NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012802

Metagenome / Metatranscriptome Family F012802

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012802
Family Type Metagenome / Metatranscriptome
Number of Sequences 277
Average Sequence Length 42 residues
Representative Sequence MPELVVRGWRRALHNQRALYVKRLLLFEPHVILASVPYQLVR
Number of Associated Samples 227
Number of Associated Scaffolds 277

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.33 %
% of genes near scaffold ends (potentially truncated) 91.34 %
% of genes from short scaffolds (< 2000 bps) 90.61 %
Associated GOLD sequencing projects 214
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.227 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.163 % of family members)
Environment Ontology (ENVO) Unclassified
(24.910 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.736 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.86%    β-sheet: 0.00%    Coil/Unstructured: 67.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 277 Family Scaffolds
PF13520AA_permease_2 17.69
PF00582Usp 16.97
PF03030H_PPase 6.86
PF01554MatE 2.89
PF00107ADH_zinc_N 2.53
PF08240ADH_N 2.17
PF00486Trans_reg_C 1.81
PF02746MR_MLE_N 1.44
PF13602ADH_zinc_N_2 1.08
PF12697Abhydrolase_6 1.08
PF14667Polysacc_synt_C 1.08
PF00719Pyrophosphatase 0.72
PF08281Sigma70_r4_2 0.72
PF13493DUF4118 0.72
PF05199GMC_oxred_C 0.72
PF03814KdpA 0.72
PF01872RibD_C 0.72
PF02790COX2_TM 0.72
PF03006HlyIII 0.72
PF04185Phosphoesterase 0.72
PF06772LtrA 0.72
PF09948DUF2182 0.72
PF00704Glyco_hydro_18 0.36
PF01642MM_CoA_mutase 0.36
PF12802MarR_2 0.36
PF00534Glycos_transf_1 0.36
PF03703bPH_2 0.36
PF00583Acetyltransf_1 0.36
PF00892EamA 0.36
PF00156Pribosyltran 0.36
PF01243Putative_PNPOx 0.36
PF01966HD 0.36
PF07992Pyr_redox_2 0.36
PF00589Phage_integrase 0.36
PF01883FeS_assembly_P 0.36
PF04951Peptidase_M55 0.36
PF00580UvrD-helicase 0.36
PF05988DUF899 0.36
PF00313CSD 0.36
PF00324AA_permease 0.36
PF04828GFA 0.36
PF08002DUF1697 0.36
PF00224PK 0.36
PF13751DDE_Tnp_1_6 0.36
PF00933Glyco_hydro_3 0.36
PF01083Cutinase 0.36
PF07963N_methyl 0.36
PF08447PAS_3 0.36
PF02597ThiS 0.36
PF13378MR_MLE_C 0.36
PF03793PASTA 0.36
PF08331QueG_DUF1730 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 277 Family Scaffolds
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 6.86
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 2.89
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.72
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.72
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.72
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.72
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.72
COG2060K+-transporting ATPase, KdpA subunitInorganic ion transport and metabolism [P] 0.72
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.72
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.72
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.72
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.36
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.36
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.36
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.36
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.36
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.36
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.36
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.36
COG1600Epoxyqueuosine reductase QueG (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.36
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.36
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.36
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.36
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.36
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.36
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.36
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 0.36
COG3973DNA helicase IVReplication, recombination and repair [L] 0.36
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.23 %
UnclassifiedrootN/A18.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309009|GPKNP_GG3DY5402HHQVZAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
2166559005|cont_contig73682Not Available702Open in IMG/M
2170459010|GIO7OMY01B0TJDNot Available504Open in IMG/M
2170459019|G14TP7Y02I7D1DAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300000550|F24TB_16796791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300000956|JGI10216J12902_103549214All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300001333|A21PFW6_1192700All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300001686|C688J18823_10217615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1282Open in IMG/M
3300002070|JGI24750J21931_1074317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300004479|Ga0062595_100409550All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300004643|Ga0062591_100945856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300004643|Ga0062591_101645869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300005171|Ga0066677_10320618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium887Open in IMG/M
3300005171|Ga0066677_10831169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300005178|Ga0066688_10115974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1651Open in IMG/M
3300005178|Ga0066688_10783958All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005186|Ga0066676_11183341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300005329|Ga0070683_100437744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300005330|Ga0070690_100983348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300005332|Ga0066388_103524455All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300005334|Ga0068869_101078674All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005338|Ga0068868_100992353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300005341|Ga0070691_10813280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300005439|Ga0070711_100109496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2025Open in IMG/M
3300005439|Ga0070711_100247147All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300005467|Ga0070706_101911659All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005468|Ga0070707_100008142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia9725Open in IMG/M
3300005526|Ga0073909_10299070All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005532|Ga0070739_10408020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300005545|Ga0070695_101875403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300005555|Ga0066692_10848459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia561Open in IMG/M
3300005556|Ga0066707_10248428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1160Open in IMG/M
3300005556|Ga0066707_10896201All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005558|Ga0066698_10235611All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300005560|Ga0066670_10655877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300005561|Ga0066699_10177504All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300005563|Ga0068855_101475766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300005566|Ga0066693_10115337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300005566|Ga0066693_10138267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300005568|Ga0066703_10345192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300005568|Ga0066703_10774981All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005587|Ga0066654_10876627All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005616|Ga0068852_102162737All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005764|Ga0066903_103798283All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300005764|Ga0066903_107650649All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005764|Ga0066903_108830041All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005840|Ga0068870_10924840All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005937|Ga0081455_10030991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4847Open in IMG/M
3300005993|Ga0080027_10231471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300006032|Ga0066696_10176468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1350Open in IMG/M
3300006032|Ga0066696_10839495All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300006032|Ga0066696_10998460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300006046|Ga0066652_101004310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300006046|Ga0066652_101190336All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006173|Ga0070716_100793209All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300006173|Ga0070716_101713577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300006175|Ga0070712_100584853All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300006577|Ga0074050_11165675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300006797|Ga0066659_10782575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300006800|Ga0066660_10489803All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300006806|Ga0079220_10943277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi676Open in IMG/M
3300006852|Ga0075433_11655269All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300006871|Ga0075434_101077917All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300007076|Ga0075435_100118213All Organisms → cellular organisms → Bacteria2210Open in IMG/M
3300009012|Ga0066710_100171718All Organisms → cellular organisms → Bacteria3049Open in IMG/M
3300009038|Ga0099829_11096140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300009098|Ga0105245_11314627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300009098|Ga0105245_12627346Not Available557Open in IMG/M
3300009100|Ga0075418_10335540All Organisms → cellular organisms → Bacteria1613Open in IMG/M
3300009100|Ga0075418_10648312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1137Open in IMG/M
3300009137|Ga0066709_100760232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1400Open in IMG/M
3300009137|Ga0066709_100905169All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300009156|Ga0111538_11244108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria940Open in IMG/M
3300009156|Ga0111538_11279353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium926Open in IMG/M
3300009156|Ga0111538_13548771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300009176|Ga0105242_10318292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1426Open in IMG/M
3300009545|Ga0105237_11397049Not Available706Open in IMG/M
3300009551|Ga0105238_11422472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300009789|Ga0126307_10433561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300009789|Ga0126307_10863262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300010042|Ga0126314_10296455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1153Open in IMG/M
3300010046|Ga0126384_12471367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300010152|Ga0126318_10727626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300010323|Ga0134086_10390781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300010325|Ga0134064_10223663All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300010333|Ga0134080_10423347Not Available620Open in IMG/M
3300010333|Ga0134080_10690536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300010337|Ga0134062_10756344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300010371|Ga0134125_11553315Not Available720Open in IMG/M
3300010375|Ga0105239_13602643All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010376|Ga0126381_100691866Not Available1458Open in IMG/M
3300010376|Ga0126381_105079402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300010396|Ga0134126_11649281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300010398|Ga0126383_10076552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2902Open in IMG/M
3300010400|Ga0134122_12215291Not Available593Open in IMG/M
3300011269|Ga0137392_10639848Not Available882Open in IMG/M
3300011270|Ga0137391_10919432Not Available715Open in IMG/M
3300012014|Ga0120159_1060264Not Available1167Open in IMG/M
3300012189|Ga0137388_11387876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300012199|Ga0137383_10289843Not Available1199Open in IMG/M
3300012200|Ga0137382_11128955Not Available559Open in IMG/M
3300012205|Ga0137362_10869837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300012208|Ga0137376_10212090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1677Open in IMG/M
3300012208|Ga0137376_11507377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300012209|Ga0137379_11184657Not Available670Open in IMG/M
3300012209|Ga0137379_11494811Not Available576Open in IMG/M
3300012210|Ga0137378_10573529Not Available1037Open in IMG/M
3300012210|Ga0137378_10994689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300012210|Ga0137378_11422232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300012211|Ga0137377_11756433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300012212|Ga0150985_100434699All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300012350|Ga0137372_10093047All Organisms → cellular organisms → Bacteria → Proteobacteria2543Open in IMG/M
3300012350|Ga0137372_11215708Not Available508Open in IMG/M
3300012353|Ga0137367_10134337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1811Open in IMG/M
3300012354|Ga0137366_10930184Not Available610Open in IMG/M
3300012355|Ga0137369_10287102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1227Open in IMG/M
3300012356|Ga0137371_10082389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2497Open in IMG/M
3300012358|Ga0137368_10176691All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300012358|Ga0137368_10489295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300012358|Ga0137368_10956656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012359|Ga0137385_11618811Not Available511Open in IMG/M
3300012360|Ga0137375_10889371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300012363|Ga0137390_11199467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300012896|Ga0157303_10179118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300012897|Ga0157285_10067564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300012898|Ga0157293_10025769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1140Open in IMG/M
3300012899|Ga0157299_10153217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300012905|Ga0157296_10095298All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300012923|Ga0137359_10028357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4792Open in IMG/M
3300012951|Ga0164300_10170617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300012955|Ga0164298_11503371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300012958|Ga0164299_11663422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300012960|Ga0164301_10139035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1467Open in IMG/M
3300012960|Ga0164301_11684428All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300012961|Ga0164302_11583690Not Available544Open in IMG/M
3300012972|Ga0134077_10034615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1811Open in IMG/M
3300012975|Ga0134110_10516108Not Available545Open in IMG/M
3300012977|Ga0134087_10638081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300012989|Ga0164305_10118469All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300012989|Ga0164305_10382586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1071Open in IMG/M
3300013100|Ga0157373_10954347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300013105|Ga0157369_10075031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3626Open in IMG/M
3300013297|Ga0157378_12705511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides549Open in IMG/M
3300013765|Ga0120172_1015057All Organisms → cellular organisms → Bacteria2362Open in IMG/M
3300014157|Ga0134078_10237756Not Available759Open in IMG/M
3300014157|Ga0134078_10295905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300014157|Ga0134078_10415570All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300014314|Ga0075316_1104134All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300014325|Ga0163163_10491085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1289Open in IMG/M
3300014497|Ga0182008_10141224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300014968|Ga0157379_10158790All Organisms → cellular organisms → Bacteria → Acidobacteria2041Open in IMG/M
3300014968|Ga0157379_11011650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300015077|Ga0173483_10396719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300015264|Ga0137403_11467958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300015265|Ga0182005_1209400Not Available589Open in IMG/M
3300015357|Ga0134072_10252386All Organisms → cellular organisms → Bacteria → Terrabacteria group636Open in IMG/M
3300015359|Ga0134085_10166180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria941Open in IMG/M
3300015359|Ga0134085_10547324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300015371|Ga0132258_11503064Not Available1701Open in IMG/M
3300015372|Ga0132256_101242533Not Available858Open in IMG/M
3300015372|Ga0132256_103284559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300015373|Ga0132257_100056709All Organisms → cellular organisms → Bacteria4383Open in IMG/M
3300015373|Ga0132257_100835631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1151Open in IMG/M
3300015373|Ga0132257_101023701All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300015373|Ga0132257_103574670Not Available566Open in IMG/M
3300015374|Ga0132255_100181576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2964Open in IMG/M
3300015374|Ga0132255_103647215Not Available655Open in IMG/M
3300016319|Ga0182033_10383825Not Available1183Open in IMG/M
3300017937|Ga0187809_10182409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300017959|Ga0187779_10112634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1649Open in IMG/M
3300017974|Ga0187777_10234021Not Available1244Open in IMG/M
3300017974|Ga0187777_11485151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300018027|Ga0184605_10417264Not Available597Open in IMG/M
3300018028|Ga0184608_10095353All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300018054|Ga0184621_10110127All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300018060|Ga0187765_10288768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium979Open in IMG/M
3300018061|Ga0184619_10148900All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300018061|Ga0184619_10218121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium877Open in IMG/M
3300018061|Ga0184619_10270005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300018064|Ga0187773_10111778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1361Open in IMG/M
3300018071|Ga0184618_10172986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300018071|Ga0184618_10373032All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300018076|Ga0184609_10210438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium907Open in IMG/M
3300018431|Ga0066655_10794809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300018468|Ga0066662_10610638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300019878|Ga0193715_1062607Not Available789Open in IMG/M
3300019886|Ga0193727_1053005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1304Open in IMG/M
3300019888|Ga0193751_1157397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium808Open in IMG/M
3300020018|Ga0193721_1029548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1450Open in IMG/M
3300020080|Ga0206350_11615297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300021078|Ga0210381_10051366Not Available1236Open in IMG/M
3300021377|Ga0213874_10023223Not Available1728Open in IMG/M
3300021560|Ga0126371_12340242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300022694|Ga0222623_10239408All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300022737|Ga0247747_1006235All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300022899|Ga0247795_1011501All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300024290|Ga0247667_1014295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1577Open in IMG/M
3300024331|Ga0247668_1063084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300025898|Ga0207692_10196180Not Available1184Open in IMG/M
3300025905|Ga0207685_10079011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1356Open in IMG/M
3300025910|Ga0207684_10023478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5266Open in IMG/M
3300025911|Ga0207654_11137818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300025916|Ga0207663_10268777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1262Open in IMG/M
3300025921|Ga0207652_10881638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300025922|Ga0207646_11085438All Organisms → cellular organisms → Bacteria → Terrabacteria group705Open in IMG/M
3300025924|Ga0207694_11363863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300025927|Ga0207687_11532201All Organisms → cellular organisms → Bacteria → Terrabacteria group572Open in IMG/M
3300025928|Ga0207700_10102006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2291Open in IMG/M
3300025929|Ga0207664_10021904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4762Open in IMG/M
3300025929|Ga0207664_11753148Not Available543Open in IMG/M
3300025931|Ga0207644_11176711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300025939|Ga0207665_10672610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300025941|Ga0207711_10706438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium940Open in IMG/M
3300025945|Ga0207679_11994442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300025990|Ga0208527_1009398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1194Open in IMG/M
3300026021|Ga0208140_1021393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium902Open in IMG/M
3300026023|Ga0207677_11983077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300026075|Ga0207708_10240061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1457Open in IMG/M
3300026078|Ga0207702_12444692All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300026300|Ga0209027_1206671Not Available632Open in IMG/M
3300026308|Ga0209265_1011342All Organisms → cellular organisms → Bacteria → Terrabacteria group2769Open in IMG/M
3300026316|Ga0209155_1009462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4273Open in IMG/M
3300026324|Ga0209470_1093741All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300026326|Ga0209801_1285456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300026331|Ga0209267_1063732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1628Open in IMG/M
3300026547|Ga0209156_10111740All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300027821|Ga0209811_10123297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300027882|Ga0209590_10764418Not Available616Open in IMG/M
3300027909|Ga0209382_11955116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300027986|Ga0209168_10095959Not Available1533Open in IMG/M
3300028047|Ga0209526_10421649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300028711|Ga0307293_10005287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3418Open in IMG/M
3300028716|Ga0307311_10069603Not Available955Open in IMG/M
3300028718|Ga0307307_10238427All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300028719|Ga0307301_10042318All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300028721|Ga0307315_10183097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300028771|Ga0307320_10180552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300028784|Ga0307282_10208736Not Available934Open in IMG/M
3300028787|Ga0307323_10287857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300028787|Ga0307323_10323326Not Available553Open in IMG/M
3300028793|Ga0307299_10392467Not Available520Open in IMG/M
3300028799|Ga0307284_10011656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2648Open in IMG/M
3300028799|Ga0307284_10106768All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300028814|Ga0307302_10138540Not Available1175Open in IMG/M
3300028814|Ga0307302_10218228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium932Open in IMG/M
3300028824|Ga0307310_10321299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300028828|Ga0307312_10936661Not Available574Open in IMG/M
3300028872|Ga0307314_10137704Not Available696Open in IMG/M
3300028872|Ga0307314_10183670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300028876|Ga0307286_10007948All Organisms → cellular organisms → Bacteria3232Open in IMG/M
3300028878|Ga0307278_10016028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3477Open in IMG/M
3300028881|Ga0307277_10091994All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300028884|Ga0307308_10181859All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300029989|Ga0311365_10161190All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300029990|Ga0311336_11924901Not Available524Open in IMG/M
3300030838|Ga0311335_10049125Not Available2628Open in IMG/M
3300031170|Ga0307498_10352005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300031251|Ga0265327_10043670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2396Open in IMG/M
3300031544|Ga0318534_10369050Not Available825Open in IMG/M
3300031572|Ga0318515_10209637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300031716|Ga0310813_10852758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300031753|Ga0307477_10027943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3859Open in IMG/M
3300031753|Ga0307477_10504193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300031768|Ga0318509_10571639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300031805|Ga0318497_10862836Not Available508Open in IMG/M
3300031858|Ga0310892_11296226Not Available521Open in IMG/M
3300031893|Ga0318536_10328463Not Available775Open in IMG/M
3300031996|Ga0308176_10604573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1127Open in IMG/M
3300032001|Ga0306922_11899797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300032035|Ga0310911_10719823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300032892|Ga0335081_10838373All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300032897|Ga0335071_10382415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1361Open in IMG/M
3300033551|Ga0247830_11011836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces acidiscabies663Open in IMG/M
3300033807|Ga0314866_037844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300033807|Ga0314866_090490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300034125|Ga0370484_0138722Not Available649Open in IMG/M
3300034354|Ga0364943_0175520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.16%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.05%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.08%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.08%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.08%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.72%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.72%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.36%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.36%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.36%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.36%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.36%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.36%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.36%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.36%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.36%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.36%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.36%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.36%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.36%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.36%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.36%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309009Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025990Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026021Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKNP_094600802070309009SoilLVFNGARKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP
cont_0682.000052502166559005SimulatedVLVLMPELFTRGWRRLLHNQKALYVKRLLFEPHVVLASVPYQLLR
F62_083526502170459010Grass SoilMPEMIVRGWARALHNQRALYIKRLLLFEPHVILSSVPYQLFR
4MG_042820502170459019Switchgrass, Maize And Mischanthus LitterDEQRATASSLPELSLRGWRRLLHNQRALYAKRLLLVEPNVDPGLVPYQLIR
F24TB_1679679113300000550SoilPELIFTGSARLLHNQRALYIKRLLLFEPRVILASVPYRLD*
JGI10216J12902_10354921433300000956SoilIVRGADRLLHNQRALYLKRLLLFEPRVILTSVPYQLL*
A21PFW6_119270023300001333PermafrostVAVVVMPELVVRGANRLLHNQRALYLKRLLLFEPRVILTSVPFQLT*
C688J18823_1021761533300001686SoilWQRLLHNQRALYVKRLLLFEPRVILSSVPYQLFR*
JGI24750J21931_107431733300002070Corn, Switchgrass And Miscanthus RhizosphereGWRRALHNQRALYVKRLLLFEPRVILTSVPYQLLR*
Ga0062595_10040955013300004479SoilELVFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRAG*
Ga0062591_10094585623300004643SoilELIFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLS*
Ga0062591_10164586913300004643SoilVNIVMPEVVVRGWARFLHNQRALYVKRLLLFERHVILSSVPYQLFR*
Ga0066677_1032061823300005171SoilVMPELVVRGPTRVLHNQRALYLKRLLLFEPRVILASVPYQLLR*
Ga0066677_1083116923300005171SoilVAAVMPEIVVRGRSRLLHNQRALYVKRLLLFEPRVLLTSVPYQLFR*
Ga0066688_1011597413300005178SoilMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLMR*
Ga0066688_1078395813300005178SoilELIFSGPQRLLHNQRALYIKRLLLFEPRVILSSVPYSLG*
Ga0066676_1118334123300005186SoilMPELIFRGWRRLLHNQRAVYVKRLLLFEPRVILATVPYPLN*
Ga0070683_10043774413300005329Corn RhizosphereMPEVVVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR*
Ga0070690_10098334823300005330Switchgrass RhizosphereVMPELVFGGMSRALHNQRALYIKRLLLFEPRVILASVPYRLD*
Ga0066388_10352445523300005332Tropical Forest SoilELTADESTVVLVVMPEIVTRGWRRLLHNHRALYIKRLLLLEPGVILASVPYQVL*
Ga0068869_10107867433300005334Miscanthus RhizosphereMPELVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT*
Ga0068868_10099235333300005338Miscanthus RhizosphereVLVVVPELVVRGPARLLHNQRALYVKRLLLFEPRVVLAAVPFQLG*
Ga0070691_1081328023300005341Corn, Switchgrass And Miscanthus RhizospherePELIFSGPQRLMHNQRALYVKRLLLFEPRVILTAVPYRLT*
Ga0070711_10010949613300005439Corn, Switchgrass And Miscanthus RhizosphereEIVVRGWQRLLHNQRALYVKRLLLFEPRVILSSVPYQLFR*
Ga0070711_10024714723300005439Corn, Switchgrass And Miscanthus RhizosphereLVMPELVVRGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR*
Ga0070706_10191165913300005467Corn, Switchgrass And Miscanthus RhizosphereELVTRGWRRALHNQRSLYVKRLLLFEPNVILASVPYQILR*
Ga0070707_10000814213300005468Corn, Switchgrass And Miscanthus RhizosphereELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR*
Ga0073909_1029907013300005526Surface SoilVVMPELVFNGARKLLHNQRALYIKRLLLFEPRVILSSVPYHLP*
Ga0070739_1040802013300005532Surface SoilGTEVLVVMPELVFRGWRRLLHNQRALYVKRLLLVEPHVALASVPYQLLR*
Ga0070695_10187540323300005545Corn, Switchgrass And Miscanthus RhizosphereLRELTAEEGTEVLVVMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0066692_1084845923300005555SoilSLAAVVMPELIVRGTDRLLHNQRAMYLKRLLLFEPRVILTSVPYQLV*
Ga0066707_1024842823300005556SoilVVMPELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR*
Ga0066707_1089620113300005556SoilAVVVMPELVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPYQLL*
Ga0066698_1023561113300005558SoilIFHGPSRLLHNQRALYIKRLLLFERRVILASVPYRLN*
Ga0066670_1065587713300005560SoilMPELIVRGTDRLLHNQRAMYLKRLLLFEPRVILTSVPYQLV*
Ga0066699_1017750433300005561SoilVLMPELVFGGTARLLHNQRALYIKRLLLFEPRVILASVPYRLD*
Ga0068855_10147576613300005563Corn RhizosphereVMPEIVVRGWARALHNQRALYIKRLLLFEPRVILSSVPYQLFR*
Ga0066693_1011533723300005566SoilGWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR*
Ga0066693_1013826713300005566SoilMPEIVTRGWRRVLHNHRALYVKRLLLLEPGVVLASVPYQVL*
Ga0066703_1034519213300005568SoilVVMPELVVRGASRVLHNQRALYFKRLLLFEPRVILVSVPYQLIR*
Ga0066703_1077498113300005568SoilGGDDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR*
Ga0066654_1087662723300005587SoilLRGWARVLHNQRALYVKRLLLVEPNVILASVPYQLLR*
Ga0068852_10216273723300005616Corn RhizosphereLTAEDRDVLVVLPELILRGWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR*
Ga0066903_10379828323300005764Tropical Forest SoilELIVRGTDRLLHNQRALYLKRLLLFEPQVILTSVPFQLT*
Ga0066903_10765064923300005764Tropical Forest SoilGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT*
Ga0066903_10883004113300005764Tropical Forest SoilWRRLLHNQRALYLKRLLLFEPNVVLLSVPYQLLR*
Ga0068870_1092484013300005840Miscanthus RhizosphereVMPELVFTGVRKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP*
Ga0081455_1003099113300005937Tabebuia Heterophylla RhizosphereNGVRKLLHNQRALYIKRLLLFEPNVLLTSVPYHLP*
Ga0080027_1023147113300005993Prmafrost SoilEPGTVVNLVMPEIVVRGRARLLHNQRALYIKRLLLFEPHVILSSVPYQIFR*
Ga0066696_1017646813300006032SoilEIVVRGRSRLLHNQRALYVKRLLLFEPHVLLTSVPYQLFR*
Ga0066696_1083949523300006032SoilLVMPELVVRGLSRVLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0066696_1099846023300006032SoilVRGWARLLHNQRALYLKRLLLFEPHIILSSVPYQLFR*
Ga0066652_10100431023300006046SoilLVVRGADRLLHNQRALYLKRLLLFEPQVILTSVPYQLS*
Ga0066652_10119033623300006046SoilRGWRRLLHNQKALYVKRLLLFESNVILASVPYQLLR*
Ga0070716_10079320923300006173Corn, Switchgrass And Miscanthus RhizosphereLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR*
Ga0070716_10171357723300006173Corn, Switchgrass And Miscanthus RhizosphereEVLVVMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0070712_10058485313300006175Corn, Switchgrass And Miscanthus RhizosphereTVVNIVMPEMVVRGSARLLHNQRALYIKRLLLFERHVILSSVPYQLFR*
Ga0074050_1116567513300006577SoilELIFSGLSRTLHNQRALYIKRLLLFEPRVILSSVPYRLD*
Ga0066659_1078257513300006797SoilPEIVVRGRSRLLHNQRALYVKRLLLFEPRVILTSVPYQLLR*
Ga0066660_1048980333300006800SoilELIFRGRQRLLHNQRALYIKRLLLFEERVILTAVPYRLN*
Ga0079220_1094327713300006806Agricultural SoilLRGWRRLLHNQRALYVKRLLLVEPNVILASVPYHLIR*
Ga0075433_1165526923300006852Populus RhizosphereELTADGRTEVVLVMPELVVRGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR*
Ga0075434_10107791713300006871Populus RhizosphereAITDDGRDVLVVLPELILRGWARLLHNQRALYVKRLLIVEPHVILASVPYQLIR*
Ga0075435_10011821313300007076Populus RhizosphereNVVMPEIVVRGWARLLHNQRALYIKRLLLFEKHVILSSVPYQVFR*
Ga0066710_10017171833300009012Grasslands SoilMPELVLNGPRKHLHNQRALYVKRLLLFEPRVILISVPYQLPR
Ga0099829_1109614013300009038Vadose Zone SoilFSGLARTLHNQRALYVKRLLLFEPRVVLSSVPYRLD*
Ga0105245_1131462723300009098Miscanthus RhizosphereVVMPELVFSGMARALHNQRALYIKRLLLFEPRVILASVPYRMD*
Ga0105245_1262734613300009098Miscanthus RhizosphereRGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR*
Ga0075418_1033554013300009100Populus RhizosphereVVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT*
Ga0075418_1064831223300009100Populus RhizosphereVRGWARLLHNQRALYIKRLLLFEERVVLATVPYQL*
Ga0066709_10076023233300009137Grasslands SoilMPELVLNGPRKHLHNQRALYVKRLLLFEPRVILISVPYQLPR*
Ga0066709_10090516923300009137Grasslands SoilVAVVVMPELVVRGTDRLPHNQRALYLKRLLLFEPRVILTSVPFQLT*
Ga0111538_1124410813300009156Populus RhizosphereTADDTAVNVVMPELVLRGRARLLHNQRALYLKRLLLFERRIILSSVPYQLFR*
Ga0111538_1127935333300009156Populus RhizosphereVVMPELVFNGARKLLHNQRALYIKRLLLFEPRVVLSTVPYHLP*
Ga0111538_1354877113300009156Populus RhizosphereMPELVVRGWARLLHNQRALYIKRLLLFEERVVLATVPYQL*
Ga0105242_1031829233300009176Miscanthus RhizosphereVVMPELVFHGMRKVLHNQRALYIKRLLLFERRVILSSVPYHLP*
Ga0105237_1139704923300009545Corn RhizosphereYTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0105238_1142247223300009551Corn RhizosphereRGWRRLLHNQRALYVKRLLLLEPNVLLASVPYPLVR*
Ga0126307_1043356133300009789Serpentine SoilELRIHGLPRVLHSQAALYIKRLLLFEPRIILTSVPYRLE*
Ga0126307_1086326233300009789Serpentine SoilPGIAVNVLMPELVLRGRARLLHNQRALYIKRLLLFEQRVILSSVPYQLFR*
Ga0126314_1029645533300010042Serpentine SoilELVLRGRARLLHNQRALYIKRLLLFERRVILSSVPYQLFR*
Ga0126384_1247136713300010046Tropical Forest SoilLIFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD*
Ga0126318_1072762623300010152SoilRGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR*
Ga0134086_1039078123300010323Grasslands SoilLHDLTEDGRTEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLIK*
Ga0134064_1022366323300010325Grasslands SoilGPSRLLHNQRALYIKRLLLFEPRVILASVPYRLN*
Ga0134080_1042334713300010333Grasslands SoilVLLPELVTRGRRRLLQNQRALYIKRLLLFGPDAVLASVPYQLLREPD*
Ga0134080_1069053623300010333Grasslands SoilEGQDVLVVLPEVILRGWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR*
Ga0134062_1075634423300010337Grasslands SoilVLNRAQRLLHNQRALYIKRLLLFEPRVILTSVPYRLG*
Ga0134125_1155331523300010371Terrestrial SoilVLVLMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0105239_1360264323300010375Corn RhizosphereVRGWRRLLHNQRALYVKRLLLFEPRVILSSVPYQLFR*
Ga0126381_10069186613300010376Tropical Forest SoilLIFRGWRRLLHNQRAIYIKRLLLFEPRVILVTVPYRLN*
Ga0126381_10507940213300010376Tropical Forest SoilEIVVGGMRRVLHNQRALYVKRMLLFEPRVILSAVPYQLV*
Ga0134126_1164928113300010396Terrestrial SoilLLFTGPLRLLHNQRALYVKRLLLFEPRVILTAVPYRLT*
Ga0126383_1007655243300010398Tropical Forest SoilPEVVVRGWSRLLHNQRALYVKRLLLFEPHVILSSVPTQAAA*
Ga0134122_1221529113300010400Terrestrial SoilPELVVRGWRRLLHNQRALYVKRLLLFEPNVVLAAVPYQLLR*
Ga0137392_1063984823300011269Vadose Zone SoilLVLMPELFVRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0137391_1091943213300011270Vadose Zone SoilAEEGTEVLVLMPELFVRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0120159_106026423300012014PermafrostTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0137388_1138787623300012189Vadose Zone SoilMPELVVRGTDRLLHNQRALYMKRLLLFEPRVILTSVPYQLL*
Ga0137383_1028984313300012199Vadose Zone SoilLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR*
Ga0137382_1112895513300012200Vadose Zone SoilWARALHNQRALYVKRLLLFERHVILSSVPYQLFR*
Ga0137362_1086983723300012205Vadose Zone SoilPELVVRGASRVLHNQRALYFKRLLLFEPRVILVSVPYQLIR*
Ga0137376_1021209023300012208Vadose Zone SoilVMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0137376_1150737713300012208Vadose Zone SoilVHGWARLLHNQRALYVKRLLLFEPHVVLASVPYQLP*
Ga0137379_1118465723300012209Vadose Zone SoilGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0137379_1149481113300012209Vadose Zone SoilIFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD*
Ga0137378_1057352923300012210Vadose Zone SoilLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR*
Ga0137378_1099468913300012210Vadose Zone SoilELVIPGWRKLLHNQRALYLKRLLLFEPRVVLSSVPYHLP*
Ga0137378_1142223213300012210Vadose Zone SoilLNVVMPEVVVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQFFR*
Ga0137377_1175643313300012211Vadose Zone SoilPESVAVVVMPELIVRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV*
Ga0150985_10043469933300012212Avena Fatua RhizosphereIGLRSLLSVHGPARLLHNQRAFYVKRLLLFEPRVVLASVPYQLR*
Ga0137372_1009304753300012350Vadose Zone SoilVRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV*
Ga0137372_1121570823300012350Vadose Zone SoilRTEVVLVLPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR*
Ga0137367_1013433733300012353Vadose Zone SoilFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLG*
Ga0137366_1093018413300012354Vadose Zone SoilSGSQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD*
Ga0137369_1028710233300012355Vadose Zone SoilRGRRPLLHNQRALYIKPLLRFAPRVILASVPYRLN*
Ga0137371_1008238913300012356Vadose Zone SoilVAIMPELIFSGAARLLHNQRALYIKRLLLFEPRVILTSVPYRLN*
Ga0137368_1017669113300012358Vadose Zone SoilPELIFSGPQRLLHNQRALYIKRLLLFEPQVILTSVPYRLG*
Ga0137368_1048929523300012358Vadose Zone SoilELIVRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV*
Ga0137368_1095665623300012358Vadose Zone SoilVAVVIMPELIFRGWRRLLHNQRALYIKRLLVFEPRVILASVPYRLN*
Ga0137385_1161881123300012359Vadose Zone SoilEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR*
Ga0137375_1088937113300012360Vadose Zone SoilRNVAVVVMPELVFHGWRRLLHNQRAFYVKRLLLFEPRVVLAAVPYSLD*
Ga0137390_1119946723300012363Vadose Zone SoilVVVMPELVVRGTDRLLHNQRALYMKRLLLFEPRVILTSVPYQLL*
Ga0157303_1017911823300012896SoilRELTGSGHDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR*
Ga0157285_1006756433300012897SoilMLEPVVHGWKPLLHNQRALYVKRLLLFEPRTTLSSVPYQLS*
Ga0157293_1002576933300012898SoilAVVVMPELVFSGVRKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP*
Ga0157299_1015321713300012899SoilGPQRLMHNQRALYVKRLLLFEPHVILTAVPYRLT*
Ga0157296_1009529823300012905SoilVFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLS*
Ga0137359_1002835763300012923Vadose Zone SoilMPELVTRGWARLLHNQRALYIKRLLLVEPGVILASVPYQLL*
Ga0164300_1017061713300012951SoilSGLSRTLHNQRALYIKRLLLFEPRVILASVPYRMD*
Ga0164298_1150337123300012955SoilLMPELVTRGWRRLLHNQRALYVKRLLLFEPNVILAAVPYQLLR*
Ga0164299_1166342223300012958SoilLPELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR*
Ga0164301_1013903533300012960SoilLVVLPELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR*
Ga0164301_1168442823300012960SoilEAMAIVVMPELVVRGVDRLLHHQRALYLKRLLLFEPRVILASVPYQLL*
Ga0164302_1158369013300012961SoilGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR*
Ga0134077_1003461513300012972Grasslands SoilVVVMPELIFRGWRRLLHNQRAVYVKRLLLFEPRVILATVPYPLN*
Ga0134110_1051610823300012975Grasslands SoilFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR*
Ga0134087_1063808113300012977Grasslands SoilGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV*
Ga0164305_1011846913300012989SoilELVVRGWRRALHNQRALYVKRLLLFESHVILASVPYQLVR*
Ga0164305_1038258623300012989SoilGLSRSLHNQRALYIKRLLLFEPRVILTSVPYRLD*
Ga0157373_1095434713300013100Corn RhizosphereDDGHDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLLR*
Ga0157369_1007503113300013105Corn RhizospherePELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYHLIR*
Ga0157378_1270551113300013297Miscanthus RhizosphereGRARVLHNQRALYLKRVLLFERRVMLTSVPYQLFR*
Ga0120172_101505713300013765PermafrostDGRTEAILVMPELVVRGPRRVLHNQRALYLKRLLLFEPRVILVSVPYQLMR*
Ga0134078_1023775623300014157Grasslands SoilVVRGLSRALHKQRALYLKRLLLFEPNVILASVPYQLMR*
Ga0134078_1029590523300014157Grasslands SoilELTAEEQDVLVVLPEVILRGWRRLLHNQRALYVKRLLLVEPHVILASVPYQLIR*
Ga0134078_1041557023300014157Grasslands SoilDDLTDDGRTEVIMVLPELVVRGASRLLHNQRALYIKRLLMFEPNVILASVPYQIMR*
Ga0075316_110413423300014314Natural And Restored WetlandsLVVLPELVLPGWRRLLHNERALYVKRLLLFEPNVVLTAVPYQIVD*
Ga0163163_1049108513300014325Switchgrass RhizosphereMPELIFSGPQRLMHNQRALYVKRLLLFEPRVILTAVPYRLT*
Ga0182008_1014122433300014497RhizosphereWARILHNQRALYIKRLLLFEQHVILSSVPYQLFR*
Ga0157379_1015879023300014968Switchgrass RhizosphereVTPPDFVPAGGAQLLHNQRALYIKRLLLFEPRVILASVPYQLIH*
Ga0157379_1101165013300014968Switchgrass RhizospherePELVFRGWRRLLHNQRALYIKRLLIFEPRVILTAVPYRLN*
Ga0173483_1039671923300015077SoilVRGVSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR*
Ga0137403_1146795823300015264Vadose Zone SoilIMPELVVRGWRRLPHNQRALYVKRRLLFEPRVILSSVPYQLT*
Ga0182005_120940023300015265RhizosphereVTRGWRRLLHNQKALYVKRLLLFEPGVVLAAVPYQLLR*
Ga0134072_1025238623300015357Grasslands SoilMPELIVRGTDRLLHNQRAMYLKRLLLFEPPVILTSVPYQLV*
Ga0134085_1016618013300015359Grasslands SoilSRALHNQKALYLKRLLLFEPHVILASVPYQLLRS*
Ga0134085_1054732423300015359Grasslands SoilPELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIK*
Ga0132258_1150306423300015371Arabidopsis RhizospherePEVVVRGWSRLLHNQRALYVKRLLLFESHVILSSVPYQLFR*
Ga0132256_10124253323300015372Arabidopsis RhizosphereMPELVVRGWRRLLHNQRALYVKRQLLFEPNVILAAVPYQLLR*
Ga0132256_10328455923300015372Arabidopsis RhizosphereEETLVLVVLPELVVHGVGRLLHNQRALYVKRLLLFEPGVALAAVPFRLS*
Ga0132257_10005670973300015373Arabidopsis RhizosphereELVVHGWKRLLHNQRALYVKRLLLFEPRTILSSVPYQLP*
Ga0132257_10083563123300015373Arabidopsis RhizosphereWARLLHNQRALYIKRVLLFEPHVVLSSVPYQLFR*
Ga0132257_10102370123300015373Arabidopsis RhizosphereGTDRLLHNQRALYLKRLLLFEPRVILTSVPLQLT*
Ga0132257_10357467013300015373Arabidopsis RhizosphereLRAYLDPLTGPDRAVNVVMPEVVVRGRARLLHNQRALYVKRLLRFEPHVILSSVPYQVFR
Ga0132255_10018157643300015374Arabidopsis RhizosphereDIGEPLRAYLDPLTSPDRAVNVVMPEVVVRGRARLLHNQRALYVKRLLLFEPHVILSSVPYQVFR*
Ga0132255_10364721523300015374Arabidopsis RhizosphereMPELVFNGARKLLHNQRALYLKRLLLFEPRVILTSVPYQLFR*
Ga0182033_1038382523300016319SoilVRGWARLLHNQRALYIKRLLLFEPRVILSSVPYQLFR
Ga0187809_1018240923300017937Freshwater SedimentLVVMPELVVRGWRRLLHNQRALYVKRLLLFEPHVLLAAVPYQLLR
Ga0187779_1011263423300017959Tropical PeatlandVVMPEIVVRGWSRVLHNQRAIYVKRLLLFEPHVILSSVPYQLFR
Ga0187777_1023402113300017974Tropical PeatlandHWWQHPLHGQRGLFVKRLLLFEDRVILSSVPYKIS
Ga0187777_1148515113300017974Tropical PeatlandLVFSGPQRLLHNQRALYVKRLLLFEPRVILTSVPYRLS
Ga0184605_1041726423300018027Groundwater SedimentEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLMR
Ga0184608_1009535323300018028Groundwater SedimentLTEDGRTEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR
Ga0184621_1011012733300018054Groundwater SedimentVMPELVVRGANRLLHNQRALYLKRLLLFEPRVILTSVPYRVG
Ga0187765_1028876833300018060Tropical PeatlandYLRDLTADEETEVLVLMPGLVTHGWRRLLHNQRSLYIKRLLLLEPGVILASVPYQILR
Ga0184619_1014890013300018061Groundwater SedimentMAELVARGTDRLLHNQRALYLKRLLLFEPRVILTSVPLQLT
Ga0184619_1021812123300018061Groundwater SedimentVAVVIMPELIFRGRQRLLHNQRALYIKRLLLFEERVILTAVPYRLN
Ga0184619_1027000533300018061Groundwater SedimentEVAVSVLMPELVFSGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP
Ga0187773_1011177833300018064Tropical PeatlandEEGTAVLVLMPELITRGWRRLLHNQRALYIKRLLLLEPNIILASVPYQILR
Ga0184618_1017298613300018071Groundwater SedimentVMPELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR
Ga0184618_1037303213300018071Groundwater SedimentSATERLLHNQRALYLKRLLLFEPRVILASAPFQLT
Ga0184609_1021043833300018076Groundwater SedimentSGWRALLHNQRAFYLKRLLLFEPGIILSSVPYHLP
Ga0066655_1079480913300018431Grasslands SoilELIVRGTDRLLHNQRALYLKRLLIFEPRVILASVPYQLV
Ga0066662_1061063833300018468Grasslands SoilVVSGWSRALHNQRALYLKRLLLFEPRVILSAVPYQLG
Ga0193715_106260723300019878SoilEGVLGMPELVVGGLSRALHNQRALYLKRLLLFEPRVILASVPYQLVR
Ga0193727_105300513300019886SoilGRTEVVLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR
Ga0193751_115739713300019888SoilVVMPELVTRGWRRLLHNQRALYVKRLLLLEPGVILASVPYQVL
Ga0193721_102954813300020018SoilMPELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR
Ga0206350_1161529713300020080Corn, Switchgrass And Miscanthus RhizospherePEIVVRGWARLLHNQRALYIKRLLLFEPHVILSSVPYQLFR
Ga0210381_1005136613300021078Groundwater SedimentPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR
Ga0213874_1002322323300021377Plant RootsRGWARLLHNQRALYIKRVLLFEPHVILSSVPYQLFR
Ga0126371_1234024223300021560Tropical Forest SoilVVRGWRRLLHNQRALYLKRLLLFEPNVVLLSVPYQLLR
Ga0222623_1023940833300022694Groundwater SedimentAVSVLMPELVFSGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP
Ga0247747_100623513300022737SoilMPEVVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPF
Ga0247795_101150113300022899SoilEVVVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT
Ga0247667_101429513300024290SoilEIVVRGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR
Ga0247668_106308423300024331SoilRGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR
Ga0207692_1019618013300025898Corn, Switchgrass And Miscanthus RhizosphereRGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR
Ga0207685_1007901133300025905Corn, Switchgrass And Miscanthus RhizosphereDPDAVAVVLMPELVFSGTGRLLHNQRALYVKRLLLFEPRVILASVPYRLD
Ga0207684_1002347813300025910Corn, Switchgrass And Miscanthus RhizosphereMPELVARGVDRILHNQRALYLKRLLLFEPRVILTSVPFQLT
Ga0207654_1113781813300025911Corn RhizosphereMPEVVVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR
Ga0207663_1026877713300025916Corn, Switchgrass And Miscanthus RhizosphereLILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR
Ga0207652_1088163813300025921Corn RhizosphereIVMPEIVVRGWARFLHNQRALYIKRLLLFEPHVILSSVPYQLFR
Ga0207646_1108543833300025922Corn, Switchgrass And Miscanthus RhizosphereRGWARLLHNQRALYIKRLLLFEQHVILSSVPYQLFR
Ga0207694_1136386313300025924Corn RhizosphereELVLRGWRRLLHNQRALYVKRLLLLEPNVLLASVPYPLVR
Ga0207687_1153220123300025927Miscanthus RhizosphereVVHGWRRLLHNQRALYLKRLLLFEPRVILSSVPYRL
Ga0207700_1010200613300025928Corn, Switchgrass And Miscanthus RhizosphereELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR
Ga0207664_1002190413300025929Agricultural SoilVLPELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYQLIR
Ga0207664_1175314813300025929Agricultural SoilVRGWARVLHNQRALYIKRLLLFEPHVILSSVPYQLFR
Ga0207644_1117671123300025931Switchgrass RhizospherePELILRGWRRLLHNQRALYVKRLLLVEPNVILASVPYHLIR
Ga0207665_1067261023300025939Corn, Switchgrass And Miscanthus RhizosphereELTDDGHDVLVVLPELILRGWARLLHNQRALYVKRLLLVEPHVILASVPYQLIR
Ga0207711_1070643833300025941Switchgrass RhizosphereDGDDVLVVLPELILRGWRRLLHNQRALYVKRLLLLEPHVLLASVPYPLVR
Ga0207679_1199444213300025945Corn RhizosphereFGGMSRALHNQRALYIKRLLLFEPRVILASVPYRLD
Ga0208527_100939813300025990Rice Paddy SoilVMPELITRGWRRALHNQRALYIKRLLLFEPGVILASVPYQVMR
Ga0208140_102139323300026021Rice Paddy SoilLITRGWRRALHNQRALYIKRLLLFEPGVILASVPYQVMR
Ga0207677_1198307713300026023Miscanthus RhizospherePELVFTGVRKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP
Ga0207708_1024006123300026075Corn, Switchgrass And Miscanthus RhizosphereSGPQRLMHNQRALYVKRLLLFEPRVILTAVPYRLT
Ga0207702_1244469213300026078Corn RhizosphereVMPEVIVRGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT
Ga0209027_120667113300026300Grasslands SoilPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR
Ga0209265_101134223300026308SoilMPELIVRGTDRLLHNQRAMYLKRLLLFEPRVILTSVPYQLV
Ga0209155_100946243300026316SoilVLVMPELVVRGLSRALHKQRALYLKRLLLFEPNVILASVPYQLMR
Ga0209470_109374113300026324SoilNGARKLLHNQRALYIKRLLLFEPRVFLSSVPYHLP
Ga0209801_128545623300026326SoilRRLTEGGRTEVVLVMPELVVRGPSRALHNQKALYLKRLLLFEPHVILASVPYQLMR
Ga0209267_106373223300026331SoilMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLMR
Ga0209156_1011174033300026547SoilPELVARGTDRLLHNQRALYLKRLLLFEPRVILTSVPFQLT
Ga0209811_1012329733300027821Surface SoilAVSVVMPELVFNGARKLLHNQRALYIKRLLLFEPRVILSSVPYHLP
Ga0209590_1076441813300027882Vadose Zone SoilFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRLD
Ga0209382_1195511623300027909Populus RhizosphereVVVMPELVFSGFSRSLHNQRALYIKRLLLFEPRVILASVPYRMD
Ga0209168_1009595923300027986Surface SoilGWRRLLHNQRALYVKRLLLFEPGVILASVPYQLLR
Ga0209526_1042164923300028047Forest SoilMPEVVTRGFRRILHNQRALYVKRLLLFEPRVILASVPYQLLR
Ga0307293_1000528713300028711SoilLTEDGATEVIVVMPELVVSGPRRLLHNQRALYLKRLLLFEPGVILVSVPYQLLR
Ga0307311_1006960333300028716SoilLIFSGPQRLLHNQKALYIKRLLLFEPRVILTSVPYRLD
Ga0307307_1023842723300028718SoilELVVSGPRRLLHNQRALYLKRLLLFEPGVILVSVPYQLLR
Ga0307301_1004231813300028719SoilELVVRGTDRLLHNQRALYVKRLLLFEPRVILTSVPFQLT
Ga0307315_1018309723300028721SoilVVRGWARVLHNQRALYIKRLLLFERHVILSSVPYQLFR
Ga0307320_1018055213300028771SoilFSGQQRLLHNQRALYIKRLLLFEPRVILTSVPYRMG
Ga0307282_1020873613300028784SoilEGTEVLVVMPELFTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR
Ga0307323_1028785713300028787SoilELVFRGWRRLLHNQRALYIKRLLIFEPRVILTAVPYRLN
Ga0307323_1032332613300028787SoilLVTRGWRRLLHNQRALYVKRLLLFEPNVVLAAVPYQLLR
Ga0307299_1039246713300028793SoilGGLSRALHNQRALYLKRLLLFEPNVILASVPYQLVR
Ga0307284_1001165613300028799SoilELVVRGARRVLHNQRALYLKRLLLFEPRVILVSVPYQLIR
Ga0307284_1010676823300028799SoilMPELVVRGTDRLLHNQRALYVKRLLLFEPRVILTSVPFQLT
Ga0307302_1013854013300028814SoilLVMPELVVRGLSRALHNQKALYLKRLLLFEPHVILASVPYQLLR
Ga0307302_1021822833300028814SoilMPELVFNGARKLLHNQRALYIKRLLLFEPRVILSSVPYHLP
Ga0307310_1032129923300028824SoilEDGATEAIVVMPELVVSGPRRLLHNQRALYLKRLLLFEPGVILVSVPYQLLR
Ga0307312_1093666113300028828SoilTRGWRRLLHNQKALYVKRLLLFEPHVILASVPYQLLR
Ga0307314_1013770413300028872SoilGWRRLLHNQRALYVKRLLLFEPNVVLAAVPYQLLR
Ga0307314_1018367013300028872SoilSGLSRSLHNQRALYIKRLLLFEPRVILTSVPYRLD
Ga0307286_1000794823300028876SoilMPELVVRGWRRALHNQRALYVKRLLLFEPHVILASVPYQLVR
Ga0307278_1001602863300028878SoilVLMPELVFSGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP
Ga0307277_1009199433300028881SoilELIFSGPQRLLHNQRALYIKRLLLFEPRVILTSVPYRVG
Ga0307308_1018185933300028884SoilLLMPELVISGSRKLLHNQRALYIKRLLLFEPRVLLSSVPYHLP
Ga0311365_1016119013300029989FenVAVVVMPELIVRGVDRMLHNQRALYLKRLLLFEPNVILASVPYQFL
Ga0311336_1192490113300029990FenEMVVRGSARLLHNQRALYIKRVLLFERHVILSSVPYQLFR
Ga0311335_1004912513300030838FenRGVDRMLHNQRALYLKRLLLFEPNVILASVPYQFL
Ga0307498_1035200523300031170SoilMLELVFGGMSRALHNQRALYIKRLLLFEPRMILGSVPYRLD
Ga0265327_1004367043300031251RhizospherePEMVVHGMARLLHNQRALYIKRMLLFERHVILSSVPYQLFR
Ga0318534_1036905033300031544SoilDDARCVVILPELVVRKRWRLLHNQRAFFVKRVLLFEPRVALTSVPQALA
Ga0318515_1020963723300031572SoilPELIFSGLARTLHNQRALYVKRLLLFEPQVILSSVPYRLD
Ga0310813_1085275823300031716SoilVFNGTARLLHNQRALYVKRLLLFEPRVILASVPYRMD
Ga0307477_1002794353300031753Hardwood Forest SoilVMPELVTRGWRRLLHNQRALYIKRLLLVEPGVILASVPYQAL
Ga0307477_1050419313300031753Hardwood Forest SoilVMPELVTRGLVRVLHNQRALYIKRLLLFEPGVVLASVPYQILR
Ga0318509_1057163923300031768SoilSGLTRALHNQRAIYLKRLLLFEPRVILSSVPYQLG
Ga0318497_1086283623300031805SoilPEVVVAGWRELLHNQRSLYVKRLLLFEPNVVLTSVPFQIIA
Ga0310892_1129622623300031858SoilEVVLVMPELVVRGLSRVLHNRRALYLKRLLLFEPHVILASVPYQLLR
Ga0318536_1032846313300031893SoilPELVVRGIDRILHNHRALYFKRLLLFEPRVILASVPYRLL
Ga0308176_1060457313300031996SoilELVLRGWARLLHNQRALYIKRLLLVEPNVILASVPYPLVR
Ga0306922_1189979713300032001SoilRGWARVLHNQRALYLKRLLLFEPRVILSSVPYQFLR
Ga0310911_1071982323300032035SoilEIVVGGLRRVLHNQRALYVKRMLLFEPRVILSAVPYQLD
Ga0335081_1083837313300032892SoilRHWWQQPLHGQRGLFVKRLLLFEERVILSSVPYRIP
Ga0335071_1038241513300032897SoilLPELITPGWRRLLHNQRALYIKRLLLLEPGVILASVPYQLLR
Ga0247830_1101183633300033551SoilLDLERQRLLHNQRALYIKRLLLFEPRVIVVDVPYRLN
Ga0314866_037844_276_4043300033807PeatlandMPELIVPGWRRLLHNQRALYIKRLLLLEPGVILASVPYQLLR
Ga0314866_090490_398_5263300033807PeatlandMPEIVVRGSVRLLHNQRALYIKRLLLFEPHVILSSVPYQLFR
Ga0370484_0138722_3_1313300034125Untreated Peat SoilMPEMVVRGTARLLHNQRALYIKRVLLFERHVILSSVPYQLFR
Ga0364943_0175520_672_7793300034354SedimentSGLSRSLHNQRALYIKRLLLFEPRVILSSVPYRLD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.