Basic Information | |
---|---|
Family ID | F012823 |
Family Type | Metagenome |
Number of Sequences | 277 |
Average Sequence Length | 49 residues |
Representative Sequence | DSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Number of Associated Samples | 208 |
Number of Associated Scaffolds | 277 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.64 % |
% of genes near scaffold ends (potentially truncated) | 90.25 % |
% of genes from short scaffolds (< 2000 bps) | 88.09 % |
Associated GOLD sequencing projects | 189 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.755 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.108 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.213 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.736 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.54% β-sheet: 2.70% Coil/Unstructured: 56.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 277 Family Scaffolds |
---|---|---|
PF03601 | Cons_hypoth698 | 4.69 |
PF10503 | Esterase_PHB | 3.97 |
PF07369 | DUF1488 | 1.44 |
PF01804 | Penicil_amidase | 0.72 |
PF13561 | adh_short_C2 | 0.72 |
PF11752 | DUF3309 | 0.72 |
PF00581 | Rhodanese | 0.72 |
PF00982 | Glyco_transf_20 | 0.72 |
PF08714 | Fae | 0.72 |
PF07883 | Cupin_2 | 0.72 |
PF03330 | DPBB_1 | 0.72 |
PF13432 | TPR_16 | 0.36 |
PF01384 | PHO4 | 0.36 |
PF02909 | TetR_C_1 | 0.36 |
PF00571 | CBS | 0.36 |
PF02602 | HEM4 | 0.36 |
PF00440 | TetR_N | 0.36 |
PF01472 | PUA | 0.36 |
PF02586 | SRAP | 0.36 |
PF13643 | DUF4145 | 0.36 |
PF09335 | SNARE_assoc | 0.36 |
PF01471 | PG_binding_1 | 0.36 |
PF00589 | Phage_integrase | 0.36 |
PF09361 | Phasin_2 | 0.36 |
PF00239 | Resolvase | 0.36 |
PF03358 | FMN_red | 0.36 |
PF13384 | HTH_23 | 0.36 |
PF14023 | DUF4239 | 0.36 |
PF00691 | OmpA | 0.36 |
PF13683 | rve_3 | 0.36 |
PF03411 | Peptidase_M74 | 0.36 |
PF08240 | ADH_N | 0.36 |
PF04366 | Ysc84 | 0.36 |
PF07311 | Dodecin | 0.36 |
PF00709 | Adenylsucc_synt | 0.36 |
PF01545 | Cation_efflux | 0.36 |
PF12833 | HTH_18 | 0.36 |
PF08282 | Hydrolase_3 | 0.36 |
COG ID | Name | Functional Category | % Frequency in 277 Family Scaffolds |
---|---|---|---|
COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 4.69 |
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.72 |
COG1795 | Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase) | Energy production and conversion [C] | 0.72 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.36 |
COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.36 |
COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.36 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.36 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.36 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.36 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.36 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.36 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.36 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.36 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.36 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.36 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.36 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.36 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.36 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.36 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.36 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.36 |
COG3770 | Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.75 % |
Unclassified | root | N/A | 16.25 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000787|JGI11643J11755_11364233 | Not Available | 631 | Open in IMG/M |
3300000787|JGI11643J11755_11540903 | Not Available | 567 | Open in IMG/M |
3300000789|JGI1027J11758_12581108 | Not Available | 606 | Open in IMG/M |
3300000789|JGI1027J11758_12831007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 625 | Open in IMG/M |
3300000890|JGI11643J12802_11206908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 941 | Open in IMG/M |
3300000955|JGI1027J12803_101456634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 855 | Open in IMG/M |
3300000956|JGI10216J12902_115837155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 528 | Open in IMG/M |
3300001431|F14TB_102252649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 510 | Open in IMG/M |
3300001536|A1565W1_10782035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 560 | Open in IMG/M |
3300001537|A2065W1_10046870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1683 | Open in IMG/M |
3300001537|A2065W1_11673040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 623 | Open in IMG/M |
3300002124|C687J26631_10326817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 506 | Open in IMG/M |
3300002503|C687J35164_10160022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 649 | Open in IMG/M |
3300003994|Ga0055435_10021133 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300003997|Ga0055466_10157622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 652 | Open in IMG/M |
3300004062|Ga0055500_10141838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 563 | Open in IMG/M |
3300004156|Ga0062589_100306140 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300004157|Ga0062590_102480827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 549 | Open in IMG/M |
3300004463|Ga0063356_102382556 | Not Available | 809 | Open in IMG/M |
3300004463|Ga0063356_103969942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 637 | Open in IMG/M |
3300004479|Ga0062595_101025841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 712 | Open in IMG/M |
3300004479|Ga0062595_102109884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 549 | Open in IMG/M |
3300004480|Ga0062592_102073950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 564 | Open in IMG/M |
3300004481|Ga0069718_15610022 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300004643|Ga0062591_102573843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 536 | Open in IMG/M |
3300005093|Ga0062594_102416061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300005295|Ga0065707_10278248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1053 | Open in IMG/M |
3300005329|Ga0070683_102080003 | Not Available | 545 | Open in IMG/M |
3300005330|Ga0070690_100306871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1139 | Open in IMG/M |
3300005330|Ga0070690_100853197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 710 | Open in IMG/M |
3300005331|Ga0070670_100035681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 4280 | Open in IMG/M |
3300005331|Ga0070670_100820463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 841 | Open in IMG/M |
3300005337|Ga0070682_100119833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1765 | Open in IMG/M |
3300005337|Ga0070682_100489897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 950 | Open in IMG/M |
3300005339|Ga0070660_100007762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7482 | Open in IMG/M |
3300005343|Ga0070687_100198279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1214 | Open in IMG/M |
3300005343|Ga0070687_101207319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 558 | Open in IMG/M |
3300005344|Ga0070661_100009705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6676 | Open in IMG/M |
3300005344|Ga0070661_100856010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 748 | Open in IMG/M |
3300005354|Ga0070675_100031386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 4295 | Open in IMG/M |
3300005355|Ga0070671_101820496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 541 | Open in IMG/M |
3300005365|Ga0070688_100016304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 4245 | Open in IMG/M |
3300005366|Ga0070659_100847760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 796 | Open in IMG/M |
3300005366|Ga0070659_102059665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 513 | Open in IMG/M |
3300005367|Ga0070667_101599195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 612 | Open in IMG/M |
3300005441|Ga0070700_101901785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 514 | Open in IMG/M |
3300005444|Ga0070694_101224038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 630 | Open in IMG/M |
3300005457|Ga0070662_100737106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 835 | Open in IMG/M |
3300005457|Ga0070662_101517502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → Deinococcus roseus | 578 | Open in IMG/M |
3300005458|Ga0070681_10750291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 892 | Open in IMG/M |
3300005536|Ga0070697_101694470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 565 | Open in IMG/M |
3300005546|Ga0070696_100480147 | Not Available | 985 | Open in IMG/M |
3300005546|Ga0070696_101775980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 533 | Open in IMG/M |
3300005548|Ga0070665_100165403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2214 | Open in IMG/M |
3300005549|Ga0070704_100090565 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
3300005563|Ga0068855_101873424 | Not Available | 608 | Open in IMG/M |
3300005577|Ga0068857_100756996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 925 | Open in IMG/M |
3300005614|Ga0068856_101514299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 684 | Open in IMG/M |
3300005614|Ga0068856_101754784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 633 | Open in IMG/M |
3300005764|Ga0066903_101458273 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300005764|Ga0066903_103374310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
3300005843|Ga0068860_100900857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 900 | Open in IMG/M |
3300006047|Ga0075024_100655592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 571 | Open in IMG/M |
3300006052|Ga0075029_100629251 | Not Available | 719 | Open in IMG/M |
3300006058|Ga0075432_10120070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 987 | Open in IMG/M |
3300006163|Ga0070715_10626565 | Not Available | 634 | Open in IMG/M |
3300006175|Ga0070712_101003031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 722 | Open in IMG/M |
3300006175|Ga0070712_101470682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 595 | Open in IMG/M |
3300006358|Ga0068871_102020302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 549 | Open in IMG/M |
3300006755|Ga0079222_10413543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 945 | Open in IMG/M |
3300006844|Ga0075428_101102046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 839 | Open in IMG/M |
3300006903|Ga0075426_10431455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 974 | Open in IMG/M |
3300006904|Ga0075424_100145194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2513 | Open in IMG/M |
3300006904|Ga0075424_100650507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1125 | Open in IMG/M |
3300006904|Ga0075424_101160311 | Not Available | 823 | Open in IMG/M |
3300006904|Ga0075424_102071852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 600 | Open in IMG/M |
3300007004|Ga0079218_11800274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 686 | Open in IMG/M |
3300007076|Ga0075435_100775365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 834 | Open in IMG/M |
3300007076|Ga0075435_102024048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 506 | Open in IMG/M |
3300009053|Ga0105095_10356536 | Not Available | 806 | Open in IMG/M |
3300009094|Ga0111539_10184900 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
3300009094|Ga0111539_10500210 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300009094|Ga0111539_12262656 | Not Available | 631 | Open in IMG/M |
3300009101|Ga0105247_10055647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 2441 | Open in IMG/M |
3300009101|Ga0105247_10954630 | Not Available | 666 | Open in IMG/M |
3300009146|Ga0105091_10139713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1131 | Open in IMG/M |
3300009147|Ga0114129_10711863 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300009147|Ga0114129_10721401 | Not Available | 1279 | Open in IMG/M |
3300009147|Ga0114129_13147143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 538 | Open in IMG/M |
3300009156|Ga0111538_10642000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1346 | Open in IMG/M |
3300009162|Ga0075423_10859363 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300009162|Ga0075423_11869575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 648 | Open in IMG/M |
3300009545|Ga0105237_12620429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 515 | Open in IMG/M |
3300009551|Ga0105238_10580368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1127 | Open in IMG/M |
3300009553|Ga0105249_10339878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1518 | Open in IMG/M |
3300009700|Ga0116217_10140564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1619 | Open in IMG/M |
3300009811|Ga0105084_1040671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 811 | Open in IMG/M |
3300009811|Ga0105084_1055018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 708 | Open in IMG/M |
3300009815|Ga0105070_1123284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 522 | Open in IMG/M |
3300009820|Ga0105085_1097244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 573 | Open in IMG/M |
3300009824|Ga0116219_10000569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 38264 | Open in IMG/M |
3300009839|Ga0116223_10002308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 18149 | Open in IMG/M |
3300009839|Ga0116223_10159275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1398 | Open in IMG/M |
3300010371|Ga0134125_10498581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
3300010371|Ga0134125_11646322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 698 | Open in IMG/M |
3300010373|Ga0134128_10084502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3620 | Open in IMG/M |
3300010373|Ga0134128_10619327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1204 | Open in IMG/M |
3300010373|Ga0134128_11038315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 906 | Open in IMG/M |
3300010373|Ga0134128_11439529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 759 | Open in IMG/M |
3300010375|Ga0105239_10476293 | Not Available | 1418 | Open in IMG/M |
3300010375|Ga0105239_11488296 | Not Available | 782 | Open in IMG/M |
3300010396|Ga0134126_10768693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1091 | Open in IMG/M |
3300010397|Ga0134124_10468403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1213 | Open in IMG/M |
3300010397|Ga0134124_10674234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1021 | Open in IMG/M |
3300010397|Ga0134124_12051994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300010399|Ga0134127_10329404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1483 | Open in IMG/M |
3300010400|Ga0134122_11935834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 626 | Open in IMG/M |
3300010401|Ga0134121_10045181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3606 | Open in IMG/M |
3300010401|Ga0134121_11141091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 775 | Open in IMG/M |
3300010401|Ga0134121_12067655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 603 | Open in IMG/M |
3300011119|Ga0105246_10691514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 893 | Open in IMG/M |
3300011119|Ga0105246_11065685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 736 | Open in IMG/M |
3300011991|Ga0120153_1027078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1218 | Open in IMG/M |
3300012019|Ga0120139_1088710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 768 | Open in IMG/M |
3300012358|Ga0137368_10644535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 670 | Open in IMG/M |
3300012360|Ga0137375_11475119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300012361|Ga0137360_10914818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 756 | Open in IMG/M |
3300012895|Ga0157309_10249782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 578 | Open in IMG/M |
3300012906|Ga0157295_10402442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 511 | Open in IMG/M |
3300012907|Ga0157283_10153253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 682 | Open in IMG/M |
3300012909|Ga0157290_10272806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 611 | Open in IMG/M |
3300012911|Ga0157301_10300900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 585 | Open in IMG/M |
3300012915|Ga0157302_10418155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
3300012915|Ga0157302_10443715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 547 | Open in IMG/M |
3300012931|Ga0153915_10037240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4920 | Open in IMG/M |
3300012957|Ga0164303_10620746 | Not Available | 715 | Open in IMG/M |
3300012958|Ga0164299_10362394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 917 | Open in IMG/M |
3300012961|Ga0164302_10991258 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012984|Ga0164309_10718115 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300012984|Ga0164309_11112328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 658 | Open in IMG/M |
3300012984|Ga0164309_11876984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 514 | Open in IMG/M |
3300012989|Ga0164305_11605066 | Not Available | 581 | Open in IMG/M |
3300012989|Ga0164305_12054243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 523 | Open in IMG/M |
3300013100|Ga0157373_10383200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1006 | Open in IMG/M |
3300013296|Ga0157374_11220971 | Not Available | 773 | Open in IMG/M |
3300013297|Ga0157378_10034294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4488 | Open in IMG/M |
3300013306|Ga0163162_10439217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1437 | Open in IMG/M |
3300013307|Ga0157372_12990952 | Not Available | 540 | Open in IMG/M |
3300013308|Ga0157375_10051179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4055 | Open in IMG/M |
3300013308|Ga0157375_11628086 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300013758|Ga0120147_1049431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
3300014324|Ga0075352_1154985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 647 | Open in IMG/M |
3300014325|Ga0163163_10085860 | All Organisms → cellular organisms → Bacteria | 3155 | Open in IMG/M |
3300014325|Ga0163163_10295996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1671 | Open in IMG/M |
3300014325|Ga0163163_11255376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 803 | Open in IMG/M |
3300014325|Ga0163163_12751188 | Not Available | 549 | Open in IMG/M |
3300014326|Ga0157380_12328202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 600 | Open in IMG/M |
3300014823|Ga0120170_1066060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 774 | Open in IMG/M |
3300014968|Ga0157379_10322168 | Not Available | 1411 | Open in IMG/M |
3300014968|Ga0157379_10665079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 976 | Open in IMG/M |
3300014968|Ga0157379_11935197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 582 | Open in IMG/M |
3300015077|Ga0173483_10090872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1253 | Open in IMG/M |
3300015371|Ga0132258_10166720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5305 | Open in IMG/M |
3300015371|Ga0132258_11455800 | Not Available | 1730 | Open in IMG/M |
3300015372|Ga0132256_101088953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
3300015372|Ga0132256_103426440 | Not Available | 533 | Open in IMG/M |
3300015373|Ga0132257_103362184 | Not Available | 582 | Open in IMG/M |
3300015374|Ga0132255_101628662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 978 | Open in IMG/M |
3300016270|Ga0182036_10549594 | Not Available | 920 | Open in IMG/M |
3300016357|Ga0182032_10106604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1991 | Open in IMG/M |
3300016371|Ga0182034_10974685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
3300016387|Ga0182040_11153773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 650 | Open in IMG/M |
3300016404|Ga0182037_10067991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2453 | Open in IMG/M |
3300017792|Ga0163161_12058297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 508 | Open in IMG/M |
3300017947|Ga0187785_10165498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 940 | Open in IMG/M |
3300017959|Ga0187779_11123023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 550 | Open in IMG/M |
3300017999|Ga0187767_10030268 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300018028|Ga0184608_10164463 | Not Available | 962 | Open in IMG/M |
3300018056|Ga0184623_10188035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 951 | Open in IMG/M |
3300018058|Ga0187766_10905146 | Not Available | 623 | Open in IMG/M |
3300018063|Ga0184637_10672878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 571 | Open in IMG/M |
3300018076|Ga0184609_10255722 | Not Available | 819 | Open in IMG/M |
3300018089|Ga0187774_11190606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 545 | Open in IMG/M |
3300018465|Ga0190269_11074920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 617 | Open in IMG/M |
3300018481|Ga0190271_10657663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1169 | Open in IMG/M |
3300019356|Ga0173481_10289128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 757 | Open in IMG/M |
3300019356|Ga0173481_10336070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 716 | Open in IMG/M |
3300019361|Ga0173482_10168533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 870 | Open in IMG/M |
3300023263|Ga0247800_1062893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 698 | Open in IMG/M |
3300024433|Ga0209986_10539092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 508 | Open in IMG/M |
3300025002|Ga0209001_1084165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 501 | Open in IMG/M |
3300025165|Ga0209108_10291424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 821 | Open in IMG/M |
3300025322|Ga0209641_10499741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 862 | Open in IMG/M |
3300025324|Ga0209640_10064538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 3169 | Open in IMG/M |
3300025325|Ga0209341_11038917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 598 | Open in IMG/M |
3300025326|Ga0209342_11124039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 587 | Open in IMG/M |
3300025327|Ga0209751_10487764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1009 | Open in IMG/M |
3300025551|Ga0210131_1040621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 735 | Open in IMG/M |
3300025899|Ga0207642_10137957 | Not Available | 1282 | Open in IMG/M |
3300025901|Ga0207688_10137559 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300025901|Ga0207688_10376163 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300025901|Ga0207688_10613687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 686 | Open in IMG/M |
3300025904|Ga0207647_10023576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4069 | Open in IMG/M |
3300025905|Ga0207685_10012519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2592 | Open in IMG/M |
3300025906|Ga0207699_10149935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1542 | Open in IMG/M |
3300025906|Ga0207699_11239473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 552 | Open in IMG/M |
3300025907|Ga0207645_10231267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1220 | Open in IMG/M |
3300025915|Ga0207693_10528882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 920 | Open in IMG/M |
3300025915|Ga0207693_10803889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 725 | Open in IMG/M |
3300025916|Ga0207663_10124900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1768 | Open in IMG/M |
3300025918|Ga0207662_10025439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3409 | Open in IMG/M |
3300025919|Ga0207657_10149402 | Not Available | 1904 | Open in IMG/M |
3300025920|Ga0207649_10792624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 739 | Open in IMG/M |
3300025920|Ga0207649_11001902 | Not Available | 657 | Open in IMG/M |
3300025923|Ga0207681_10281306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1310 | Open in IMG/M |
3300025923|Ga0207681_10448360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1049 | Open in IMG/M |
3300025925|Ga0207650_10296458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1319 | Open in IMG/M |
3300025929|Ga0207664_10183557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1797 | Open in IMG/M |
3300025931|Ga0207644_10057980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2797 | Open in IMG/M |
3300025932|Ga0207690_10050683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2772 | Open in IMG/M |
3300025936|Ga0207670_10989637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 707 | Open in IMG/M |
3300025938|Ga0207704_10017320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3730 | Open in IMG/M |
3300025939|Ga0207665_11009929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 662 | Open in IMG/M |
3300025940|Ga0207691_10130450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2221 | Open in IMG/M |
3300025945|Ga0207679_10913270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 803 | Open in IMG/M |
3300025949|Ga0207667_10719560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 999 | Open in IMG/M |
3300025949|Ga0207667_11470664 | Not Available | 653 | Open in IMG/M |
3300025949|Ga0207667_12058236 | Not Available | 530 | Open in IMG/M |
3300025961|Ga0207712_10320419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1279 | Open in IMG/M |
3300025961|Ga0207712_10384601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1175 | Open in IMG/M |
3300025981|Ga0207640_10361043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1170 | Open in IMG/M |
3300025986|Ga0207658_10076699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 2547 | Open in IMG/M |
3300026088|Ga0207641_10376391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1359 | Open in IMG/M |
3300026089|Ga0207648_10469562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1148 | Open in IMG/M |
3300026142|Ga0207698_12179630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 567 | Open in IMG/M |
3300027056|Ga0209879_1046731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 707 | Open in IMG/M |
3300027854|Ga0209517_10137382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1583 | Open in IMG/M |
3300027909|Ga0209382_11688400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 622 | Open in IMG/M |
3300027952|Ga0209889_1033908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1106 | Open in IMG/M |
3300027957|Ga0209857_1031522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 975 | Open in IMG/M |
3300028380|Ga0268265_10482721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
3300028889|Ga0247827_11334909 | Not Available | 503 | Open in IMG/M |
3300030006|Ga0299907_10537527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 918 | Open in IMG/M |
3300030006|Ga0299907_10973825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 625 | Open in IMG/M |
3300030006|Ga0299907_11121993 | Not Available | 570 | Open in IMG/M |
3300030114|Ga0311333_11299628 | Not Available | 623 | Open in IMG/M |
3300030606|Ga0299906_10351098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1146 | Open in IMG/M |
3300030613|Ga0299915_10065598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 2676 | Open in IMG/M |
3300030620|Ga0302046_10987429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 670 | Open in IMG/M |
3300030659|Ga0316363_10003780 | All Organisms → cellular organisms → Bacteria | 10677 | Open in IMG/M |
3300030707|Ga0310038_10066905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1967 | Open in IMG/M |
3300031170|Ga0307498_10047101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1149 | Open in IMG/M |
3300031562|Ga0310886_11043634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 525 | Open in IMG/M |
3300031668|Ga0318542_10409287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 701 | Open in IMG/M |
3300031679|Ga0318561_10479358 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 685 | Open in IMG/M |
3300031726|Ga0302321_100419047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → Methyloligella halotolerans | 1462 | Open in IMG/M |
3300031740|Ga0307468_100615819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
3300031740|Ga0307468_101975820 | Not Available | 558 | Open in IMG/M |
3300031781|Ga0318547_10206749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1174 | Open in IMG/M |
3300031796|Ga0318576_10629390 | Not Available | 505 | Open in IMG/M |
3300031833|Ga0310917_10216125 | Not Available | 1284 | Open in IMG/M |
3300031833|Ga0310917_10274683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1137 | Open in IMG/M |
3300031847|Ga0310907_10062300 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300031940|Ga0310901_10046525 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300032000|Ga0310903_10458426 | Not Available | 659 | Open in IMG/M |
3300032017|Ga0310899_10506231 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300032075|Ga0310890_10347387 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300032205|Ga0307472_100491931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1055 | Open in IMG/M |
3300032205|Ga0307472_101613110 | Not Available | 638 | Open in IMG/M |
3300032205|Ga0307472_101974938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 584 | Open in IMG/M |
3300032261|Ga0306920_103069569 | Not Available | 628 | Open in IMG/M |
3300032782|Ga0335082_10609659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 953 | Open in IMG/M |
3300033551|Ga0247830_10277423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1278 | Open in IMG/M |
3300033551|Ga0247830_10638803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 844 | Open in IMG/M |
3300034090|Ga0326723_0247144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 795 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.25% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.53% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.53% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.81% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.44% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.44% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.08% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.08% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.08% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.08% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.36% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.36% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.36% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.36% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.36% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J11755_113642331 | 3300000787 | Soil | EALRELLEQVASDVFDAGEADEAGCILVTKEALN* |
JGI11643J11755_115409031 | 3300000787 | Soil | REIIEHVASDAFDAEDPFDTSGRVLVTSEALARVMRSA* |
JGI1027J11758_125811082 | 3300000789 | Soil | EIIEQVASDAFDAEDPFDTSGRVLVTSEALARVMRSA* |
JGI1027J11758_128310072 | 3300000789 | Soil | HAERVHLNGSDGAIFEAYRELIEDLASEAFDAEGPFDQHGRILVTSEAIARVTRSA* |
JGI11643J12802_112069083 | 3300000890 | Soil | EELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA* |
JGI1027J12803_1014566343 | 3300000955 | Soil | SHEALRDHADRVHFSESDGAVFQAYRELIEQAASDAYDAEGPFDDHGRVLVTSEALARVTRSA* |
JGI10216J12902_1158371551 | 3300000956 | Soil | MPLVRLKDEYLEQEDGVRFLMADELGNAVACKVSHEALRAQAEHVHFSGSDSAAFDAEGPFDNHGRVLVTSEALARITRSA* |
F14TB_1022526491 | 3300001431 | Soil | LIEQVASDAYDAEGPFDDHGRILVTPEALARVTRSA* |
A1565W1_107820352 | 3300001536 | Permafrost | TDSAIFEAYRELIEDVASKTFDAEGPFDDHGRILVTSEALARVTRSA* |
A2065W1_100468705 | 3300001537 | Permafrost | HEVLRDQADRLHFVATDDAIFEEYRELIEDIASEAFDAGGPLDHQGRILVTSEAMARATRSA* |
A2065W1_116730401 | 3300001537 | Permafrost | VHLSGTDSAVFEAYRELIEDVASETFDAEGPYDEHGRILVTSDALARVTRSA* |
C687J26631_103268171 | 3300002124 | Soil | SEAHDAEGPFDAHGRILVTSGALARVTRSAVFRK* |
C687J35164_101600223 | 3300002503 | Soil | VFQAYRELIEEVASEAHDAEGPFDAHGRVLVTSEALARVTRSA* |
Ga0055435_100211332 | 3300003994 | Natural And Restored Wetlands | MHFSGTDSAIFDAYRELIEGVASDAHDAEGPFDAHGRIIVTSEALARVMRSA* |
Ga0055466_101576222 | 3300003997 | Natural And Restored Wetlands | HEALRDHAERVHLSGSDAAVFEAYRELIEQAASDAHDAEGPFDNHGRVLVTSEALARVTRSA* |
Ga0055500_101418382 | 3300004062 | Natural And Restored Wetlands | ALQDHADRMHFSGTDGAVFDAYRELIEAVASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0062589_1003061401 | 3300004156 | Soil | DISGTYRSASDAFDAEGPFDNHGRVLVSSEALARITRSA* |
Ga0062590_1024808272 | 3300004157 | Soil | VSHEALRAQAERVHFSGSDSAVFRIEELASDAFDAEGPFDNHGRVLVTSEALARITRSA* |
Ga0063356_1023825562 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA* |
Ga0063356_1039699421 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA* |
Ga0062595_1010258412 | 3300004479 | Soil | VQLSHELRDHADRMHFSGTDGAVFEAYRELMEDVASGAYDAKGPFDDHGRILVTSEALARVTRSA* |
Ga0062595_1021098841 | 3300004479 | Soil | TGSDSEVFEAYRELIEELASEAFDAEGPFDAHGRVLVTSEAIARITRSA* |
Ga0062592_1020739502 | 3300004480 | Soil | AYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA* |
Ga0069718_156100223 | 3300004481 | Sediment | DGAVFEAYRELIEELASATYDAETPFDELGRVLVTSEAIARITRSA* |
Ga0062591_1025738431 | 3300004643 | Soil | QAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA* |
Ga0062594_1024160611 | 3300005093 | Soil | SGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALAGNA* |
Ga0065707_102782481 | 3300005295 | Switchgrass Rhizosphere | KVSHEALRTHAEHVHFAGTDSAVFQAYRELVEELASDAFDAEGPFDNHGRVLVTSEALARITRSA* |
Ga0070683_1020800031 | 3300005329 | Corn Rhizosphere | KVFKAYRELIEQVASDAYDAGAKVDDAGCVLVTSEAIDRVSRSA* |
Ga0070690_1003068713 | 3300005330 | Switchgrass Rhizosphere | SDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070690_1008531972 | 3300005330 | Switchgrass Rhizosphere | AYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0070670_1000356811 | 3300005331 | Switchgrass Rhizosphere | ERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070670_1008204632 | 3300005331 | Switchgrass Rhizosphere | FSGSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070682_1001198334 | 3300005337 | Corn Rhizosphere | AVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0070682_1004898972 | 3300005337 | Corn Rhizosphere | TDGAVFQAYRELIEELANDAAEGPFDNHGRVLVTSEALARITRSA* |
Ga0070660_1000077621 | 3300005339 | Corn Rhizosphere | DSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070687_1001982792 | 3300005343 | Switchgrass Rhizosphere | MPTAHFSGTDGAAFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0070687_1012073192 | 3300005343 | Switchgrass Rhizosphere | SGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVSSEALARITRSA* |
Ga0070661_1000097051 | 3300005344 | Corn Rhizosphere | CKVNHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070661_1008560103 | 3300005344 | Corn Rhizosphere | GTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA* |
Ga0070675_1000313869 | 3300005354 | Miscanthus Rhizosphere | DRVHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0070671_1018204961 | 3300005355 | Switchgrass Rhizosphere | AYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0070688_1000163041 | 3300005365 | Switchgrass Rhizosphere | SAVFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA* |
Ga0070659_1008477602 | 3300005366 | Corn Rhizosphere | GAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0070659_1020596651 | 3300005366 | Corn Rhizosphere | HFSGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALAGNA* |
Ga0070667_1015991951 | 3300005367 | Switchgrass Rhizosphere | QAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070700_1019017851 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | EALRGHADRMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA* |
Ga0070694_1012240381 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0070662_1007371061 | 3300005457 | Corn Rhizosphere | GAVFQAYREPIEELANDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070662_1015175022 | 3300005457 | Corn Rhizosphere | QPRADEPIARAASGDAFDAEGPYDNHGRVLVTSEALARVTRSA* |
Ga0070681_107502914 | 3300005458 | Corn Rhizosphere | DSAVFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA* |
Ga0070697_1016944702 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HFSGSDSAVFQAHRELIEELASEAFDAEGPFDNHGRVLVTSEALARITRSA* |
Ga0070696_1004801471 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0070696_1017759801 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | HAERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070665_1001654031 | 3300005548 | Switchgrass Rhizosphere | SAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070704_1000905651 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA* |
Ga0068855_1018734241 | 3300005563 | Corn Rhizosphere | KVMVFEAYRELIEQVASDACDAGANVDDAGCVLVTSEALDRVSRSA* |
Ga0068857_1007569964 | 3300005577 | Corn Rhizosphere | AVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0068856_1015142992 | 3300005614 | Corn Rhizosphere | AYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA* |
Ga0068856_1017547841 | 3300005614 | Corn Rhizosphere | VFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0066903_1014582731 | 3300005764 | Tropical Forest Soil | VFEAYRELIETVASDAFDAEGPMDAHGRILVTSEALARVMRSA* |
Ga0066903_1033743102 | 3300005764 | Tropical Forest Soil | MKHCERVRLSGSDSSVFEACRELIEDSASEAFDAEGLFDRHGRGLVNSEAIARVTRSA* |
Ga0068860_1009008571 | 3300005843 | Switchgrass Rhizosphere | VFEAYRELIEQVASDAYDAGTSFDDAGLILVTSEALARVGRSA* |
Ga0075024_1006555921 | 3300006047 | Watersheds | LQDHADRMHFSGTDGAVFDAYRELIEAVASEAHDAEGPFDAHGRILVTSEALARVTRSA* |
Ga0075029_1006292511 | 3300006052 | Watersheds | RELIEQVASDAYHAGTSVDDAGLVLVTSEALALVARSA* |
Ga0075432_101200702 | 3300006058 | Populus Rhizosphere | RVHFSGSDSAVFQAYRELIEELASEAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070715_106265651 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LNVADDKVFEAYRELIEQVASDAYDAGANVDDAGCVLVTSEALDRVSRSA* |
Ga0070712_1010030311 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0070712_1014706821 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTHEALRDHAERMHFSGSDRAVFEAYRELIETVASGAFDAEGPMDAHGRILVTSEALARVMRSA* |
Ga0068871_1020203022 | 3300006358 | Miscanthus Rhizosphere | AYRELIEELASEAHDAEGPFDAHGRILVTSEALARVTRSA* |
Ga0079222_104135431 | 3300006755 | Agricultural Soil | GTDATIFEAYRELIEQIASDAYDAEGPVDDHGRILVTSEALARVTRSA* |
Ga0075428_1011020463 | 3300006844 | Populus Rhizosphere | ERVHFSGSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA* |
Ga0075426_104314551 | 3300006903 | Populus Rhizosphere | SHEALRAHAERVHFAGNDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA* |
Ga0075424_1001451948 | 3300006904 | Populus Rhizosphere | FSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0075424_1006505071 | 3300006904 | Populus Rhizosphere | AVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRNA* |
Ga0075424_1011603113 | 3300006904 | Populus Rhizosphere | FEAYREFIEQVASDAYDAGSVDDAGLALVTSEALARVGRSA* |
Ga0075424_1020718521 | 3300006904 | Populus Rhizosphere | MPDRMHFSGTDGAVFEAYRELIEDVASGAYDAKGPFDDHGRILVSSEKLARVT |
Ga0079218_118002742 | 3300007004 | Agricultural Soil | LRDHADRMHFSGTDGAVFEAYRELIEEVASEAHDAEGPFDAHGRILVTSEALARVTRST* |
Ga0075435_1007753653 | 3300007076 | Populus Rhizosphere | GSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA* |
Ga0075435_1020240481 | 3300007076 | Populus Rhizosphere | MAPFSRAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA* |
Ga0105095_103565362 | 3300009053 | Freshwater Sediment | HFSGTDGAVFDAYRELIEEVASVAHDAEGPFDEHGRILVTSEALARVTRSA* |
Ga0111539_101849006 | 3300009094 | Populus Rhizosphere | VSHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRSA* |
Ga0111539_105002102 | 3300009094 | Populus Rhizosphere | MPTVQHSGTDGAVFEAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA* |
Ga0111539_122626562 | 3300009094 | Populus Rhizosphere | EGPDEKVFEVYRELIEQVASDAYDAGTSVDDAGLVLVTSEALARVGRSA* |
Ga0105247_100556471 | 3300009101 | Switchgrass Rhizosphere | IEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0105247_109546301 | 3300009101 | Switchgrass Rhizosphere | VFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA* |
Ga0105091_101397131 | 3300009146 | Freshwater Sediment | RVSHEALRDHAERTHFSGTDGAVFEAYRELIEEVASETHDAEGPFDAHGRVLVTSEALARVTRSA* |
Ga0114129_107118632 | 3300009147 | Populus Rhizosphere | LAINLEEELEHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA* |
Ga0114129_107214013 | 3300009147 | Populus Rhizosphere | SHASGTDSAVFQAYRELIEELASDAFDAEGPFDNPGHVLVTSEALTRITRSA* |
Ga0114129_131471432 | 3300009147 | Populus Rhizosphere | HEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0111538_106420002 | 3300009156 | Populus Rhizosphere | MVDELGNTVACKVCHEALRVHAEREHFAGTDGAVFQAHRELIEELASGAFDAEGPFANYGRVLVTSEALTRITRSA* |
Ga0075423_108593632 | 3300009162 | Populus Rhizosphere | HFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRNA* |
Ga0075423_114164842 | 3300009162 | Populus Rhizosphere | RLNVADDKVFEAYRELIEQVASDAYDAGANVDDAGCVLVTSEALDRVSRSA* |
Ga0075423_118695751 | 3300009162 | Populus Rhizosphere | DSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALARIMRSA* |
Ga0105237_126204291 | 3300009545 | Corn Rhizosphere | LRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0105238_105803681 | 3300009551 | Corn Rhizosphere | MRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA* |
Ga0105249_103398781 | 3300009553 | Switchgrass Rhizosphere | RELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0116217_101405644 | 3300009700 | Peatlands Soil | FEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA* |
Ga0105084_10406711 | 3300009811 | Groundwater Sand | YRELIEQLASDAYDAEGPFDAHGRVFVTSEALARVTRSA* |
Ga0105084_10550183 | 3300009811 | Groundwater Sand | YRELIEGVASEAHDAEGPFDAHGRILVTSEALARVTRSA* |
Ga0105070_11232842 | 3300009815 | Groundwater Sand | YRELIEEIASEAYEAEGPFDAHGRILVTSEALARVTRSA* |
Ga0105085_10972441 | 3300009820 | Groundwater Sand | LIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA* |
Ga0116219_100005691 | 3300009824 | Peatlands Soil | LIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA* |
Ga0116223_100023081 | 3300009839 | Peatlands Soil | EKVFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVARSA* |
Ga0116223_101592751 | 3300009839 | Peatlands Soil | EKVFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA* |
Ga0134125_104985812 | 3300010371 | Terrestrial Soil | FSGADGAVFEAYRELIEEVAIEAHDAEGPFDDHGRILVTTEALTRVMRSA* |
Ga0134125_116463221 | 3300010371 | Terrestrial Soil | MPLTRVKDDGAVFQAYREPIEELANDAFDAEVPFDNHGRVLVTSEALTRITRSA* |
Ga0134128_1008450211 | 3300010373 | Terrestrial Soil | ELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0134128_106193271 | 3300010373 | Terrestrial Soil | ALRDHADRLHFTGTDGAVFEAYRELIEDLAGRAFEAGGPLDDEGTILVTSEAIARETRSA |
Ga0134128_110383151 | 3300010373 | Terrestrial Soil | LRDHADRLHLSGTDGAVFDVYRELIEEVASAAYDAESPLDDHGRILVTSEALARMTRSA* |
Ga0134128_114395291 | 3300010373 | Terrestrial Soil | MVDELGITVACKVCHEALRVHAEREHFAGTDGAVFQAHRELIEELASGAFDAEGPFANYGRVLVTSEALTRITRSA* |
Ga0105239_104762932 | 3300010375 | Corn Rhizosphere | YRELIEQVASDAYDAGAKVDDAGCVLVTSEAIDRVSRSA* |
Ga0105239_114882961 | 3300010375 | Corn Rhizosphere | EAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0134126_107686931 | 3300010396 | Terrestrial Soil | MRFSGTDGAVFEAYRELIEEIASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0134124_104684031 | 3300010397 | Terrestrial Soil | ALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Ga0134124_106742341 | 3300010397 | Terrestrial Soil | ELIEQVASDAYDAGTSVDDAGLVLVTAEALARVGRSA* |
Ga0134124_120519941 | 3300010397 | Terrestrial Soil | RVSHEALRGHADRMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALARVMRSA* |
Ga0134127_103294041 | 3300010399 | Terrestrial Soil | VHFSGSDSAVFQAYRELIEELASEAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0134122_119358342 | 3300010400 | Terrestrial Soil | FSGADGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0134121_100451811 | 3300010401 | Terrestrial Soil | AQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0134121_111410911 | 3300010401 | Terrestrial Soil | RELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0134121_120676551 | 3300010401 | Terrestrial Soil | SHEALRAQAERVHFSGSDSAVFQAYRELIEELASEAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0105246_106915142 | 3300011119 | Miscanthus Rhizosphere | MHFSGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALAGNA* |
Ga0105246_110656852 | 3300011119 | Miscanthus Rhizosphere | ADRMRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0120153_10270783 | 3300011991 | Permafrost | HEALRDHADRVHLSGTDSAIFEAYRELIEDVASKTFDAEGPFDDHGRILVTSEALARVTRSA* |
Ga0120139_10887102 | 3300012019 | Permafrost | ALRDHADRVHLSGTDSAVFEAYRELIEDVASETFDAEGPYDEHGRILVTSDALARVTRSA |
Ga0137368_106445351 | 3300012358 | Vadose Zone Soil | HEALRDHADRMHFSGTDGAVFEAYRELIEEVASEAYDAEGPFNDHGRVLVTSEALARVIRSA* |
Ga0137375_114751191 | 3300012360 | Vadose Zone Soil | DHADRVHFSGTDSAVFEAYRELIEDVASEAFDAEGPFDDHGRILVTSEALARVTRSA* |
Ga0137360_109148181 | 3300012361 | Vadose Zone Soil | HADRVHLSGTDGSVFEAYRELIEGVASEAFDAEGPFNDHGRILVTSQALARVTRSA* |
Ga0157309_102497821 | 3300012895 | Soil | EALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0157295_104024421 | 3300012906 | Soil | ERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA* |
Ga0157283_101532531 | 3300012907 | Soil | QAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA* |
Ga0157290_102728061 | 3300012909 | Soil | QAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA* |
Ga0157301_103009002 | 3300012911 | Soil | EALRAHAERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA* |
Ga0157302_104181551 | 3300012915 | Soil | RDHANRVQHSGTDGAVFEAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA* |
Ga0157302_104437151 | 3300012915 | Soil | VSHEALRAQAEHVHFSGSDSAVFQAFRELIEELASDAFDAEGPFDNHGRVLVTSEALARITRSA* |
Ga0153915_100372406 | 3300012931 | Freshwater Wetlands | LQDHAERVHLSGSDAIVFEAYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA* |
Ga0164303_106207462 | 3300012957 | Soil | VFEAYRELIEQVASDTFDAGVNVDEAGGILVTKEALDRVARSA* |
Ga0164299_103623943 | 3300012958 | Soil | AERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA* |
Ga0164302_109912582 | 3300012961 | Soil | EAYRELIEELASAAYDAEATFEDHGRVLVTSEAIARITRRA* |
Ga0164309_107181151 | 3300012984 | Soil | SGTDGAVFEAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA* |
Ga0164309_111123281 | 3300012984 | Soil | FSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSGALTRITRSA* |
Ga0164309_118769841 | 3300012984 | Soil | FSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEAITRITRSA* |
Ga0164305_116050662 | 3300012989 | Soil | TDDQVFEAYRELIEQVASDTFDAGVDVDEAGCILVTKEALDRVARSA* |
Ga0164305_120542431 | 3300012989 | Soil | KDESGGTVACRVNHLALRDHADRMHFSGNDGAVFEAYRELIEELASEAHDAEGPFDAHGRILVTSEALARVMRSA* |
Ga0157373_103832001 | 3300013100 | Corn Rhizosphere | AERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0157374_112209711 | 3300013296 | Miscanthus Rhizosphere | RELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0157378_100342948 | 3300013297 | Miscanthus Rhizosphere | AYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0163162_104392173 | 3300013306 | Switchgrass Rhizosphere | FQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0157372_129909521 | 3300013307 | Corn Rhizosphere | RELIEQVASDTFDTRVNVDEAGCILVTKEALDRVGRSA* |
Ga0157375_100511797 | 3300013308 | Miscanthus Rhizosphere | FEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA* |
Ga0157375_116280861 | 3300013308 | Miscanthus Rhizosphere | FEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0120147_10494313 | 3300013758 | Permafrost | ICRGSHEALRDQADRLHFVATDDAIFEEYRELIEDIASEAFDAGGPLDHQGRILVTSEAMARATRSA* |
Ga0075352_11549851 | 3300014324 | Natural And Restored Wetlands | ALRDHAERVHLASKDAAVFEAYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA |
Ga0163163_100858602 | 3300014325 | Switchgrass Rhizosphere | MRFSGADGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA* |
Ga0163163_102959963 | 3300014325 | Switchgrass Rhizosphere | SGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0163163_112553761 | 3300014325 | Switchgrass Rhizosphere | LFIYALKVMVFEAYRELIEQVASDACDAGANVDDAGCVLVTSEALDRVSRSA* |
Ga0163163_127511881 | 3300014325 | Switchgrass Rhizosphere | MHFSGTDGAVFDAYRELIEEVASEAHDAEGPFDDQGRIRVTSEALA |
Ga0157380_123282021 | 3300014326 | Switchgrass Rhizosphere | HFAGNDSAVFQAYQELIEELASDAFDAEGPFDNHGRVLVSSEALARITRSA* |
Ga0120170_10660602 | 3300014823 | Permafrost | RDHADRVHLSGTDSAVFEAYRELIEDVASETFDAEGPYDEHGRILVTSDALARVTRSA* |
Ga0157379_103221682 | 3300014968 | Switchgrass Rhizosphere | DDEVFEAYRELIEQVASDTFDAGVNIDEAGCILVTKEALDRVARSA* |
Ga0157379_106650791 | 3300014968 | Switchgrass Rhizosphere | TDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0157379_119351971 | 3300014968 | Switchgrass Rhizosphere | AERVHFSGSDSAVFQAYRELIEELASDAFDVEGPFDNHGRVLVTSEALTRITRSA* |
Ga0173483_100908721 | 3300015077 | Soil | RVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEAFTRITRSA* |
Ga0132258_1016672011 | 3300015371 | Arabidopsis Rhizosphere | FQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA* |
Ga0132258_114558001 | 3300015371 | Arabidopsis Rhizosphere | MRFSGTDGAVFEAYRELVEEIASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0132256_1010889533 | 3300015372 | Arabidopsis Rhizosphere | HLSDTDAAVFEAYRELIEQVASDAYDAEGPFDDHGRILVTSEALARVTRSA* |
Ga0132256_1034264401 | 3300015372 | Arabidopsis Rhizosphere | DGDTVACGVSHELRDHVDRMHFSGTDSAVFEAYRELIEDVASGAYDAKSPFDDHGRILVTSEALARVTRSA* |
Ga0132257_1033621842 | 3300015373 | Arabidopsis Rhizosphere | EQVASDTFDAGVNVDEAGCILVTKEALDRVARSA* |
Ga0132255_1016286621 | 3300015374 | Arabidopsis Rhizosphere | LIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA* |
Ga0182036_105495941 | 3300016270 | Soil | LIEQVASDAYDAGANVDDVGCVLVTSEALDRVSRSA |
Ga0182032_101066043 | 3300016357 | Soil | FETYRELIEQVASDAYDAEGPYDMEGRILVTSEALARVLRSA |
Ga0182034_109746853 | 3300016371 | Soil | RELIEDLASEAFDAEGPFDQHGRVLITSEAIARITRSA |
Ga0182040_111537731 | 3300016387 | Soil | IEDVASEAFDAEGPFDQHGRVLVTSEAIARITRSA |
Ga0182037_100679911 | 3300016404 | Soil | AYRELIEDLASEAFDIEGPFDQHGRILVTSEAIARITRSA |
Ga0163161_120582971 | 3300017792 | Switchgrass Rhizosphere | HFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Ga0187785_101654981 | 3300017947 | Tropical Peatland | HLNGSDSKVFETYRELIEDLASEAFDAEGPFDRNGRVLVTSEALARVTRSA |
Ga0187779_111230231 | 3300017959 | Tropical Peatland | DHAERAHLSGSDGVVFETYRELIEELASEAFDAEGPFDRHGRVLVTSEAVARVTRSA |
Ga0187767_100302683 | 3300017999 | Tropical Peatland | AYRELIEQVASDAYDAGANVDDTGCVLVTSEALDRVSRSA |
Ga0184608_101644632 | 3300018028 | Groundwater Sediment | MAFASSEDEAGSTVACRVSHEALRDLAHRMHFSGTGGPVFDAYRELIEGVASKAHDAEGPFDARGRILVTPEALARVMRSA |
Ga0184623_101880351 | 3300018056 | Groundwater Sediment | VSHEALRDHAGRMHYSGTDGAVFDAYRELIEGIASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0187766_109051461 | 3300018058 | Tropical Peatland | TDGVVFETYREIIEQIASDAYNAERPFDKDGQILVTSEALARVTRSA |
Ga0184637_106728781 | 3300018063 | Groundwater Sediment | ALRDHADRMHFSGTDGAVFDAYRELIEGIASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0184609_102557222 | 3300018076 | Groundwater Sediment | AYRELIEEGASDAYDDAEGPSDDHGRILVTSGALARVSRSA |
Ga0187774_111906061 | 3300018089 | Tropical Peatland | DCKVFETYRELIEELASEAFDAEGPFDRHGRVLVTSEALARVMRSA |
Ga0190269_110749202 | 3300018465 | Soil | MKDCDNHADRMHFSGSAGAVFKAHPELIEEIASEAYEAEGPFDAHGRVLVTSEGLARVTRSA |
Ga0190271_106576631 | 3300018481 | Soil | SRELIEQIASDAHDAEGPFDDHGRVLVTSEAIARVMRSA |
Ga0173481_102891283 | 3300019356 | Soil | AERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0173481_103360702 | 3300019356 | Soil | MHFSGTDGAVFEAYRELIEEVASAAYDAEAPFDDHGRILVTSEALARITRSA |
Ga0173482_101685331 | 3300019361 | Soil | QGLRIYRELIEQVACDAYDAGANVDDAGCVLVTSEALDRVSRSA |
Ga0247800_10628933 | 3300023263 | Soil | FSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Ga0209986_105390921 | 3300024433 | Deep Subsurface | RMHISGTDGAVFDAYRELIEEVASEAHDAEGPFDEHGRILVTSEALARVTRSA |
Ga0209001_10841651 | 3300025002 | Soil | ELIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA |
Ga0209108_102914244 | 3300025165 | Soil | AYRELIEGGASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0209641_104997411 | 3300025322 | Soil | DHADRRHFSGTDGAVFEAYRELIEAVASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0209640_100645381 | 3300025324 | Soil | GAVFDAYRELIEGVASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0209341_110389171 | 3300025325 | Soil | EALRDHAARVQLSGRDGDVFQAYRELIESVASDAFDAEGPFDDHGRVLVTSEALARVTRS |
Ga0209342_111240392 | 3300025326 | Soil | LIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA |
Ga0209751_104877641 | 3300025327 | Soil | VHFSGTDGAVFEAYRELIEDLASEAFDAEGPFDEHGRVLVTSEALARVTRSA |
Ga0210131_10406211 | 3300025551 | Natural And Restored Wetlands | VSHEALRDHADRMHFSGTDSAIFDAYRELIEGVASDAHDAEGPFDAHGRIIVTSEALARVMRSA |
Ga0207642_101379574 | 3300025899 | Miscanthus Rhizosphere | GTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTSEALTRVMRSA |
Ga0207688_101375593 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207688_103761632 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | QTFRELIEELASDAFDAEGPFDNHGRVLISSEALARITRSA |
Ga0207688_106136871 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | DSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0207647_100235761 | 3300025904 | Corn Rhizosphere | ALRDHADRLHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207685_100125193 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0207699_101499351 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DSAVFQAYRELIEEPASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207699_112394731 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DATIFEAYRELIEQIASDAYDAEGPVDDHGRILVTSEALARVTRSA |
Ga0207645_102312673 | 3300025907 | Miscanthus Rhizosphere | AVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207693_105288823 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207693_108038892 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0207663_101249004 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FQAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207662_100254395 | 3300025918 | Switchgrass Rhizosphere | DRLHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207657_100073131 | 3300025919 | Corn Rhizosphere | HEALRDHADRVHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207657_101494022 | 3300025919 | Corn Rhizosphere | RELIEQVASDAYDAGAKVDDAGCVLVTSEAIDRVSRSA |
Ga0207649_107926241 | 3300025920 | Corn Rhizosphere | VHFSGTDGAAFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207649_110019021 | 3300025920 | Corn Rhizosphere | LIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207681_102813062 | 3300025923 | Switchgrass Rhizosphere | LIEELSIDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0207681_104483602 | 3300025923 | Switchgrass Rhizosphere | RELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207650_102964581 | 3300025925 | Switchgrass Rhizosphere | RAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207664_101835574 | 3300025929 | Agricultural Soil | IVLFFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207644_100579801 | 3300025931 | Switchgrass Rhizosphere | EAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207690_100506831 | 3300025932 | Corn Rhizosphere | HFSGTDGAAFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207670_109896371 | 3300025936 | Switchgrass Rhizosphere | IEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0207704_1001732011 | 3300025938 | Miscanthus Rhizosphere | YRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207665_110099291 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PDEKVFEAYRELIEQVASDAYDAGTSFDDAGLILVASEALARVGRSA |
Ga0207691_101304503 | 3300025940 | Miscanthus Rhizosphere | YRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207679_109132703 | 3300025945 | Corn Rhizosphere | KVSHEALRAHAERSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0207667_107195602 | 3300025949 | Corn Rhizosphere | VACKVNHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207667_114706641 | 3300025949 | Corn Rhizosphere | ELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207667_120582361 | 3300025949 | Corn Rhizosphere | VADDNVFEAYRELIEQVASDACDAGANVDDAGCVLVTSEALDRVSRSA |
Ga0207712_103204191 | 3300025961 | Switchgrass Rhizosphere | QAYRELIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207712_103846013 | 3300025961 | Switchgrass Rhizosphere | RELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0207640_103610431 | 3300025981 | Corn Rhizosphere | GSDSAIFQAYRELIEELASDAFDAEGPFDNHGRALVTSEALTRITRSA |
Ga0207658_100766991 | 3300025986 | Switchgrass Rhizosphere | ALRDHADCLHFSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0207641_103763911 | 3300026088 | Switchgrass Rhizosphere | MRFSGTDGAVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA |
Ga0207648_104695621 | 3300026089 | Miscanthus Rhizosphere | CKVSHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0207698_121796301 | 3300026142 | Corn Rhizosphere | CRVSHEALRGHADRMRFSGTDGVVFEAYRELIEEVASEAHDAEGPFDDHGRILVTTEALTRVMRSA |
Ga0209879_10467311 | 3300027056 | Groundwater Sand | RELIEGVASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0209517_101373821 | 3300027854 | Peatlands Soil | ELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA |
Ga0209382_116884001 | 3300027909 | Populus Rhizosphere | VNHEALRAQAERVHFSGSDSAVFQAYRELIEELASDAFHAEGPFDNHGRVLVTSEALTRITRSA |
Ga0209889_10339082 | 3300027952 | Groundwater Sand | AYRELIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA |
Ga0209857_10315223 | 3300027957 | Groundwater Sand | MHFSGTDGAVFDAYRELIEGIASEAHDAEGPFDAHGRILVTSEALARVTRSA |
Ga0268265_104827211 | 3300028380 | Switchgrass Rhizosphere | FSGTDGAVFEAYRELIEQVASDAYDAEGPFDDNGRVLVTPEALARVTRSA |
Ga0247827_113349091 | 3300028889 | Soil | HLAANDNEIFEAYRELIEQVASDAFDAQAGVDEAGCVVVTKEALDRVGRSA |
Ga0299907_105375271 | 3300030006 | Soil | LHLAGTDAEVFEGYRELIEQIASDTHDAEGPFDDHGRVLVTSEAIARVMRSA |
Ga0299907_109738251 | 3300030006 | Soil | SHEALRDHADRMHFSGTDGAVFDAYRELIEEVASEAHDAEGPFDEHGRILVTSEALARVTRSA |
Ga0299907_111219931 | 3300030006 | Soil | LPGTDADVFAACRELIEQIASDAYDAEGPFDDHGRVLVTSEALARVTRSA |
Ga0311333_112996281 | 3300030114 | Fen | FEGADKEIFEAYREIIEQIASDAFDADAGVDDDGAILVTSEALDRVGRSA |
Ga0299906_103510983 | 3300030606 | Soil | VFEKYRELIEDIASEAFDAGGPLDHQGRILVTSEALARVTRSA |
Ga0299915_100655984 | 3300030613 | Soil | YRELIEEVASEAHDAEGPFDAHGRVLVTSEALARVTRSA |
Ga0302046_109874291 | 3300030620 | Soil | GRVHFSGTDGAVFEAYRELIEDLASEAFDAEGPFDEHGRVLVTSEALARVTRSA |
Ga0316363_1000378017 | 3300030659 | Peatlands Soil | EKVFEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA |
Ga0310038_100669051 | 3300030707 | Peatlands Soil | FEAYRELIEQVASDAFDAGASVDDAGLVLVTSEALARVGRSA |
Ga0307498_100471013 | 3300031170 | Soil | DEKIFEVYRELIEQVASDAYDAGTSVDEAGLVLVTAEALARVGRSA |
Ga0310886_110436342 | 3300031562 | Soil | RSHASGTDSAVFQAYRELIEELASDAFDAEGPFDNHGRVLVTSGALTRITRSA |
Ga0318542_104092872 | 3300031668 | Soil | HAERVHLSSSDSEVFEAYRELIEDLASEAFDAEGPFDQHGRVLVTSEAIARITRSA |
Ga0318561_104793581 | 3300031679 | Soil | EALRDHADRLHLSGRDGVVFETYRELIEQVASDAYDAEGPYDMEGRILVTSEALARVLRS |
Ga0302321_1004190471 | 3300031726 | Fen | EIIEQIASDAFDADAGVDDDGAILVTSEALDRVGRSA |
Ga0307468_1006158191 | 3300031740 | Hardwood Forest Soil | LIEEVASETHDAEGPFDAHGGVLVTSEALARVTRSA |
Ga0307468_1019758202 | 3300031740 | Hardwood Forest Soil | FEAYRELIEQVASDTFDAGVNVDEAGCILVTKEALDRVARSA |
Ga0318547_102067494 | 3300031781 | Soil | YRELIEDLASEAFDIEGPFDQHGRVLVTSEAIARITRSA |
Ga0318576_106293901 | 3300031796 | Soil | LIEQVASDAYDAGANVDDIGCVLVTSEALDRVSRSA |
Ga0310917_102161252 | 3300031833 | Soil | TYRELIEQVASDAYDAEGPYDMEGRILVTSEALARVLRSA |
Ga0310917_102746831 | 3300031833 | Soil | VFEAYRELIEDLASEAFDIEGPFDQHGRVLVTSEAIARITRSA |
Ga0310907_100623003 | 3300031847 | Soil | YRELIEELASVAYDAEAPIDDHGRVLVTSEAIARITRSA |
Ga0310901_100465251 | 3300031940 | Soil | RVQLSGTDGAVFQAYRELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA |
Ga0310903_104584261 | 3300032000 | Soil | ELVEQVASDAYDAGTSYDESGLVLVTSEALARVGRSA |
Ga0310899_105062311 | 3300032017 | Soil | LRDHANRVQLSGTDGAVFEAYRELIEELASVAYDAETPFDEFGRVLVTSEAIARITRSA |
Ga0310890_103473871 | 3300032075 | Soil | RELIEELASAAYDAEAPFDDHGRVLVTSEAIARITRSA |
Ga0307472_1004919311 | 3300032205 | Hardwood Forest Soil | LIEELASDAFDAEGPFDNHGRVLVTSEALTRITRSA |
Ga0307472_1016131103 | 3300032205 | Hardwood Forest Soil | EAYRELIEQVASDAYDAGTSVDDAGLVLVTSEALARVGRSA |
Ga0307472_1019749381 | 3300032205 | Hardwood Forest Soil | EKVFEAYRELIEQVASDAYDAGTSFDDAGLILVTSEALARVGRSA |
Ga0306920_1030695691 | 3300032261 | Soil | RDGVVFETYRKLIEQVASDAYDAEGPYDMEGRILVTSEALARVLRSA |
Ga0335082_106096591 | 3300032782 | Soil | FETYRELIEDLASEAFDAEGPFDRHGRVLVTSEALARVMRSA |
Ga0247830_102774231 | 3300033551 | Soil | RELIEQAASDAYDAEGPFDDHGRVLVTSEALARVTRSA |
Ga0247830_106388032 | 3300033551 | Soil | EAYRELVEQVASDAYDAGTSYDESGLVLVTSEALARVGRSA |
Ga0326723_0247144_652_795 | 3300034090 | Peat Soil | TDGAVFDAYRELIEEVASVAHDAEGPFDDHGRILVTSEALAQVTRSA |
⦗Top⦘ |