMPAKAGIHSFLKTLDFRLRGNDAKGGFKTFNETINVGRSIFILKKTC
Ga0316191_1005650433300032258Worm BurrowMPAKAGIQNYLISLGSRLRGNDAKGHFKTFYETIIVGRLMFIF
Ga0316191_1011670313300032258Worm BurrowKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINVHL
Ga0316191_1019139513300032258Worm BurrowMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETINK
Ga0316191_1035509143300032258Worm BurrowNYLKTLDSRLRGNDAKGRFKTFYETINIKCYFKPG
Ga0316191_1037590613300032258Worm BurrowMPAKASIQNYLKTLDSHLRGKDAKGRFKTFYEAINSYTRTRT
Ga0316191_1040375533300032258Worm BurrowKVRNSVMPAKVGIQNYLKTLDSRLRGNDAKGVFKTFYETIN
Ga0316191_1047817923300032258Worm BurrowMPAKSGIQKYLKTLDSRLRGNDTKGRFKAIYESIII
Ga0316191_1050310723300032258Worm BurrowMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIKFDKA
Ga0316191_1053240923300032258Worm BurrowMPVGAGIQNYLKTLDSRLHGNDVKGRFKTFYETINFNSLQNR
Ga0316191_1059346213300032258Worm BurrowMPAEAGIQNYLKTLASRLRGNDVKGRFKTFYETIKIQTFYNF
Ga0316191_1119409133300032258Worm BurrowMPAKAGIQNHLKSLDSRLRGNDGKGAFLSFCETIK
Ga0316191_1136748213300032258Worm BurrowMPAKAGIQNYLRTLDSRLRGNDAKGRFKTFYETINLVPLNFTSLLCSD
Ga0316190_1008254733300032259Worm BurrowMPAKAGIQNYLETMGSRLRGNDVKGRFKTFYETINLQFTIPR
Ga0316190_1042225433300032259Worm BurrowMLAKAGIQNYLKTLDSRIRGNDAKGRFKIFYETINIQSSFVIPL
Ga0316190_1111571613300032259Worm BurrowMPAKAGIQNYLKTLDSRLRGNDAKKRFKTFYETIKFTIRNVRDG
Ga0316192_1015300123300032260Worm BurrowMPAKAGIQNYLKTLDSRLRGNDVKGRFKIFYEPINIQFRFIRVGFY
Ga0316192_1025894023300032260Worm BurrowMLAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETINIQQNKHPV
Ga0316192_1027269213300032260Worm BurrowMPAKAGIQKYLKTLDSRLRGNDAKGRFKTFYETIKF
Ga0316192_1042540423300032260Worm BurrowMRAKAGIQNHLNTLDPCLRGNDVKGRFKIFYDTISV
Ga0316192_1044121013300032260Worm BurrowMPAEAGIHNYLKILDYRLRGNDVKGRFKTFYETITFLVW
Ga0316192_1059813713300032260Worm BurrowRNSVLPAKAGIQNYLKTLDSRLRGKDVKGCFKTFY
Ga0316192_1061488223300032260Worm BurrowMPAKAGIQNYLKSLDSRLRGNDVKGRFRTYYETINIQRSMLDVIGIFCSEQ
Ga0316192_1072586413300032260Worm BurrowMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYDFIKIGISN
Ga0316192_1083223613300032260Worm BurrowMPAKAGIQKYLKTLDSRLRGNDAKGRFKNFYETIKP
Ga0316192_1097331413300032260Worm BurrowMPAKAGIQNYSKTLDSRLRGKDVKGRFKTFYETINIVDAALYLF
Ga0316192_1107482023300032260Worm BurrowMPAKAGIQNYLKILDSRLRGNDAKGGFKTFYETIDLQFSASGG
Ga0316194_1003115023300032262SedimentMPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEFSISNA
Ga0316194_1018000113300032262SedimentMPAKAGIQNYSKTLDSRLRGNDAKGRFKTFYVTINVRCSKFIF
Ga0316194_1018197113300032262SedimentMPAKAGIQNYLKTLDSGLRGNDAKGRFKTFYETIKI
Ga0316195_1006675323300032263SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKITFCFNYCITDK
Ga0316195_1014784513300032263SedimentMPAKAGIQKYLKTLDSRLRGNDIKERFKTIYESIKIAN
Ga0316195_1040230523300032263SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYGNIRVKYYKFMHF
Ga0316189_1004692113300032272Worm BurrowMPAKAGIQKYLKTLDSRLRGNDAKGRFKNFYETIKPGTAQL
Ga0316189_1006971043300032272Worm BurrowMPAKAGIQNYLKTLDSRLRGNDAKGRFKIFYETINIQQATNNRPLTN
Ga0316189_1010791843300032272Worm BurrowMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINSNSGFLRM
Ga0316189_1015396313300032272Worm BurrowMPAKSGIQKYLKTLDSRLRGNDTKGRFKAIYESIIIKKYSN
Ga0316189_1021415923300032272Worm BurrowAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETIIIGY
Ga0316189_1022997913300032272Worm BurrowMPAKAGIQNYLKTLDSRLRENDAKGHFKTFTKPSILMT
Ga0316189_1028364743300032272Worm BurrowMPAKAGIQKYLKTLDSRLRGNDVKRGIKTFYETIKFDA
Ga0316189_1040553713300032272Worm BurrowMPAKAGIQKYLKTLDSRLRGNDAEGRFKTFYETIKVQGTRFRVQGS
Ga0316189_1075304413300032272Worm BurrowNSVMPAKAGIQNYLKTLDSRLRRNDVKGRFKAFYETIKTF
Ga0316189_1152408813300032272Worm BurrowMPEKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKD
Ga0316188_1011381233300032276Worm BurrowMPAKAGIQNYLKALDSRLRGNDAKGCFKTFYETINLDYFK
Ga0316188_1013834613300032276Worm BurrowMPAKAGIQNYLISLGSRLPGNDVKGRFKTFLNFAIIF
Ga0316188_1022045323300032276Worm BurrowSVMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIFFEY
Ga0316188_1024831713300032276Worm BurrowMPAKAGIQNHLKILDSRLRGNDVQGHFKTFYETINSNKIWVKDD
Ga0316193_1001706463300033429SedimentMPAKAGIQNYLKTLDSRLRGNDVKGRFKTFYETINI
Ga0316193_1026203733300033429SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKTFYETIKSEGP
Ga0316193_1028047123300033429SedimentMPAKAGIQNYLKTLDSRLRGNNVKGRFKAIYETINLYVGPK
Ga0316193_1060621813300033429SedimentVRNSVMPAKAGIQKYLKTLDSRLRGNDAKGRFETFCESINIEISISNA
Ga0316193_1104522813300033429SedimentMPAKAGIQNYLISLGSRIRGNDAKGGFKIFYETINTD
Ga0316193_1162111113300033429SedimentMPAKAGIQNYLKTLDSRLRGNDAKGRFKIFYETINIQRSTLMDS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.