NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012665

Metagenome / Metatranscriptome Family F012665

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012665
Family Type Metagenome / Metatranscriptome
Number of Sequences 278
Average Sequence Length 43 residues
Representative Sequence QTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSGAPGG
Number of Associated Samples 172
Number of Associated Scaffolds 278

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.28 %
% of genes from short scaffolds (< 2000 bps) 93.53 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.770 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.827 % of family members)
Environment Ontology (ENVO) Unclassified
(34.173 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(58.993 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.42%    β-sheet: 0.00%    Coil/Unstructured: 46.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 278 Family Scaffolds
PF07811TadE 25.54
PF13400Tad 5.40
PF04964Flp_Fap 5.40
PF07837FTCD_N 3.24
PF13581HATPase_c_2 1.80
PF07311Dodecin 1.44
PF05345He_PIG 1.08
PF14833NAD_binding_11 0.72
PF02801Ketoacyl-synt_C 0.72
PF00221Lyase_aromatic 0.72
PF00109ketoacyl-synt 0.72
PF08448PAS_4 0.72
PF00072Response_reg 0.36
PF02812ELFV_dehydrog_N 0.36
PF13474SnoaL_3 0.36
PF14721AIF_C 0.36
PF01402RHH_1 0.36
PF05199GMC_oxred_C 0.36
PF05762VWA_CoxE 0.36
PF00589Phage_integrase 0.36
PF01551Peptidase_M23 0.36
PF08529NusA_N 0.36
PF08241Methyltransf_11 0.36
PF07040DUF1326 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 278 Family Scaffolds
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 5.40
COG3643Glutamate formiminotransferaseAmino acid transport and metabolism [E] 3.24
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 1.44
COG2986Histidine ammonia-lyaseAmino acid transport and metabolism [E] 0.72
COG0334Glutamate dehydrogenase/leucine dehydrogenaseAmino acid transport and metabolism [E] 0.36
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.36
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.13 %
UnclassifiedrootN/A11.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1169646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300000956|JGI10216J12902_102268410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300000956|JGI10216J12902_111608360All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300003998|Ga0055472_10289852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300004019|Ga0055439_10220612All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300004024|Ga0055436_10251772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella → unclassified Eggerthella → Eggerthella sp. 1_3_56FAA564Open in IMG/M
3300004156|Ga0062589_100773696All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300004156|Ga0062589_102198524Not Available565Open in IMG/M
3300004157|Ga0062590_100484743All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300004479|Ga0062595_100261692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1132Open in IMG/M
3300004643|Ga0062591_102738151All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005213|Ga0068998_10139620All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005328|Ga0070676_10276581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1130Open in IMG/M
3300005328|Ga0070676_10424624All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300005328|Ga0070676_10990017All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Robbsia → Robbsia andropogonis630Open in IMG/M
3300005329|Ga0070683_100333393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300005329|Ga0070683_101480704All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005331|Ga0070670_102197371All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005332|Ga0066388_100448282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1932Open in IMG/M
3300005332|Ga0066388_100542644All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300005332|Ga0066388_106428305All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005332|Ga0066388_107269097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales556Open in IMG/M
3300005335|Ga0070666_10380048All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300005345|Ga0070692_11129071All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005347|Ga0070668_101083566All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300005355|Ga0070671_101240295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella657Open in IMG/M
3300005356|Ga0070674_100351566All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300005356|Ga0070674_100675352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300005356|Ga0070674_101932341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300005365|Ga0070688_100742234All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005365|Ga0070688_101565340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella → unclassified Eggerthella → Eggerthella sp. HGA1537Open in IMG/M
3300005441|Ga0070700_101726944All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005445|Ga0070708_101008948All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300005445|Ga0070708_101490069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300005456|Ga0070678_102384227Not Available502Open in IMG/M
3300005459|Ga0068867_102269211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus mucilaginosus515Open in IMG/M
3300005466|Ga0070685_10076576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1995Open in IMG/M
3300005535|Ga0070684_100157809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2057Open in IMG/M
3300005535|Ga0070684_100520393All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300005535|Ga0070684_101546236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Atopobiaceae → Atopobium → unclassified Atopobium → Atopobium sp. oral taxon 810625Open in IMG/M
3300005543|Ga0070672_101459538All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005543|Ga0070672_101633119All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005543|Ga0070672_101833373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae545Open in IMG/M
3300005577|Ga0068857_100486704Not Available1157Open in IMG/M
3300005577|Ga0068857_100651077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300005577|Ga0068857_102366699All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005578|Ga0068854_101365575Not Available640Open in IMG/M
3300005615|Ga0070702_100287837Not Available1131Open in IMG/M
3300005615|Ga0070702_101346226All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005764|Ga0066903_106404745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300005840|Ga0068870_10072118Not Available1886Open in IMG/M
3300005840|Ga0068870_10441996Not Available855Open in IMG/M
3300005840|Ga0068870_10524269All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300005841|Ga0068863_100695110All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300006049|Ga0075417_10705245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia519Open in IMG/M
3300006577|Ga0074050_12052609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1219Open in IMG/M
3300006844|Ga0075428_102695674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales506Open in IMG/M
3300006845|Ga0075421_101150771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Eggerthella → unclassified Eggerthella → Eggerthella sp. 1_3_56FAA868Open in IMG/M
3300006845|Ga0075421_102520142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300006847|Ga0075431_101032048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae788Open in IMG/M
3300006852|Ga0075433_10208628All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300006852|Ga0075433_11818114All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300006854|Ga0075425_101767418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300006854|Ga0075425_101992128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300006871|Ga0075434_100102524All Organisms → cellular organisms → Bacteria2869Open in IMG/M
3300006880|Ga0075429_101936279All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006881|Ga0068865_100544841Not Available973Open in IMG/M
3300006894|Ga0079215_11107239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300006904|Ga0075424_100015190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album7770Open in IMG/M
3300006904|Ga0075424_100161579All Organisms → cellular organisms → Bacteria2374Open in IMG/M
3300006904|Ga0075424_102736010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300006918|Ga0079216_11446897All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300009094|Ga0111539_10062612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4403Open in IMG/M
3300009094|Ga0111539_10645604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1232Open in IMG/M
3300009094|Ga0111539_12790383All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300009098|Ga0105245_10486244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1248Open in IMG/M
3300009098|Ga0105245_12990842Not Available524Open in IMG/M
3300009147|Ga0114129_10953370All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300009147|Ga0114129_11115539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300009148|Ga0105243_12166937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300009148|Ga0105243_13091977Not Available504Open in IMG/M
3300009153|Ga0105094_10979228All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009156|Ga0111538_10703736All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300009156|Ga0111538_11793428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300009176|Ga0105242_10850529Not Available908Open in IMG/M
3300009176|Ga0105242_10878634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria894Open in IMG/M
3300009176|Ga0105242_11419253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300009176|Ga0105242_12854289All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009553|Ga0105249_11753849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300009821|Ga0105064_1149926All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010362|Ga0126377_10771712All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300010366|Ga0126379_12430085All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300010373|Ga0134128_12840512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300010397|Ga0134124_10609682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1070Open in IMG/M
3300010400|Ga0134122_13411174Not Available500Open in IMG/M
3300010403|Ga0134123_10158151All Organisms → cellular organisms → Bacteria1884Open in IMG/M
3300010403|Ga0134123_11824575Not Available662Open in IMG/M
3300010403|Ga0134123_12093552All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300010403|Ga0134123_12361177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300011107|Ga0151490_1407681All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300011119|Ga0105246_10318449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1263Open in IMG/M
3300011119|Ga0105246_10423519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1112Open in IMG/M
3300011440|Ga0137433_1064117All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300012022|Ga0120191_10106004Not Available588Open in IMG/M
3300012892|Ga0157294_10134587All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300012900|Ga0157292_10134806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12772Open in IMG/M
3300012904|Ga0157282_10141806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300012905|Ga0157296_10280408Not Available574Open in IMG/M
3300012907|Ga0157283_10155669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300012907|Ga0157283_10169609All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012911|Ga0157301_10377185All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012912|Ga0157306_10231014All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300012915|Ga0157302_10048018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1196Open in IMG/M
3300012916|Ga0157310_10063870All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300012948|Ga0126375_10977991All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300012951|Ga0164300_10246489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria904Open in IMG/M
3300012958|Ga0164299_10217031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1118Open in IMG/M
3300012958|Ga0164299_11288415All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012958|Ga0164299_11310097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300012986|Ga0164304_11569344All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300013096|Ga0157307_1029492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300013306|Ga0163162_12998889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300013307|Ga0157372_13220874All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300013308|Ga0157375_11535070Not Available786Open in IMG/M
3300013308|Ga0157375_12345615All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300013308|Ga0157375_12839921Not Available579Open in IMG/M
3300014272|Ga0075327_1315713All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300014296|Ga0075344_1153217All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300014301|Ga0075323_1077465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300014325|Ga0163163_10871279Not Available964Open in IMG/M
3300014325|Ga0163163_11968580Not Available644Open in IMG/M
3300014326|Ga0157380_12583588All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300014326|Ga0157380_13454828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300014745|Ga0157377_10002317All Organisms → cellular organisms → Bacteria8376Open in IMG/M
3300014969|Ga0157376_11852653All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300015200|Ga0173480_10336190All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300015371|Ga0132258_10079270All Organisms → cellular organisms → Bacteria7654Open in IMG/M
3300015371|Ga0132258_10274138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4136Open in IMG/M
3300015371|Ga0132258_10490194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3071Open in IMG/M
3300015371|Ga0132258_11006652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2106Open in IMG/M
3300015371|Ga0132258_11367088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli1789Open in IMG/M
3300015371|Ga0132258_12658523All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300015371|Ga0132258_13657538Not Available1050Open in IMG/M
3300015371|Ga0132258_13684951Not Available1046Open in IMG/M
3300015371|Ga0132258_13688370All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300015371|Ga0132258_13692505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300015372|Ga0132256_100033593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4660Open in IMG/M
3300015372|Ga0132256_100116851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2626Open in IMG/M
3300015372|Ga0132256_101491305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300015372|Ga0132256_103048268All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300015372|Ga0132256_103623648All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300015372|Ga0132256_103644746All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300015372|Ga0132256_103931515All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300015373|Ga0132257_100467093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1543Open in IMG/M
3300015373|Ga0132257_100560288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1408Open in IMG/M
3300015373|Ga0132257_100953983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300015373|Ga0132257_101092992All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300015373|Ga0132257_102938516All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300015373|Ga0132257_103699922All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300015374|Ga0132255_101592350All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300015374|Ga0132255_102272114All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300015374|Ga0132255_102430871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria800Open in IMG/M
3300015374|Ga0132255_103911845Not Available632Open in IMG/M
3300015374|Ga0132255_104129156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300015374|Ga0132255_104411429Not Available596Open in IMG/M
3300015374|Ga0132255_106345449All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300016319|Ga0182033_11002736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300017792|Ga0163161_11603661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300017965|Ga0190266_10928071All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300017965|Ga0190266_11009063All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300018028|Ga0184608_10326698All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300018055|Ga0184616_10096382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300018067|Ga0184611_1089246All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300018072|Ga0184635_10277602All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300018073|Ga0184624_10042640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1807Open in IMG/M
3300018073|Ga0184624_10520852All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300018073|Ga0184624_10538848All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300018081|Ga0184625_10305810All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300018469|Ga0190270_10045366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3009Open in IMG/M
3300018469|Ga0190270_10709512All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300018469|Ga0190270_10828002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria935Open in IMG/M
3300018469|Ga0190270_10965831All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300018469|Ga0190270_11981124All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300018481|Ga0190271_10057845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3347Open in IMG/M
3300018481|Ga0190271_10301248All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300018481|Ga0190271_10532484All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300018481|Ga0190271_10881475All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300018481|Ga0190271_11442734All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300018481|Ga0190271_12025467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300018481|Ga0190271_13004891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300018481|Ga0190271_13168155All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300019356|Ga0173481_10441851All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300019361|Ga0173482_10621850All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300019362|Ga0173479_10626212All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300019377|Ga0190264_11190332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300020005|Ga0193697_1094381All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300020020|Ga0193738_1180650All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300021082|Ga0210380_10513207All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300022756|Ga0222622_10852726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300022756|Ga0222622_11156981All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300022883|Ga0247786_1051509All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300023066|Ga0247793_1069830All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300023266|Ga0247789_1135911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300025165|Ga0209108_10118336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1416Open in IMG/M
3300025165|Ga0209108_10533417All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300025325|Ga0209341_10120814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2209Open in IMG/M
3300025325|Ga0209341_10757009All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300025325|Ga0209341_11150826Not Available555Open in IMG/M
3300025549|Ga0210094_1046287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300025901|Ga0207688_10829731Not Available586Open in IMG/M
3300025903|Ga0207680_10358761All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300025907|Ga0207645_10957669All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025908|Ga0207643_10765478All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300025908|Ga0207643_10976267All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300025918|Ga0207662_10184453All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300025923|Ga0207681_11339143All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300025925|Ga0207650_10397514All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300025925|Ga0207650_10720609All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300025926|Ga0207659_10229931Not Available1495Open in IMG/M
3300025926|Ga0207659_10590604All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300025926|Ga0207659_10809487All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300025926|Ga0207659_11540558All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300025934|Ga0207686_11167204All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300025934|Ga0207686_11200491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300025934|Ga0207686_11541178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300025934|Ga0207686_11647287All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300025934|Ga0207686_11745608All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300025937|Ga0207669_10124426All Organisms → cellular organisms → Bacteria1758Open in IMG/M
3300025937|Ga0207669_10525970All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300025938|Ga0207704_11257077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300025940|Ga0207691_10612329All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300025940|Ga0207691_10635076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300025940|Ga0207691_11538460All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300025942|Ga0207689_10247882All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300025944|Ga0207661_10564433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300025944|Ga0207661_10971271Not Available782Open in IMG/M
3300025972|Ga0207668_10289614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1347Open in IMG/M
3300026089|Ga0207648_10783773All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300026095|Ga0207676_10195320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1784Open in IMG/M
3300026116|Ga0207674_10502844Not Available1171Open in IMG/M
3300026121|Ga0207683_10031291All Organisms → cellular organisms → Bacteria4618Open in IMG/M
3300026121|Ga0207683_11380172All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300027163|Ga0209878_1042812All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300027332|Ga0209861_1037093All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300027523|Ga0208890_1024154All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300027561|Ga0209887_1107192All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300027907|Ga0207428_10269609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1266Open in IMG/M
3300027907|Ga0207428_10632283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300028379|Ga0268266_11168338Not Available744Open in IMG/M
3300028592|Ga0247822_11688888All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300028814|Ga0307302_10202811All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300028819|Ga0307296_10482567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300028881|Ga0307277_10487125All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300030619|Ga0268386_10527269All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300030831|Ga0308152_112727All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300031422|Ga0308186_1037262Not Available521Open in IMG/M
3300031572|Ga0318515_10393663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300031576|Ga0247727_11128935All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031682|Ga0318560_10717706All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031744|Ga0306918_11086789Not Available620Open in IMG/M
3300031765|Ga0318554_10139871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1372Open in IMG/M
3300031845|Ga0318511_10215636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium856Open in IMG/M
3300031873|Ga0315297_11082115All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300031943|Ga0310885_10433724All Organisms → cellular organisms → Bacteria → Proteobacteria706Open in IMG/M
3300031997|Ga0315278_10872411All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300031999|Ga0315274_11572753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300032013|Ga0310906_10271392All Organisms → cellular organisms → Bacteria → Proteobacteria1069Open in IMG/M
3300032066|Ga0318514_10302974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium845Open in IMG/M
3300032177|Ga0315276_11469090All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300032342|Ga0315286_11842943All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300032397|Ga0315287_10064842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4059Open in IMG/M
3300032516|Ga0315273_11370759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria878Open in IMG/M
3300032516|Ga0315273_11605640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300033407|Ga0214472_10817150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria838Open in IMG/M
3300033551|Ga0247830_11139637All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300034176|Ga0364931_0112287Not Available867Open in IMG/M
3300034662|Ga0314783_140248All Organisms → cellular organisms → Bacteria550Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere8.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere6.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.60%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.16%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.80%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.44%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.08%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.08%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.36%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.36%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.36%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.36%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.36%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.36%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014317Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027332Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030831Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031422Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_116964613300000881SoilILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG*
JGI10216J12902_10226841013300000956SoilTEYAILLGFLAIAIIIALFFLRNVLRQLFSSAASSVSNAPG*
JGI10216J12902_11160836023300000956SoilGFLAIAIIIALFFLRNVLRSLFSNAASSVSSAPDG*
Ga0055472_1028985223300003998Natural And Restored WetlandsEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPG*
Ga0055439_1022061213300004019Natural And Restored WetlandsEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPGP*
Ga0055436_1025177213300004024Natural And Restored WetlandsREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSGAGN*
Ga0062589_10077369613300004156SoilTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG*
Ga0062589_10219852423300004156SoilEYAILLGFLAIAIIIALFFLRNVLRSLFSQAASSVSGAPNS*
Ga0062590_10048474333300004157SoilQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGT*
Ga0062595_10026169223300004479SoilQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSGAPDS*
Ga0062591_10273815123300004643SoilREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAAKSVQSSPGSP*
Ga0068998_1013962013300005213Natural And Restored WetlandsQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSGAGN*
Ga0070676_1027658113300005328Miscanthus RhizosphereQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0070676_1042462433300005328Miscanthus RhizosphereGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0070676_1099001713300005328Miscanthus RhizosphereTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPN*
Ga0070683_10033339333300005329Corn RhizosphereTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0070683_10148070423300005329Corn RhizosphereTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0070670_10219737113300005331Switchgrass RhizosphereAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSGAPNG*
Ga0066388_10044828233300005332Tropical Forest SoilVHELREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS*
Ga0066388_10054264443300005332Tropical Forest SoilEREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS*
Ga0066388_10642830513300005332Tropical Forest SoilDGQTTTEYAILLGFLAIAIIVALFFLRTVLKNLFSDAAQSVSDAGGP*
Ga0066388_10726909713300005332Tropical Forest SoilEREDGQTTTEYAILLGFLAIAIIVALFFLRNVLRGLFSNAASSVSNAPNG*
Ga0070666_1038004813300005335Switchgrass RhizosphereEREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0070692_1112907123300005345Corn, Switchgrass And Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGT*
Ga0070668_10108356623300005347Switchgrass RhizosphereQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKGPGN*
Ga0070671_10124029523300005355Switchgrass RhizosphereRNREEGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSKAASSVSGAPG*
Ga0070674_10035156633300005356Miscanthus RhizosphereTTEYAILLGFLAIAIIVALFFLRNVLRSLFSSAASSVSGAPN*
Ga0070674_10067535213300005356Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIVALFFLRNVLRSLFSSAASSVSRAPG*
Ga0070674_10193234113300005356Miscanthus RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG*
Ga0070688_10074223423300005365Switchgrass RhizosphereLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN*
Ga0070688_10156534023300005365Switchgrass RhizosphereHQLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPN*
Ga0070700_10172694423300005441Corn, Switchgrass And Miscanthus RhizosphereTTEYAILLGFLAIAIIVALFFLRNVLRSLFSSAASSVSRAPG*
Ga0070708_10100894823300005445Corn, Switchgrass And Miscanthus RhizosphereGQTTTEYAILLGFLAIAIIVALFFLRNVLRGLFSNAASSVSGAPG*
Ga0070708_10149006913300005445Corn, Switchgrass And Miscanthus RhizosphereGQTTTEYAILLGFLAIAIIVALFFLRNVLRGLFSNAASSVSNAPG*
Ga0070678_10238422723300005456Miscanthus RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG*
Ga0068867_10226921113300005459Miscanthus RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPTG*
Ga0070685_1007657643300005466Switchgrass RhizosphereEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0070684_10015780933300005535Corn RhizosphereTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0070684_10052039313300005535Corn RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0070684_10154623613300005535Corn RhizosphereTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0070672_10145953823300005543Miscanthus RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS*
Ga0070672_10163311923300005543Miscanthus RhizosphereHQLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN*
Ga0070672_10183337333300005543Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG*
Ga0068857_10048670423300005577Corn RhizosphereLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0068857_10065107733300005577Corn RhizosphereEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0068857_10236669913300005577Corn RhizosphereEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN*
Ga0068854_10136557523300005578Corn RhizosphereTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS*
Ga0070702_10028783733300005615Corn, Switchgrass And Miscanthus RhizosphereTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0070702_10134622613300005615Corn, Switchgrass And Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0066903_10640474523300005764Tropical Forest SoilILLGFLAVAIIVALFFLRHQIKGLFSKAASSISQAPAGS*
Ga0068870_1007211843300005840Miscanthus RhizosphereILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN*
Ga0068870_1044199633300005840Miscanthus RhizosphereILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0068870_1052426913300005840Miscanthus RhizosphereGFLAIAIIIALFFLRGVLRSLFSAAASSVSGAPNG*
Ga0068863_10069511023300005841Switchgrass RhizosphereTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0075417_1070524513300006049Populus RhizosphereGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN*
Ga0074050_1205260933300006577SoilQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSGAPG*
Ga0075428_10269567413300006844Populus RhizosphereTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPNS*
Ga0075421_10115077113300006845Populus RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNS*
Ga0075421_10252014213300006845Populus RhizosphereEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPS*
Ga0075431_10103204813300006847Populus RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN*
Ga0075433_1020862813300006852Populus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG*
Ga0075433_1181811423300006852Populus RhizosphereEREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG*
Ga0075425_10176741813300006854Populus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSGAPDS*
Ga0075425_10199212823300006854Populus RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG*
Ga0075434_10010252443300006871Populus RhizosphereREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS*
Ga0075429_10193627913300006880Populus RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNS*
Ga0068865_10054484133300006881Miscanthus RhizosphereLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN*
Ga0079215_1110723913300006894Agricultural SoilTTTEYAILLGFLAIAIIIALFFLRNVLRELFSDAARSVSNAPGN*
Ga0075424_10001519013300006904Populus RhizosphereLLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPDG*
Ga0075424_10016157943300006904Populus RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS*
Ga0075424_10273601013300006904Populus RhizosphereGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG*
Ga0079216_1144689723300006918Agricultural SoilEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSSAPPGLPHPS*
Ga0111539_1006261213300009094Populus RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG*
Ga0111539_1064560413300009094Populus RhizosphereVHRLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAASSVSGSTG*
Ga0111539_1279038313300009094Populus RhizosphereQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRGAS*
Ga0105245_1048624413300009098Miscanthus RhizosphereQLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN*
Ga0105245_1299084223300009098Miscanthus RhizosphereEYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG*
Ga0114129_1095337013300009147Populus RhizosphereQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPG*
Ga0114129_1111553913300009147Populus RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0105243_1216693713300009148Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG*
Ga0105243_1309197713300009148Miscanthus RhizosphereILLGFLAIAIIVALFFLRDVLRGLFSNAASSVSRSTD*
Ga0105094_1097922823300009153Freshwater SedimentGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAASSVSNAPGP*
Ga0111538_1070373613300009156Populus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNS*
Ga0111538_1179342823300009156Populus RhizosphereLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPG*
Ga0105242_1085052913300009176Miscanthus RhizosphereQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0105242_1087863413300009176Miscanthus RhizosphereGFLAIAIIIALFFLRNVLRDLFSKAASSVNNSPGP*
Ga0105242_1141925323300009176Miscanthus RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG*
Ga0105242_1285428913300009176Miscanthus RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSAGPGN*
Ga0105249_1175384923300009553Switchgrass RhizosphereAILLGFLAIAIIVALFFLRNVLRQLFSDAASSVSNAPGP*
Ga0105064_114992623300009821Groundwater SandGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS*
Ga0126377_1077171233300010362Tropical Forest SoilGQTTTEYAILLGFLAIAIIIALFFLRNVIRDLFSHAASSVSNSPDG*
Ga0126379_1243008523300010366Tropical Forest SoilLGFLAIAIIIALFFLRGVLRSLFSSAASSVSAAPGG*
Ga0134128_1284051213300010373Terrestrial SoilLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0134124_1060968233300010397Terrestrial SoilFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0134122_1341117413300010400Terrestrial SoilAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSSAPGD*
Ga0134123_1015815113300010403Terrestrial SoilDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0134123_1182457513300010403Terrestrial SoilFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0134123_1209355223300010403Terrestrial SoilGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS*
Ga0134123_1236117723300010403Terrestrial SoilLLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG*
Ga0151490_140768123300011107SoilILLGFLAIAIIIALFFLRNLLRSLFSKAASSVSGAPG*
Ga0105246_1031844913300011119Miscanthus RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSHAPNS*
Ga0105246_1042351913300011119Miscanthus RhizosphereTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0137433_106411713300011440SoilLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRELFSDAAESVSLSDSP*
Ga0120191_1010600423300012022TerrestrialYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPNTSRPPSTGHS*
Ga0157294_1013458713300012892SoilYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0157292_1013480613300012900SoilTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSNAPG*
Ga0157282_1014180613300012904SoilDGQTTTEYAILLGFLAIAIIIALFFLRTVLRNLFSDAAQSVSNAPGGP*
Ga0157296_1028040813300012905SoilGFLAIAIIIALYFLRNVLRDLFSDAASSVSNAPG*
Ga0157283_1015566923300012907SoilEREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0157283_1016960923300012907SoilGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0157301_1037718513300012911SoilDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0157306_1023101423300012912SoilREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRELFSDAASSVSAGPGSP*
Ga0157302_1004801813300012915SoilILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSIAPGS*
Ga0157310_1006387033300012916SoilAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSNAPS*
Ga0126375_1097799123300012948Tropical Forest SoilILLGFLAIAIIVALFFLRNILRSLFSSAASSVSGAPGD*
Ga0164300_1024648913300012951SoilTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPG*
Ga0164299_1021703113300012958SoilYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPG*
Ga0164299_1128841513300012958SoilILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPG*
Ga0164299_1131009723300012958SoilFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPGS*
Ga0164304_1156934413300012986SoilLLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPG*
Ga0157307_102949213300013096SoilLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPGG*
Ga0163162_1299888913300013306Switchgrass RhizosphereFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0157372_1322087423300013307Corn RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPAN*
Ga0157375_1153507013300013308Miscanthus RhizosphereILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0157375_1234561523300013308Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN*
Ga0157375_1283992123300013308Miscanthus RhizosphereLLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0075327_131571313300014272Natural And Restored WetlandsMIWPVAALAILVLGFLAIAIIIALFFLRNVLRSLFSDAASSVSNAPN*
Ga0075344_115321713300014296Natural And Restored WetlandsILLGFLAIAIIIALYFLRGVLRSLFSEAASSVSNAPN*
Ga0075323_107746523300014301Natural And Restored WetlandsDGQTTTEYAILLGFLAIAIIVALFFLRNILRDLFSDAASSVSNAPG*
Ga0075343_115036413300014317Natural And Restored WetlandsLVVIAILVALFFLRSTSRYVPSDAAYSVSNAPGS*
Ga0163163_1087127923300014325Switchgrass RhizosphereVHQLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN*
Ga0163163_1196858013300014325Switchgrass RhizosphereILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS*
Ga0157380_1258358823300014326Switchgrass RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG*
Ga0157380_1345482823300014326Switchgrass RhizosphereLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG*
Ga0157377_1000231793300014745Miscanthus RhizosphereYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG*
Ga0157376_1185265323300014969Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0173480_1033619013300015200SoilGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN*
Ga0132258_1007927013300015371Arabidopsis RhizosphereEREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPGP*
Ga0132258_1027413843300015371Arabidopsis RhizosphereYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGS*
Ga0132258_1049019483300015371Arabidopsis RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPA*
Ga0132258_1100665213300015371Arabidopsis RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPSG*
Ga0132258_1136708813300015371Arabidopsis RhizosphereTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPGG*
Ga0132258_1265852343300015371Arabidopsis RhizosphereLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPDS*
Ga0132258_1365753813300015371Arabidopsis RhizosphereEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSSAPGG*
Ga0132258_1368495113300015371Arabidopsis RhizosphereAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG*
Ga0132258_1368837013300015371Arabidopsis RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPGD*
Ga0132258_1369250533300015371Arabidopsis RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPGP*
Ga0132256_10003359313300015372Arabidopsis RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPGP*
Ga0132256_10011685113300015372Arabidopsis RhizosphereAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGS*
Ga0132256_10149130513300015372Arabidopsis RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAARSVSNAPT*
Ga0132256_10304826813300015372Arabidopsis RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPS*
Ga0132256_10362364813300015372Arabidopsis RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAGGP*
Ga0132256_10364474623300015372Arabidopsis RhizosphereGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPTG*
Ga0132256_10393151523300015372Arabidopsis RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSGAPGG*
Ga0132257_10046709313300015373Arabidopsis RhizosphereGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPGG*
Ga0132257_10056028833300015373Arabidopsis RhizosphereGFLAIAIIIALFFLRGVLRSLFSSAASSVSKAPGS*
Ga0132257_10095398313300015373Arabidopsis RhizosphereLLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPGP*
Ga0132257_10109299213300015373Arabidopsis RhizosphereTEYAILLGFLAIAIIVALFFLRGVLRSLFSNAASSVSKAPG*
Ga0132257_10293851613300015373Arabidopsis RhizosphereQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPSG*
Ga0132257_10369992213300015373Arabidopsis RhizosphereGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPGS*
Ga0132255_10159235033300015374Arabidopsis RhizosphereREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSGAPSG*
Ga0132255_10227211413300015374Arabidopsis RhizosphereTTEYAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSGAPGS*
Ga0132255_10243087113300015374Arabidopsis RhizosphereAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG*
Ga0132255_10391184513300015374Arabidopsis RhizosphereEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPGG*
Ga0132255_10412915613300015374Arabidopsis RhizosphereEYAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPGP*
Ga0132255_10441142913300015374Arabidopsis RhizosphereEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSNAPGD*
Ga0132255_10634544913300015374Arabidopsis RhizosphereEREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSDSPN*
Ga0182033_1100273613300016319SoilGQTTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS
Ga0163161_1160366113300017792Switchgrass RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAAQSVSNAPG
Ga0190266_1092807123300017965SoilGQTTTEYAILLGFLAIAIIIALFFLRTVLRNLFSDAAASVSGAGGP
Ga0190266_1100906313300017965SoilILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPSG
Ga0184608_1032669823300018028Groundwater SedimentILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPSG
Ga0184616_1009638213300018055Groundwater SedimentLLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPGG
Ga0184611_108924633300018067Groundwater SedimentTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNSG
Ga0184635_1027760223300018072Groundwater SedimentLGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS
Ga0184624_1004264043300018073Groundwater SedimentREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSRSTG
Ga0184624_1052085213300018073Groundwater SedimentIAVVELRQRQEGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSKAASSVSGAPG
Ga0184624_1053884813300018073Groundwater SedimentILLGFLAIAIIIALFFLRNVLRSLFSNAASSVSGAPG
Ga0184625_1030581023300018081Groundwater SedimentTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPSG
Ga0190270_1004536613300018469SoilYAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPVN
Ga0190270_1070951213300018469SoilILLGFLAIAIIVALFFLRNVLRQLFSDAAGSVSNAPG
Ga0190270_1082800223300018469SoilEREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSSAASSVSNAPG
Ga0190270_1096583113300018469SoilEDGQTTTEYAILLGFLAIAIIVALFFLRNVLRNLFSDAASSVSRAPA
Ga0190270_1198112413300018469SoilEREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRELFSDAAESVSGANNP
Ga0190271_1005784513300018481SoilILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPGP
Ga0190271_1030124833300018481SoilTTTEYAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPGG
Ga0190271_1053248433300018481SoilTTTEYAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPVN
Ga0190271_1088147523300018481SoilTTTEYAILLGFLAIAIIVALFFLRNVLRELFSDAAQSVSGAPGP
Ga0190271_1144273423300018481SoilTTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPGQ
Ga0190271_1202546723300018481SoilLGFLAIAIIIALYFLRAVLRDLFSDAASSVSNAPG
Ga0190271_1300489113300018481SoilTEYAILLGFLAIAIIVALFFLRNVLRELFSDAAASVSGAPG
Ga0190271_1316815523300018481SoilEDGQTTTEYAILLGFLAIAIIIALFFLRGVLRELFSDAAQSVSNAGN
Ga0173481_1044185123300019356SoilEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG
Ga0173482_1062185023300019361SoilILLGFLAIAIIIALFFLRNVLRQLFSDAANSVQSAPTG
Ga0173479_1062621213300019362SoilQTTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG
Ga0190264_1119033223300019377SoilYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPGP
Ga0193697_109438113300020005SoilGQTTTEYAILLGFLAIAIIIALYFLRNVLRDLFSDAASSVSNSPGG
Ga0193738_118065023300020020SoilIHDLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSGAPG
Ga0210380_1051320723300021082Groundwater SedimentGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPGG
Ga0222622_1085272613300022756Groundwater SedimentGQTTTEYAILLGFLAIAIIIALFFLRNVLRQLFSDAAKSVQSAPGGP
Ga0222622_1115698113300022756Groundwater SedimentQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPAN
Ga0247786_105150913300022883SoilAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG
Ga0247793_106983013300023066SoilTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNN
Ga0247789_113591123300023266SoilILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG
Ga0209108_1011833613300025165SoilLGFLAIAIIIALFFLRNVLRDLFSEAASSVNNAPS
Ga0209108_1053341713300025165SoilQTTTEYAILLGFLAIAIIIALYFLRNVLRELFSDAASSVSGAPG
Ga0209341_1012081433300025325SoilEYAILLGFLAIAIIIALYFLRNVLRELFSDAASSVSGAPG
Ga0209341_1075700923300025325SoilTTTEYAILLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPGP
Ga0209341_1115082613300025325SoilAILLGFLAIAIIVALYFLRDVLRQLFSDAASSVSNAPS
Ga0210094_104628723300025549Natural And Restored WetlandsDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSDAASSVSNAPGP
Ga0207688_1082973123300025901Corn, Switchgrass And Miscanthus RhizosphereILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN
Ga0207680_1035876113300025903Switchgrass RhizosphereEREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG
Ga0207645_1095766923300025907Miscanthus RhizosphereGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG
Ga0207643_1076547813300025908Miscanthus RhizosphereLGFLAIAIIIALFFLRNVLRDLFSDAASSVSNAPG
Ga0207643_1097626713300025908Miscanthus RhizosphereAILLGFLAIAIIIALFFLRNVLRQLFSDAANSVSGAGN
Ga0207662_1018445343300025918Switchgrass RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG
Ga0207681_1133914313300025923Switchgrass RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRGPNQ
Ga0207650_1039751413300025925Switchgrass RhizosphereTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN
Ga0207650_1072060933300025925Switchgrass RhizosphereYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSGAPNG
Ga0207659_1022993113300025926Miscanthus RhizosphereLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN
Ga0207659_1059060413300025926Miscanthus RhizosphereTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG
Ga0207659_1080948713300025926Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN
Ga0207659_1154055813300025926Miscanthus RhizosphereREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG
Ga0207686_1116720413300025934Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS
Ga0207686_1120049123300025934Miscanthus RhizosphereILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPG
Ga0207686_1154117813300025934Miscanthus RhizosphereGFLAIAIIIALFFLRNVLRDLFSKAASSVNNSPGP
Ga0207686_1164728723300025934Miscanthus RhizosphereEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSTAPGS
Ga0207686_1174560823300025934Miscanthus RhizosphereREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSAGPGN
Ga0207669_1012442613300025937Miscanthus RhizosphereGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN
Ga0207669_1052597013300025937Miscanthus RhizosphereEDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG
Ga0207704_1125707713300025938Miscanthus RhizosphereTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG
Ga0207691_1061232913300025940Miscanthus RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAAQSVSRAPN
Ga0207691_1063507613300025940Miscanthus RhizosphereEREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG
Ga0207691_1153846023300025940Miscanthus RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSNAPG
Ga0207689_1024788213300025942Miscanthus RhizosphereLLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG
Ga0207661_1056443333300025944Corn RhizosphereILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG
Ga0207661_1097127123300025944Corn RhizosphereYAILLGFLAIAIIIALFFLRNVLRSLFSEAASSVSGAPNG
Ga0207668_1028961433300025972Switchgrass RhizosphereTEYAILLGFLAIAIIIALFFPRGVLRSLFSSAASSVSKAPGT
Ga0207648_1078377313300026089Miscanthus RhizosphereDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAAHSVSSAPSS
Ga0207676_1019532013300026095Switchgrass RhizosphereLGFLAISIIIALFFLRGVLRSLFSAAASSVSRAPNG
Ga0207674_1050284423300026116Corn RhizosphereLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPNG
Ga0207683_1003129173300026121Miscanthus RhizosphereTTEYAILLGFLAIAIIIALFFLRNVLRSLFSSAAQSVSRAPN
Ga0207683_1138017223300026121Miscanthus RhizosphereEREDGQTTTEYAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPN
Ga0209878_104281223300027163Groundwater SandQTTTEYAILLGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS
Ga0209861_103709313300027332Groundwater SandYAILLGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS
Ga0208890_102415423300027523SoilAILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSGAPG
Ga0209887_110719213300027561Groundwater SandLLGFLAIAIIVALFFLRNILRDLFSDAASSVSGAPTS
Ga0207428_1026960933300027907Populus RhizosphereTTEYAILLGFLAIAIIIALFFLRGVLRSLFSSAASSVSRAPG
Ga0207428_1063228313300027907Populus RhizosphereVHRLREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSDAASSVSGSTG
Ga0268266_1116833823300028379Switchgrass RhizosphereAILLGFLAIAIIIALFFLRGVLRSLFSAAASSVSRAPNG
Ga0247822_1168888823300028592SoilTEYAILLGFLAIAIIIALFFLRTVLRNLFSDAANSVSNAGG
Ga0307302_1020281113300028814SoilILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSNAPGG
Ga0307296_1048256723300028819SoilREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSRAPG
Ga0307277_1048712513300028881SoilAILLGFLAIAIIIALFFLRNVLRGLFSNAASSVSNAPS
Ga0268386_1052726913300030619SoilLLGFLAIAIIIALFFLRNVLRDLFSDAASSVSGAPDA
Ga0308152_11272723300030831SoilAILLGFLAIAIIIALFFLRNVLRSLFSTAASSVSNAPGG
Ga0308186_103726213300031422SoilLLGFLAIAIIIALFFLRNVLRSLFSSAASSVSRAPG
Ga0318515_1039366333300031572SoilYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS
Ga0247727_1112893523300031576BiofilmTEYAILLGFLAIAIIIALFFLRNVLRELFSEAASSVSNAPN
Ga0318560_1071770613300031682SoilREEGQTTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSIQKAPS
Ga0306918_1108678913300031744SoilILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS
Ga0318554_1013987133300031765SoilTTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS
Ga0318511_1021563613300031845SoilREEGQTTTEYAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAGS
Ga0315297_1108211513300031873SedimentTTTEYAILLGFLAIAIIIALFFLRNVLRALFSSAASSVSGAPG
Ga0310885_1043372433300031943SoilLGFLAIAIIVALFFLRNVLRGLFSDAASSVSNAPN
Ga0315278_1087241123300031997SedimentTTTEYAILLGFLAIAIIIALFFLRNVLRALFSSAASSVSGAPNG
Ga0315274_1157275323300031999SedimentLGFLAIAIIIALFFLRNVLRGLFSEAASSVSGAPG
Ga0310906_1027139213300032013SoilEYAILLGFLAIAIIIALFFLRNVLRGLFSTAASSVSNAPG
Ga0318514_1030297413300032066SoilAILVGFLAVAIIIALFFLRNQIKGLFSKAGSSVQNAPGS
Ga0315276_1146909023300032177SedimentREREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRALFSSAASSVSGAPNG
Ga0315286_1184294313300032342SedimentLREREDGQTTTEYAILLGFLAIAIIVALFFLRNVLRALFSSAASSVSGAPG
Ga0315287_1006484213300032397SedimentREREDGQTTTEYAILLGFLAIAIIVALFFLRDVLRALFSSAASSVSGAPG
Ga0315273_1137075913300032516SedimentTTEYAILLGFLAIAIIVAILLLKGALIDLFTAASNSVNNAPGNPAP
Ga0315273_1160564013300032516SedimentREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSEAASSVSGAPG
Ga0214472_1081715023300033407SoilGQTTTEYAILLGFLAIAIIIALYFLRDVLRGLFSDAAESVQSAPGGP
Ga0247830_1113963723300033551SoilVHDLRKREDGQTTTEYAILLGFLAIAIIIALFFLRNVLRGLFSSAASSVSRAPGS
Ga0364931_0112287_746_8653300034176SedimentYAILLGFLAIAIIIALYFLRDVLRQLFSDAASSVSNAPN
Ga0314783_140248_3_1523300034662SoilREDGQTTTEYAILLGFLAIAIIIALFFQRGVLRSLFSSAASSVSRAPGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.