NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012632

Metagenome / Metatranscriptome Family F012632

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012632
Family Type Metagenome / Metatranscriptome
Number of Sequences 279
Average Sequence Length 41 residues
Representative Sequence VRRLLLSATLLALALPAPAFARGEFDPTTEFEQHEWIPIHL
Number of Associated Samples 226
Number of Associated Scaffolds 279

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.86 %
% of genes near scaffold ends (potentially truncated) 98.57 %
% of genes from short scaffolds (< 2000 bps) 93.19 %
Associated GOLD sequencing projects 211
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.548 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.545 % of family members)
Environment Ontology (ENVO) Unclassified
(32.258 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.595 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 28.99%    β-sheet: 0.00%    Coil/Unstructured: 71.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 279 Family Scaffolds
PF12697Abhydrolase_6 9.68
PF00953Glycos_transf_4 2.15
PF13670PepSY_2 1.43
PF09527ATPase_gene1 1.08
PF12833HTH_18 1.08
PF00561Abhydrolase_1 1.08
PF14681UPRTase 0.72
PF14340DUF4395 0.36
PF04007DUF354 0.36
PF00353HemolysinCabind 0.36
PF12796Ank_2 0.36
PF01300Sua5_yciO_yrdC 0.36
PF00005ABC_tran 0.36
PF00464SHMT 0.36
PF03169OPT 0.36
PF13450NAD_binding_8 0.36
PF10282Lactonase 0.36
PF12840HTH_20 0.36
PF00753Lactamase_B 0.36
PF08122NDUF_B12 0.36
PF13544Obsolete Pfam Family 0.36
PF01047MarR 0.36
PF00119ATP-synt_A 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 279 Family Scaffolds
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 2.15
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.36
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.36
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 0.36
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 0.36
COG1297Predicted oligopeptide transporter, OPT familyGeneral function prediction only [R] 0.36
COG1817Predicted glycosyltransferaseGeneral function prediction only [R] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.55 %
UnclassifiedrootN/A6.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918006|ConsensusfromContig59862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
2170459019|G14TP7Y01D0BFUAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100631975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300000955|JGI1027J12803_100002771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300000956|JGI10216J12902_100784652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria945Open in IMG/M
3300000956|JGI10216J12902_104737824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300000956|JGI10216J12902_107156393All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300000956|JGI10216J12902_108496435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300000956|JGI10216J12902_111285827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300000956|JGI10216J12902_112278258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300000956|JGI10216J12902_115464087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300000956|JGI10216J12902_116980283Not Available632Open in IMG/M
3300001431|F14TB_101987887All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300001526|A105W1_1102657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300002568|C688J35102_119830158All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300004081|Ga0063454_101471801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300004081|Ga0063454_101674728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300004114|Ga0062593_100694914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300004114|Ga0062593_102685654Not Available567Open in IMG/M
3300004153|Ga0063455_100309653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300004156|Ga0062589_100034078All Organisms → cellular organisms → Bacteria2641Open in IMG/M
3300004156|Ga0062589_100828479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300004156|Ga0062589_101832707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300004157|Ga0062590_101553282All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300004463|Ga0063356_103225323All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300004479|Ga0062595_100795684All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300004479|Ga0062595_100841962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300005093|Ga0062594_101503124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300005093|Ga0062594_102618289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300005165|Ga0066869_10022807All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300005166|Ga0066674_10217143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300005166|Ga0066674_10565806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300005174|Ga0066680_10175536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1349Open in IMG/M
3300005175|Ga0066673_10601297All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005180|Ga0066685_10685830All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005187|Ga0066675_10731167All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005328|Ga0070676_10686040All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005329|Ga0070683_100719441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium956Open in IMG/M
3300005334|Ga0068869_100855333All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300005335|Ga0070666_11397722Not Available523Open in IMG/M
3300005336|Ga0070680_100200217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1684Open in IMG/M
3300005337|Ga0070682_101432341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300005339|Ga0070660_100220130All Organisms → cellular organisms → Bacteria1543Open in IMG/M
3300005341|Ga0070691_10296182All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300005343|Ga0070687_100655705All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300005343|Ga0070687_101514710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300005345|Ga0070692_11137413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300005354|Ga0070675_100459555All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300005356|Ga0070674_101377832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300005434|Ga0070709_11237409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300005435|Ga0070714_100677993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium994Open in IMG/M
3300005438|Ga0070701_11337663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300005440|Ga0070705_100397279All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300005441|Ga0070700_101863511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300005451|Ga0066681_10478208All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300005457|Ga0070662_101389532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300005458|Ga0070681_11698343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300005459|Ga0068867_100553710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300005459|Ga0068867_100611095All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300005468|Ga0070707_101747640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300005526|Ga0073909_10082096All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300005526|Ga0073909_10655286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300005529|Ga0070741_10186295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2037Open in IMG/M
3300005530|Ga0070679_100508982All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300005530|Ga0070679_100851854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium855Open in IMG/M
3300005530|Ga0070679_101253319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300005535|Ga0070684_100037282All Organisms → cellular organisms → Bacteria4169Open in IMG/M
3300005546|Ga0070696_100171634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1603Open in IMG/M
3300005549|Ga0070704_100218754All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300005549|Ga0070704_101388859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales644Open in IMG/M
3300005552|Ga0066701_10456585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300005556|Ga0066707_10050941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2400Open in IMG/M
3300005556|Ga0066707_10501800All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005558|Ga0066698_10232226All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300005558|Ga0066698_10653266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300005560|Ga0066670_10278703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1016Open in IMG/M
3300005560|Ga0066670_10728096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300005561|Ga0066699_10193497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1413Open in IMG/M
3300005563|Ga0068855_100778280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300005569|Ga0066705_10265662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300005569|Ga0066705_10282340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1053Open in IMG/M
3300005569|Ga0066705_10846983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300005578|Ga0068854_101065153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300005615|Ga0070702_100845214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300005616|Ga0068852_102133924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300005764|Ga0066903_101523198All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300005764|Ga0066903_108763989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300005764|Ga0066903_109021817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei505Open in IMG/M
3300005844|Ga0068862_100336061All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300006046|Ga0066652_100066710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2784Open in IMG/M
3300006046|Ga0066652_100416915All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300006046|Ga0066652_102021664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300006058|Ga0075432_10499787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300006163|Ga0070715_10407190All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300006175|Ga0070712_100527170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300006196|Ga0075422_10146959All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300006237|Ga0097621_100751535All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300006358|Ga0068871_102197120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300006580|Ga0074049_10317515Not Available560Open in IMG/M
3300006580|Ga0074049_13171399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300006791|Ga0066653_10095294All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300006791|Ga0066653_10736484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300006796|Ga0066665_10872349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300006804|Ga0079221_10658567All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300006806|Ga0079220_10284628All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300006806|Ga0079220_11223264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300006844|Ga0075428_101420660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300006846|Ga0075430_101015514All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006871|Ga0075434_100718754All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300006881|Ga0068865_100884584All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300006903|Ga0075426_10734831All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300006904|Ga0075424_100922049All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300006953|Ga0074063_13612879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300006954|Ga0079219_12284565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300009012|Ga0066710_102842787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300009098|Ga0105245_13159455Not Available510Open in IMG/M
3300009101|Ga0105247_10319941All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300009101|Ga0105247_10854000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300009137|Ga0066709_100944734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1259Open in IMG/M
3300009148|Ga0105243_10096399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2447Open in IMG/M
3300009162|Ga0075423_10232201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1933Open in IMG/M
3300009162|Ga0075423_10323094All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300009176|Ga0105242_11634903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300009551|Ga0105238_12978685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300009836|Ga0105068_1100195Not Available564Open in IMG/M
3300010039|Ga0126309_10168758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1190Open in IMG/M
3300010039|Ga0126309_11172582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300010042|Ga0126314_10855525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300010042|Ga0126314_11192659Not Available569Open in IMG/M
3300010301|Ga0134070_10157001Not Available818Open in IMG/M
3300010337|Ga0134062_10446218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300010366|Ga0126379_12393633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300010371|Ga0134125_11441094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300010399|Ga0134127_13188393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300010401|Ga0134121_11110053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria784Open in IMG/M
3300011003|Ga0138514_100127708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300011107|Ga0151490_1061647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300011271|Ga0137393_11151594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300011999|Ga0120148_1063902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300012001|Ga0120167_1050810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium912Open in IMG/M
3300012010|Ga0120118_1042154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300012198|Ga0137364_10989429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300012204|Ga0137374_11252457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300012211|Ga0137377_11013806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium761Open in IMG/M
3300012212|Ga0150985_116588095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300012212|Ga0150985_119898053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300012354|Ga0137366_10403264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium995Open in IMG/M
3300012357|Ga0137384_10619423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300012383|Ga0134033_1259547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300012403|Ga0134049_1213476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300012469|Ga0150984_120305678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300012484|Ga0157333_1012497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300012582|Ga0137358_11070477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012905|Ga0157296_10402364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300012917|Ga0137395_11003335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300012923|Ga0137359_10900556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300012925|Ga0137419_11616578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300012925|Ga0137419_11876581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300012930|Ga0137407_12337652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300012955|Ga0164298_10089003All Organisms → cellular organisms → Bacteria → Terrabacteria group1605Open in IMG/M
3300012957|Ga0164303_10649402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300012957|Ga0164303_11024059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300012977|Ga0134087_10236597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300012984|Ga0164309_10030773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2942Open in IMG/M
3300012984|Ga0164309_11290219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300012985|Ga0164308_11027971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300012987|Ga0164307_11793723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300012988|Ga0164306_10255015Not Available1259Open in IMG/M
3300012988|Ga0164306_10331156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1122Open in IMG/M
3300012989|Ga0164305_10159759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1540Open in IMG/M
3300012989|Ga0164305_10354722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1106Open in IMG/M
3300012989|Ga0164305_10774154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300013307|Ga0157372_10486875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1438Open in IMG/M
3300013308|Ga0157375_11456436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300013308|Ga0157375_12502968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300013770|Ga0120123_1020507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1330Open in IMG/M
3300013772|Ga0120158_10032302All Organisms → cellular organisms → Bacteria3967Open in IMG/M
3300013831|Ga0120126_1020943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300014150|Ga0134081_10290597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300014497|Ga0182008_10919425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300014827|Ga0120171_1002685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10727Open in IMG/M
3300014829|Ga0120104_1015206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1360Open in IMG/M
3300015053|Ga0137405_1262075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1144Open in IMG/M
3300015077|Ga0173483_10009241All Organisms → cellular organisms → Bacteria3339Open in IMG/M
3300015262|Ga0182007_10426148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300015371|Ga0132258_10026897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12744Open in IMG/M
3300015371|Ga0132258_13496746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M
3300015372|Ga0132256_103016373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300015373|Ga0132257_102986531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300015374|Ga0132255_100320845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2235Open in IMG/M
3300015374|Ga0132255_104715077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300017944|Ga0187786_10231053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300017947|Ga0187785_10724157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300017973|Ga0187780_11073014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300018027|Ga0184605_10514572Not Available520Open in IMG/M
3300018061|Ga0184619_10131075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1138Open in IMG/M
3300018061|Ga0184619_10232973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300018066|Ga0184617_1078797Not Available890Open in IMG/M
3300018074|Ga0184640_10139639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1075Open in IMG/M
3300018433|Ga0066667_10994038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300020076|Ga0206355_1588962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300020610|Ga0154015_1159214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300021344|Ga0193719_10058350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1674Open in IMG/M
3300021418|Ga0193695_1095144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300022467|Ga0224712_10255465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300022756|Ga0222622_10022203All Organisms → cellular organisms → Bacteria3250Open in IMG/M
3300022898|Ga0247745_1031122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300024284|Ga0247671_1061347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300025604|Ga0207930_1146978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300025911|Ga0207654_10752225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300025913|Ga0207695_11733403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300025915|Ga0207693_10186550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1632Open in IMG/M
3300025915|Ga0207693_10934930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300025919|Ga0207657_10416220Not Available1057Open in IMG/M
3300025922|Ga0207646_11647469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300025923|Ga0207681_10650538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300025924|Ga0207694_11676785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300025928|Ga0207700_12017014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300025933|Ga0207706_10019545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6094Open in IMG/M
3300025934|Ga0207686_10780916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300025939|Ga0207665_10027309All Organisms → cellular organisms → Bacteria3771Open in IMG/M
3300025945|Ga0207679_10346420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1294Open in IMG/M
3300025949|Ga0207667_10267319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1748Open in IMG/M
3300025981|Ga0207640_10502047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1010Open in IMG/M
3300026023|Ga0207677_10502482Not Available1049Open in IMG/M
3300026023|Ga0207677_10705538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium896Open in IMG/M
3300026041|Ga0207639_11878314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300026041|Ga0207639_12226781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300026078|Ga0207702_11402801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300026095|Ga0207676_12428958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300026116|Ga0207674_11170519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300026118|Ga0207675_101135544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300026121|Ga0207683_10474844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1154Open in IMG/M
3300026142|Ga0207698_11065058Not Available821Open in IMG/M
3300026295|Ga0209234_1164943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300026300|Ga0209027_1084372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1164Open in IMG/M
3300026322|Ga0209687_1120639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium845Open in IMG/M
3300026538|Ga0209056_10105932All Organisms → cellular organisms → Bacteria2277Open in IMG/M
3300027821|Ga0209811_10315316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300027826|Ga0209060_10354826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300027882|Ga0209590_10354411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300028710|Ga0307322_10058475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria950Open in IMG/M
3300028721|Ga0307315_10078281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium952Open in IMG/M
3300028754|Ga0307297_10104585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria934Open in IMG/M
3300028787|Ga0307323_10326868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300028807|Ga0307305_10413838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300028814|Ga0307302_10001874All Organisms → cellular organisms → Bacteria9242Open in IMG/M
3300028819|Ga0307296_10419072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium732Open in IMG/M
3300028824|Ga0307310_10277454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300028828|Ga0307312_10370390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300028828|Ga0307312_11095286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300028884|Ga0307308_10652541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300028885|Ga0307304_10370989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300030336|Ga0247826_10810541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300030902|Ga0308202_1073005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300031058|Ga0308189_10265241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300031170|Ga0307498_10286304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300031572|Ga0318515_10343347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M
3300031748|Ga0318492_10443022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300031782|Ga0318552_10606952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300031799|Ga0318565_10646715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300031820|Ga0307473_11523152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300031893|Ga0318536_10116010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1350Open in IMG/M
3300031938|Ga0308175_101093104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium884Open in IMG/M
3300031939|Ga0308174_11622156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300031939|Ga0308174_11631355Not Available554Open in IMG/M
3300032074|Ga0308173_10697126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300032075|Ga0310890_10679334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300032075|Ga0310890_11103525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300032126|Ga0307415_102053215Not Available557Open in IMG/M
3300032782|Ga0335082_11143259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300032828|Ga0335080_10828989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium954Open in IMG/M
3300032829|Ga0335070_11970533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300032893|Ga0335069_10489463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1428Open in IMG/M
3300033158|Ga0335077_11629840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300034669|Ga0314794_096880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300034817|Ga0373948_0020231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.58%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.15%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.15%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.15%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.79%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.79%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.08%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.08%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.72%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.36%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.36%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.36%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.36%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.36%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.36%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.36%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.36%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.36%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918006Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005899Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012484Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300013831Permafrost microbial communities from Nunavut, Canada - A21_5cm_6MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034669Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P1_C_017935002140918006SoilMRRPLLALTTLALVAPANAFARGTFDPTVEFEQHEW
4MG_009328602170459019Switchgrass, Maize And Mischanthus LitterMRRALFTISLLALALPGQALARGEFDPTHEFEQHEW
INPhiseqgaiiFebDRAFT_10063197513300000364SoilMKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLSPLNLS
JGI1027J12803_10000277123300000955SoilMKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLS
JGI10216J12902_10078465243300000956SoilVKRIFVSVTLLALALPAPAFARGTFDPTTEFEQHEWIPIHLGP
JGI10216J12902_10473782413300000956SoilMMRRALFLSATAVLLFPAAAFARGEFDPTTEFEQHEW
JGI10216J12902_10715639343300000956SoilVKRLIGLFTTLVVLAVPAPAMAKGEFHPEEEFELHDWIPIHIGPLNLSIN
JGI10216J12902_10849643533300000956SoilVRLRGALLTALGLALTLPAPAFARGEFDPTTEFEQHEWIPIHIGPL
JGI10216J12902_11128582723300000956SoilVKRLLFLAATFALAFPGAAFARGKFDPTTEFEQHEWVSIH
JGI10216J12902_11227825823300000956SoilMFVAATAALVFPTAAFARGEFDPTTEFEQHEWVSIHLGGLDLSI
JGI10216J12902_11546408713300000956SoilMMRRALLLATTAAMIFPAAAFARGDFDPTTEFEQHEWVSIH
JGI10216J12902_11698028333300000956SoilMKRALFVISLAALALPGSALARGDFDPTTEFEQHEW
F14TB_10198788743300001431SoilMRRALVAIALLALALPGQALARGEFDPTEEFEQHEWVPIHI
A105W1_110265733300001526PermafrostMKRLGILVLLALATPPTAFARGKFDPTTEFEQHEWIPIH
C688J35102_11983015813300002568SoilMMRRALVLATTFALIGPSSAFARGEFDPTKEFEQHEWVPIHLGPLN
Ga0063454_10147180123300004081SoilVRRALLTLSTLALLVPANAFARGEFDPTTEFEQHEWIPIHLG
Ga0063454_10167472823300004081SoilVRLRRTLVGLSALALTLPAPAFARGEFDPTTEFEQHEWIPIHLGPLN
Ga0062593_10069491443300004114SoilVKRALFLAATACLLFPAAGFARGKFDPTTEFEQHEWVSIHLG
Ga0062593_10268565413300004114SoilMRRALFILATLALTVPSQAFARGEFDPTHEFELDPWVSIHIGP
Ga0063455_10030965313300004153SoilMRRAVAIVTLAALALPSTAFARGEFDPTKEFEQHEWIPIHLGPL
Ga0062589_10003407843300004156SoilMKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLDLSI
Ga0062589_10082847913300004156SoilVRRLFVALAVLALATPANAFARGEFDPSEEFVQHEWIPIHLGP
Ga0062589_10183270723300004156SoilVRRALFAVALLALTLPGQALARGDFDPTTEFEQHEWVPIHLG
Ga0062590_10155328213300004157SoilMMRRWIFFAATAALLFPAAAFARGEFDPTTEFEQHEWIPIHL
Ga0063356_10322532313300004463Arabidopsis Thaliana RhizosphereMKRWLLLVATVALTFPAAAWARGEFDPTTEFEQHEWVSIHLGGLDL
Ga0062595_10079568413300004479SoilMKRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSIHLGP
Ga0062595_10084196213300004479SoilMKRALLTLSTLALLLPANAFARGEFDPTTEFEQHEWIPIH
Ga0062594_10150312433300005093SoilMKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGL
Ga0062594_10261828923300005093SoilVRRLVLLLATLALVAPANAFARGDFDPTTEFEQHEWIPIHLG
Ga0066869_1002280743300005165SoilMRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPL
Ga0066674_1021714343300005166SoilVRRFVLALTLAALALPSPAFARGHFDPTTEFEQHKWIPIHLGPLD
Ga0066674_1056580613300005166SoilVRARRVLVALVALSLAAPADAFARGEFDPSTEFEQHEWIPIHI
Ga0066680_1017553643300005174SoilVKRALLALTLLALAAPANAFARGSFDPTKEFELHDWVPIHIG
Ga0066673_1060129713300005175SoilVKRLLASATLLALALPAPALARGTFDPTTEFEQHEWVSIH
Ga0066685_1068583013300005180SoilMRRALAIATLLALSIPAPAFARGTFDPTTEFEQHEWIPIHL
Ga0066675_1073116713300005187SoilMRLRLFLTGALVALLAPQSALARGKFDPTTEFEQHNWIPIH
Ga0070676_1068604013300005328Miscanthus RhizosphereMTRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSIHL
Ga0070683_10071944113300005329Corn RhizosphereMRLRYLFVVATLALAAPPAALARGKFDPTTEFEQHEWISIHI
Ga0068869_10085533313300005334Miscanthus RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVSIH
Ga0070666_1139772213300005335Switchgrass RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVPIHL
Ga0070680_10020021743300005336Corn RhizosphereMRRLLVALSTIALLLPANAFARGEFDPTTEFEQHEWIPIHL
Ga0070682_10143234113300005337Corn RhizosphereMRRALVSLTMIALALPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLS
Ga0070660_10022013013300005339Corn RhizosphereVRRVLVTLSTLALLLPANAFARGSFDPTVEFEQHEWIPIHLGPLN
Ga0070691_1029618233300005341Corn, Switchgrass And Miscanthus RhizosphereVRRALFLVATLALLAPSSAFARGEFDPTEEFEQHEWVPIHLG
Ga0070687_10065570513300005343Switchgrass RhizosphereVRRAFFLVATLALLAPSSAFARGEFDPTKEFEQHEWVPIHLG
Ga0070687_10151471013300005343Switchgrass RhizosphereVKRLFVGLTLLALALPSPAFARGEFDPTTEFEQHEWVSIHLGPLN
Ga0070692_1113741313300005345Corn, Switchgrass And Miscanthus RhizosphereMRRALVAITTFALLAPSSAFARGDFDPTKEFEQHEWIPIHLG
Ga0070675_10045955513300005354Miscanthus RhizosphereMKRWLFLAATAALVFPTAAFARGKFDPTTEFEQHEWISIHIGGL
Ga0070674_10137783213300005356Miscanthus RhizosphereMRRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSI
Ga0070659_10129204313300005366Corn RhizosphereVRYRLLTVALLALALPSAASARGEFDPSIEFEQHEWIPIHLG
Ga0070709_1123740913300005434Corn, Switchgrass And Miscanthus RhizosphereVRRALVTLSTLALLLPANAFARGEFDPTTEFEQHEWIPIHLGP
Ga0070714_10067799343300005435Agricultural SoilMRRLLVALTTLALVVPANAFARGEFDPTKEFEQHEWIPIHL
Ga0070701_1133766323300005438Corn, Switchgrass And Miscanthus RhizosphereMKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLDL*
Ga0070705_10039727913300005440Corn, Switchgrass And Miscanthus RhizosphereMMRRVLFLSTTAVLLFPAAAWARGDFDPTTEFEQHEWVPIHLG
Ga0070700_10186351123300005441Corn, Switchgrass And Miscanthus RhizosphereMRRVLLALTTLALLAPADALARGEFDPSEEFEQHEWISIH
Ga0066681_1047820813300005451SoilMKRALAVVTLAVLSLPAPALARGKFDPTTEFEQHEWIPIH
Ga0070662_10138953223300005457Corn RhizosphereMKRALISVTTLALLAPASAFARGEFDPTTEFEQHDWIPIHLG
Ga0070681_1169834323300005458Corn RhizosphereMKRALIAVTTFALLAPASAFARGDFDPTTEFEQHDWIPIH
Ga0068867_10055371033300005459Miscanthus RhizosphereMKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSITK
Ga0068867_10061109513300005459Miscanthus RhizosphereVRRLVLLLATLALVAPANAFARGDFDPTTEFEQHEWIPIHLGP
Ga0070707_10174764023300005468Corn, Switchgrass And Miscanthus RhizosphereVRRALVTISLLALALPGQALALGDFDPTDEFEQHEWVPIHLG
Ga0073909_1008209613300005526Surface SoilMRRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIH
Ga0073909_1065528623300005526Surface SoilMKRWLLIATTAALAFPTAAFARGKFDPTTEFEQHEWI
Ga0070741_1018629563300005529Surface SoilVKRAFVTSVALALLFPTAAFARGKFDPTTEFEQHEW
Ga0070679_10050898213300005530Corn RhizosphereMMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLG
Ga0070679_10085185433300005530Corn RhizosphereMRLRYLFVVATLALAAPSTALARGKFDPTTEFEQHEWIPIHL
Ga0070679_10125331913300005530Corn RhizosphereMRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLG
Ga0070684_10003728283300005535Corn RhizosphereMRRALLAISIAALALPGSALARGDFDPTTEFEQHEWVPIH
Ga0070696_10017163413300005546Corn, Switchgrass And Miscanthus RhizosphereMKRLLVSATLLALALPAPAFARGHFDPTTEFEQHEWVPIHLG
Ga0070704_10021875443300005549Corn, Switchgrass And Miscanthus RhizosphereMRRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLS
Ga0070704_10138885933300005549Corn, Switchgrass And Miscanthus RhizosphereVRRVFAVLVALALAAPANAFARGEFDPTTEFEQHEWIPIH
Ga0066701_1045658513300005552SoilMRLRPLVIALTAFALLVPANAFARGEFDPTKEFEQH
Ga0066707_1005094113300005556SoilVRRLLVALALTALALPSPAFARGHFDPTTEFEQHKWIPIHLGPL
Ga0066707_1050180013300005556SoilMKRVLLALGTLALFAPGNAFARGQFDPTTEFEQHKW
Ga0066698_1023222613300005558SoilVRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHEWVSIHIGG
Ga0066698_1065326613300005558SoilMIRRLLVGVLVALAFPATAFARGEFDPTTEFEQHEWVPI
Ga0066670_1027870343300005560SoilMRLRRLVIALTTFALIAPASAFARGEFDPTKEFEQH
Ga0066670_1072809633300005560SoilMRRAVAIATLVALSLPTPALARGEFDPTKEFEQHEWIPIHLG
Ga0066699_1019349743300005561SoilMRRALIAMGTIALLLPANAFARGVFDPTTEFEQHEWIPIHLGP
Ga0068855_10077828013300005563Corn RhizosphereMKRWLFLASTAALVFPTAAFARGKFDPTTEFEQHEWI
Ga0066705_1026566213300005569SoilMRRALAIATLLALSIPAPAFARGTFDPTTEFEQHEWIPIHLGPL
Ga0066705_1028234043300005569SoilVRLRYLFVVATLALAVPPAAFARGKFDPTTEFEQHEW
Ga0066705_1084698313300005569SoilVRRLLTTLLLLALALPSPAFARGHFDPTTEFEQHEWVPIHLGPL
Ga0068854_10106515333300005578Corn RhizosphereVRRALVTLSTLALLLPANAFARGEFDPTTEFEQHEW
Ga0070702_10084521433300005615Corn, Switchgrass And Miscanthus RhizosphereVKRLIVTLSTLALLLPANAFARGEFDPTTEFEQHEWIPIHLGP
Ga0068852_10213392413300005616Corn RhizosphereMRRLLVTLTMLALVAPANAFARGEFDPTTEFEQHEWIPIHLGPLN
Ga0066903_10152319813300005764Tropical Forest SoilMKRWLFLAATFALAFPAAAWARGEFDPTTEFEQHEWISIHIG
Ga0066903_10876398923300005764Tropical Forest SoilVKRLLVALTTLALVAPPAAFARGTFDPTTEFEQHEWIPIHLG
Ga0066903_10902181713300005764Tropical Forest SoilMRLRTLLTTGALALAAPSTAFARGEFDPTTEFEQHEWVSIHLGPLNLSI
Ga0068862_10033606113300005844Switchgrass RhizosphereMMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEW
Ga0075271_1010499023300005899Rice Paddy SoilVRARLVLAAVLALTFPSAALARGKFDPTTEFEQHEWVPIHLGPLN
Ga0066652_10006671063300006046SoilVRRLLLSATLLALALPAPAFARGEFDPTTEFEQHEWIPIHL
Ga0066652_10041691513300006046SoilMRRALFLTAAMALLFPAAAFARGEFDPTTEFEQHEWVSIHLG
Ga0066652_10202166423300006046SoilMRVRRLLVALTTLALIAPASAFARGDFDPTTEFEQHEWVPIHL
Ga0075432_1049978723300006058Populus RhizosphereMTRALLAASVFALALPTQAFARGEFDPTTEFEQHEWVSI
Ga0070715_1040719013300006163Corn, Switchgrass And Miscanthus RhizosphereMKRALLAGSLFALTLPAQAFARGTFDPTTEFEQHEWVSIHIG
Ga0070712_10052717013300006175Corn, Switchgrass And Miscanthus RhizosphereMRLRNALLPLVGLALVVPAPAFARGEFDPTTEFEQHEWIPIHL
Ga0075422_1014695913300006196Populus RhizosphereMKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEW
Ga0097621_10075153513300006237Miscanthus RhizosphereVKRLIVLVSTLALLLPANAFARGEFDPTKEFEQHEW
Ga0068871_10219712023300006358Miscanthus RhizosphereMRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEW
Ga0074049_1031751513300006580SoilMRRALFLAATLALMAPSQAFARGEFDPTHEFELDAAF
Ga0074049_1317139923300006580SoilMKRLLFAACLFALALPAPAFARGEFDPTTEFEQHEWVPIH
Ga0066653_1009529443300006791SoilVRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHEWVSIHIGGLNLSIT
Ga0066653_1073648413300006791SoilMKRALAVVTLAVLSLPAPALARGKFDPTTEFEQHE
Ga0066665_1087234913300006796SoilVRRLLVALALTALALPSPAFARGHFDPTTEFEQQK
Ga0079221_1065856713300006804Agricultural SoilMKRALIVATTFALLAPASAFARGDFDPTTEFEQHEW
Ga0079220_1028462843300006806Agricultural SoilMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLSI
Ga0079220_1122326413300006806Agricultural SoilVKRVFVSATLLALALPAPAFARGHFDPTTEFEQHEWIPIHIGGLNLS
Ga0075428_10142066013300006844Populus RhizosphereVKRLFVSLTLLALALPSPAFARGEFDPTTEFEQHE
Ga0075430_10101551433300006846Populus RhizosphereMRRALLAASVFALALPTQAFARGEFDPTTEFEQHEW
Ga0075434_10071875443300006871Populus RhizosphereMKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWV
Ga0068865_10088458413300006881Miscanthus RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVPIHIGPLD
Ga0075426_1073483113300006903Populus RhizosphereMKRLFVLVVLALAAPQAALARGKFDPSTEFEQHEWIPIHLG
Ga0075424_10092204913300006904Populus RhizosphereVKRALATLTLLALTLPADAFARGEFDPTDEFEQHEWIPIH
Ga0074063_1361287933300006953SoilVRRALFTISLLALALPGQALARGEFDPTKEFEQHEWVPIHLGPL
Ga0079219_1228456513300006954Agricultural SoilMRRALLGATMLFLALPAPAFARGDFDPTTEFEQHEWVSIHLGPLN
Ga0066710_10284278723300009012Grasslands SoilVKRTLLALSVLALAAPANAFARGTFDPTTEFELKDWVPIHIGALNL
Ga0105245_1315945513300009098Miscanthus RhizosphereVKRLLIVATLFLAFPSAALARGKFDPSTEFEQHPWISIPKIG
Ga0105247_1031994113300009101Switchgrass RhizosphereMKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEW
Ga0105247_1085400013300009101Switchgrass RhizosphereMKRVLLAATMLFLALPAPAFARGEFDPTTEFEQHEWI
Ga0066709_10094473443300009137Grasslands SoilMKRALAIVALAALSLPAPSFARGKFDPTTEFEQHEWIPIHLGPLN
Ga0105243_1009639963300009148Miscanthus RhizosphereMKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPLNLSIT
Ga0075423_1023220153300009162Populus RhizosphereMRRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWIPIHIGPL
Ga0075423_1032309443300009162Populus RhizosphereVKRWLVSLTLLALALPSPALARGHFDPTTEFEQHEWVPIHIG
Ga0105242_1163490313300009176Miscanthus RhizosphereVRRLVLLLATLALVAPANAFARGDFDPTTEFEQHEWVSIHLGPLN
Ga0105238_1297868523300009551Corn RhizosphereMKRALLAVTTLALIAPSAAFARGTFDPTKEFEQHDWIPI
Ga0105068_110019513300009836Groundwater SandVRRTLFLAATLALTAPSSAFARGEFDPTHEFEQKEWVPIHIGP
Ga0126309_1016875813300010039Serpentine SoilMKRSYVALTTLVLLFPASASAAEFDPSEEFEQHPWVPIHLGP
Ga0126309_1117258213300010039Serpentine SoilVRRALLAVTLLALALPAQALARGEFDPTDEFEQHEWVS
Ga0126314_1085552513300010042Serpentine SoilVRFRCLLIALTTVALTAPASAFARGDFDPTTEFEQHEWVPIHL
Ga0126314_1119265913300010042Serpentine SoilVRRALLALSLLALTLPSAAFARGEFDPTDEFVQHE
Ga0134070_1015700113300010301Grasslands SoilVKRLFVSLTLLALALPAPAFARGTFDPTKEFEQHE
Ga0134062_1044621833300010337Grasslands SoilMIRRVVVGLVIGLAFPTTAFARGEFDPTTEFEKHEWVPIHLGPLNLSST
Ga0126379_1239363333300010366Tropical Forest SoilVKRWLFIAATVALFFPAAAYARGEFDPTTEFEQHEWISIHL
Ga0134125_1144109413300010371Terrestrial SoilVKRLIVTFSTLALLLPANAFARGEFDPTTEFEQHEWIPIHLGPLNL
Ga0134127_1318839323300010399Terrestrial SoilMRLRYLLTIATLALLVPQAAFARGEFDPTTEFEQHEWVSIHLGPLNLSIT
Ga0134121_1111005333300010401Terrestrial SoilMRRALLGATMLFLALPAPAFARGEFDPTTEFEQHEWVSIH
Ga0138514_10012770813300011003SoilMKRLTVLAATLALALPADAFARGEFDPSKEFEQHEWIPIHLGGLNLSVTK
Ga0151490_106164713300011107SoilVRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEW
Ga0137393_1115159413300011271Vadose Zone SoilMKRALVTLSTLALVGPANSFARGTFDPTAEFVQHEW
Ga0120148_106390213300011999PermafrostMKRLFVSLTLVALALPAPAFARGTFDPTTEFEQKAWVSIHLGP
Ga0120167_105081023300012001PermafrostVKRLVLTLSTVALMLPADAFARGVFDPTKEFEQHEWIPIHLGPLNLSITK
Ga0120118_104215443300012010PermafrostMKRLFVSLTLVALALPAPAFARGTFDPTTEFEQHEWVPIH
Ga0137364_1098942913300012198Vadose Zone SoilMRRAIAIATLLALSIPAPAFARGKFDPTTEFEQHDWIPIHLGPLN
Ga0137374_1125245723300012204Vadose Zone SoilMKRLTLLLGALALATPGDALARGEFDPAREFEQHEWIPIHLGPLNLSI
Ga0137377_1101380613300012211Vadose Zone SoilMRLRYLLVVATLALAAPPAALARGKFDPTTEFEQHEWVPIHL
Ga0150985_11658809523300012212Avena Fatua RhizosphereMKRALTAATTLALLAPASAFARGDFDPTTEFEQHE
Ga0150985_11989805313300012212Avena Fatua RhizosphereVRRLIVLLSTFALLLPANAFARGEFDPTTEFEQHEWIPIHLGP
Ga0137366_1040326443300012354Vadose Zone SoilMRWRRVAVVAALALTAPPAALARGTFDPTTEFEQHEWIPIHLSPLNLSVTK
Ga0137384_1061942333300012357Vadose Zone SoilMKRVFIVAILALAAPPAALARGKFDPTTEFEQHEWIPIHLG
Ga0134033_125954733300012383Grasslands SoilMRLRRLVIALTAFALLVPANAFARGEFDPTKEFEQ
Ga0134049_121347613300012403Grasslands SoilMRRAIAIATLLALSIPAPAFARGKFDPTTEFEQHDWIPIH
Ga0150984_12030567813300012469Avena Fatua RhizosphereMRRALVSLTMLALAVPAPAFARGDFDPTTEFEQHEWVSIHLGGLN
Ga0157333_101249713300012484SoilVRRALVTISLLALALPGQALARGEFDPTKEFEQHEWVPIHL
Ga0137358_1107047723300012582Vadose Zone SoilMRRLLIVAALALATPPAALARGKFDPTTEFEQHEWIPIHLG
Ga0157296_1040236413300012905SoilMRRLLVALTMLALAAPGNAFARGEFDPSEEFVQNEWI
Ga0137395_1100333513300012917Vadose Zone SoilMKRLMIVAILALATPPAALARGKFDPTTEFQQHEWIPIHLGP
Ga0137359_1090055613300012923Vadose Zone SoilMRRLLIVAALALATPPAALARGKFDPTTEFEQHEWIPIHL
Ga0137419_1161657823300012925Vadose Zone SoilMRLRYLLVVATLALAAPPAAFARGKFDPTTEFEQHEWV
Ga0137419_1187658123300012925Vadose Zone SoilVKRALTTLSFVTPCTLALLLPANAFARGAFDPTKEFEQHEWIPIHFGPLNMSIT
Ga0137407_1233765213300012930Vadose Zone SoilMRRFLIVATLALAAPPAALARGKFDPTTEFEQHEWVS
Ga0164298_1008900353300012955SoilMKRWLLIATTAALAFPTAAFARGKFDPTTEFEQHEWISIH
Ga0164303_1064940233300012957SoilMKRLLLVATLALVAPPAALARGTFDPTTEFEQHEWVPI
Ga0164303_1102405913300012957SoilMMRALAIVTLAALSLPSAAFARGEFDPTKEFEQHEWIPIHLG
Ga0134087_1023659733300012977Grasslands SoilMRRAVAIATLLALSIPAPAFARGKFDPTTEFEQHNWIP
Ga0164309_1003077313300012984SoilMRRALAIATLLALSIPAPAFARGTFDPTTEFEQHEWIPIHLGPLN
Ga0164309_1129021933300012984SoilMKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHLGPL
Ga0164308_1102797133300012985SoilVKRVLLTLSTLALLLPANAFARGSFDPTTEFEQHEWIPIHLGPLN
Ga0164307_1179372313300012987SoilMKRALILLSTVALLLPAIAFARGEFDPTTEFEQHEWIPIHLG
Ga0164306_1025501543300012988SoilMMRRALFLSATAVLLFPAAAWARGDFDPTTEFEQHEWV
Ga0164306_1033115613300012988SoilMRRALLAATMLFLALPTPAFARGEFDPTTEFEQHEWVSIH
Ga0164305_1015975913300012989SoilMRLRYLFVVATLALAAPPAALARGKFDPTTEFEQHEWIP
Ga0164305_1035472243300012989SoilMRRALLAATMLFLTLPAPAFARGEFDPTTEFEQHEWIPIHLGPL
Ga0164305_1077415413300012989SoilMRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEW
Ga0157372_1048687543300013307Corn RhizosphereMRRALLAATMIFLTLPAPACARGEFDPTTEFEQHEWVSIHLGP
Ga0157375_1145643633300013308Miscanthus RhizosphereMKRVLLAATMLFLALPAPAFARGEFDPTTEFEQHDWVSIHLG
Ga0157375_1250296813300013308Miscanthus RhizosphereVRRFLLALVTLALVAPTNAFARGDFDPTTEFEQHEWI
Ga0120123_102050743300013770PermafrostVKRALIFLSSAALLLPANAFARGEFDPTKEFEQHEWVPIHLG
Ga0120158_1003230213300013772PermafrostVKRWLIALSTVALLLPANAFARGTFDPTKEFEQHEWIPI
Ga0120126_102094333300013831PermafrostMRRLLLLLGTLALVLPANAFARGEFDPAKEFEQHEWIPIHLGPL
Ga0134081_1029059723300014150Grasslands SoilMKRAHAIVALAALSLPAPSIARGKFDPTTEFEQHEWIPIHLGPLNMSIT
Ga0182008_1091942513300014497RhizosphereMRRTLLLAFTLALLAPSSAFARGEFDPTKEFEQHEWIP
Ga0120171_100268513300014827PermafrostVKRLFVSLTLVALALPAPAFARGTFDPTTEFEQKAW
Ga0120104_101520613300014829PermafrostVRRALVFLSTVALLLPANAFARGVFDPTKEFEQHEWIPIHLG
Ga0137405_126207513300015053Vadose Zone SoilMRRAIAIATLLALSIPAPAFARGKFDPTTEFEQHDWIPIHLGPL
Ga0173483_1000924113300015077SoilVRRALFAVALLALTLPGQALARGDFDPTTEFEQHEWVPIHLGP
Ga0182007_1042614813300015262RhizosphereMRTRLTTIVLLALALPAPAYARGHFDPTTEFEQHEWIPIHLGP
Ga0132258_10026897213300015371Arabidopsis RhizosphereVKYRLLTVALLALVFPSTAFARGHFDPTTEFEQHEWVPIHLGPHNLSI
Ga0132258_1349674613300015371Arabidopsis RhizosphereVRRLLLAVTTLALVAPANAFARGEFDPTTEFEQHEWIPI
Ga0132256_10301637323300015372Arabidopsis RhizosphereVKRLIVTLSTLALLLPANAFARGEFDPTTEFEQHEWI
Ga0132257_10298653113300015373Arabidopsis RhizosphereMRRWIFVAATIALVFPAAAFARGEFDPTTEFEQHEWISIHI
Ga0132255_10032084553300015374Arabidopsis RhizosphereMKRALLAASLFALTLPAQAFARGTFDPTTEFEQHE
Ga0132255_10471507713300015374Arabidopsis RhizosphereVRRLIPFLATLALVAPANAFARGDFDPTTEFEQHEWVPIHL
Ga0187786_1023105333300017944Tropical PeatlandMRLRVLLTTLVLALVVPPGAFARGSFDPTTEFEQKEWVPI
Ga0187785_1072415723300017947Tropical PeatlandMRLRILLTTLVLALVVPPGAFARGSFDPTTEFEQKEWVPIHL
Ga0187780_1107301433300017973Tropical PeatlandVKRLLVVATLFLAAPQAAFARGTFDPTKEFEQHAWVPIHLGG
Ga0184605_1051457223300018027Groundwater SedimentMKRAIFLLATFALIAPGQAFARGEFDPTEEFELHEWIPIHI
Ga0184619_1013107543300018061Groundwater SedimentMRRLFTTAVLLALALPSAASARGKFDPTTEFEQHEWISIHLG
Ga0184619_1023297313300018061Groundwater SedimentVKRLLLLLTTVALAAPANAFARGEFDPTVEFEQHEWVPIHLGPLNL
Ga0184617_107879733300018066Groundwater SedimentMKRLTVLAATLALALPADAFARGEFDPSKEFEQHE
Ga0184640_1013963913300018074Groundwater SedimentVRRVLFTISLLALALPGQAFARGDFDPTQEFEQHEWVP
Ga0066667_1099403813300018433Grasslands SoilMRRAFAIVTLLALSLPAPALARGKFDPTKEFEQHEWIPIHLGPLN
Ga0206355_158896213300020076Corn, Switchgrass And Miscanthus RhizosphereMRRLLLLGFTIALLAPSSAFARGSFDPTHEFEQREWIPIHLGP
Ga0154015_115921423300020610Corn, Switchgrass And Miscanthus RhizosphereVKRVIVMVSTLALLLPANAFARGEFDPTKEFEQHEWIPIHLGPINL
Ga0193719_1005835013300021344SoilMKRAIAIATLLALSIPTPAFARGTFDPTTEFEQHDWIPIHLGP
Ga0193695_109514413300021418SoilMRMRRFLIVATLALAAPPAALARGKFDPTTEFEQHEWVS
Ga0224712_1025546533300022467Corn, Switchgrass And Miscanthus RhizosphereMRRLLLLGFTIALLAPSSAFARGSFDPTHEFEQREWIPIHLG
Ga0222622_1002220313300022756Groundwater SedimentVRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLAGLN
Ga0247745_103112233300022898SoilMKRALLAASVFALALPTQAFARGEFDPTTEFEQHEWV
Ga0247671_106134723300024284SoilMKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLSI
Ga0207930_114697813300025604Arctic Peat SoilMKRLGILVLLALASPPAALARGKFDPTTEFEQHEWIPIHLGP
Ga0207654_1075222533300025911Corn RhizosphereVRRAFVTLSTLALLLPANAFARGEFDPTTEFEQHE
Ga0207695_1173340323300025913Corn RhizosphereVKRLLVALAALALLLPGNAFARGDFDPTDEFVQNDWIPIHLGP
Ga0207693_1018655013300025915Corn, Switchgrass And Miscanthus RhizosphereMNTVAMKRLGILIVLALAVPQAASARGTFDPTTEFEQHEWIPIHLGPLNLS
Ga0207693_1093493013300025915Corn, Switchgrass And Miscanthus RhizosphereMRRFLIVVTLALAAPPAALARGKFDPTTEFEQHEWIPIHLGPLNLSI
Ga0207657_1041622013300025919Corn RhizosphereVKRALFAVALLALTLPSQALARGDFDPTDEFEQHEWV
Ga0207646_1164746913300025922Corn, Switchgrass And Miscanthus RhizosphereVRRLLVALTTLALVAPPNAFARGEFDPTTEFEQHEWVPIHLG
Ga0207681_1065053833300025923Switchgrass RhizosphereVKRALFAVALLALTLPSQALARGDFDPTDEFEQHEWVPIH
Ga0207694_1167678513300025924Corn RhizosphereMKRALLAVTTLALIAPSAAFARGTFDPTKEFEQHEWVSIH
Ga0207700_1201701423300025928Corn, Switchgrass And Miscanthus RhizosphereVTVRRALLALSVFALLLPANAFARGEFDPTKEFEQKEW
Ga0207706_1001954593300025933Corn RhizosphereMRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIHLGGLNLSI
Ga0207686_1078091633300025934Miscanthus RhizosphereMRRALLAATMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLG
Ga0207665_1002730973300025939Corn, Switchgrass And Miscanthus RhizosphereVRRRLFPLALALTALALPSPAFARGHFDPTTEFEQHKWIPIH
Ga0207679_1034642043300025945Corn RhizosphereVKRALFAVALLALTLPSQALARGDFDPTDEFEQHEWVPIHLG
Ga0207667_1026731953300025949Corn RhizosphereMRLRYLLTIATLALLVPQAAFARGEFDPTTEFEQHEWVPIHLGPL
Ga0207640_1050204713300025981Corn RhizosphereMRRALVSLTMLALALPAPAFARGDFDPTTEFEQHEWVSIH
Ga0207677_1050248243300026023Miscanthus RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWVPIHLGSLNLSITK
Ga0207677_1070553813300026023Miscanthus RhizosphereVKRLIVTLSTLALLLPANAFARGEFDPTTEFEQHEW
Ga0207639_1187831413300026041Corn RhizosphereMRLRYLFVVATLALAAPSTALARGKFDPTTEFEQHEWI
Ga0207639_1222678113300026041Corn RhizosphereVTRLRLVLLTALFALTVPSVAMARGEFDPTTEFEQHEWISI
Ga0207702_1140280113300026078Corn RhizosphereVKRVIVMVSTLALLLPANAFARGEFDPTKEFEQHEWIPIHLG
Ga0207676_1242895823300026095Switchgrass RhizosphereVKRVIVMVSTLALLLPANAFARGEFDPTKEFEQHEWIPIHLGP
Ga0207674_1117051933300026116Corn RhizosphereMKRWLFLAATAALVFPTAAFARGKFDPTTEFEQHEWISI
Ga0207675_10113554413300026118Switchgrass RhizosphereMKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWISIHIGGLDL
Ga0207683_1047484413300026121Miscanthus RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQHEWIPIHLGSLNLSI
Ga0207698_1106505833300026142Corn RhizosphereMMRRVLFLSATAVLLFPAAAWARGDFDPTTEFEQH
Ga0209234_116494313300026295Grasslands SoilVRRLFVSLTLLALALPSPAFARGHFDPTTEFEQHE
Ga0209027_108437213300026300Grasslands SoilVKRVLVSATLIALALPSTAFARGKFDPTTEFEQHEWIPIHL
Ga0209687_112063933300026322SoilVRLRYLFVVATLALAVPPAAFARGKFDPTTEFEQHEWVP
Ga0209056_1010593213300026538SoilVRRLLVALALTALALPSPAFARGHFDPTTEFEQHKWIPIHLGPLDL
Ga0209811_1031531613300027821Surface SoilMRRLLLALTTFALVAPAGAFARGDFDPTTEFEQHEWI
Ga0209060_1035482633300027826Surface SoilVRRALLALSVFALLLPANAFARGQFDPTKEFEQKEWVPIHL
Ga0209590_1035441113300027882Vadose Zone SoilVKRLLLLLTTLALVAPANAFARGEFDPTTEFEQHEWVPIHLGALNLS
Ga0307322_1005847513300028710SoilVKRLLVSLALFALALPSSAFARGTFDPTTEFEQHEWVSIHLGPL
Ga0307315_1007828133300028721SoilVRRLLLAVTTLALVAPANAFARGEFDPTKEFEQHEWIPIHLGVLNLSI
Ga0307297_1010458543300028754SoilMRRMLLAATMLFLALPAPAFARGDFDPTTEFEQHE
Ga0307323_1032686813300028787SoilMKRVLVTITTLALLAPANAFARGDFDPTTEFEQHKWVKIEL
Ga0307305_1041383813300028807SoilMKRWLFLASTAALVFPTAAFARGKFDPTTEFEQHEWISIHIGGLDLSI
Ga0307302_10001874143300028814SoilVRRALCGVILGAVWLLALPAQALARGSFDPTTEFEQHEWIPIHIAGL
Ga0307296_1041907233300028819SoilVRRLLLAVTTLALVAPANAFARGEFDPTTEFEQHEW
Ga0307310_1027745433300028824SoilMRLRYLLVVATLALAAPPAALARGKFDPTTEFEQHEWVPIHLGPLNLS
Ga0307312_1037039033300028828SoilMKRAIAIATLLALSIPTPAFARGTFDPTTEFEQHDWIPIHLGPL
Ga0307312_1109528613300028828SoilMKRMLVALSTIALLLPANAFARGEFDPTTEFEQHEWIPIHLGPI
Ga0307308_1065254113300028884SoilMRMRRFLIVATLALAAPPAALARGKFDPTTEFEQHEWVSIH
Ga0307304_1037098913300028885SoilVKRLLAGAILFALTMPAPAFARGTFDPTTEFEQHEWIPI
Ga0247826_1081054133300030336SoilMRRWIFVAATIALVFPVAAFARGEFDPTTEFEQHE
Ga0308202_107300513300030902SoilMKRAIAIATLLALSIPAPAFARGTFDPTTEFEQHDWIPIHL
Ga0308189_1026524133300031058SoilVKRLLVSLALFALALPSSAFARGTFDPTTEFEQHEWVSIHLGPLNLSI
Ga0307498_1028630413300031170SoilMRRALLALTMLFLALPAPAFARGEFDPTTEFEQHEWVSIHLGPLNLS
Ga0318515_1034334713300031572SoilVRRALLALTTVALLLPANAFARGSFDPTKEFEQKEWVPIHI
Ga0318492_1044302213300031748SoilVKRLVVAFATLALLAPANAFARGEFDPSKEFEQHTWIPIH
Ga0318552_1060695223300031782SoilVRRALLALTTVALLLPANAFARGSFDPTKEFEQKEWVPIH
Ga0318565_1064671513300031799SoilVKRLVVAFATLALLAPANAFARGEFDPSKEFEQHTWIP
Ga0307473_1152315213300031820Hardwood Forest SoilVKRLFVGLTLLALALPAPAFARGTFDPTTEFEQHEWIPIHLGPLNL
Ga0318536_1011601043300031893SoilVRRALLALTTVALLLPANAFARGSFDPTKEFEQKEWDPIHIGPLNLSI
Ga0308175_10109310413300031938SoilVKTRLITVALLALTFPSAAFARGSFDPTVEFEQHEWIPI
Ga0308174_1162215613300031939SoilMRLRYLFVVATLALAAPSTALARGKFDPTTEFEQHEWIPIHLGP
Ga0308174_1163135523300031939SoilVKTRLTTALFLLLAFPSTAFARGDFDPTVEFEQHEWIPIHLGPLNLS
Ga0308173_1069712613300032074SoilMRRALLAATMLFLALPAPAFARGDFDPTTEFEQHEWV
Ga0310890_1067933413300032075SoilMKRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLG
Ga0310890_1110352513300032075SoilMKRWLFVATTVALAFPTAAFARGKFDPTTEFEQHEWIS
Ga0307415_10205321513300032126RhizosphereVRKALFLVATLALLAPSSAFARGEFDPTHEFEQKEWVPIH
Ga0335082_1114325913300032782SoilVRRALAALGTLALLLPANAFARGEFDPTKEFEQKE
Ga0335080_1082898913300032828SoilLTLRRAFVLVSTFALLLPGSAFAGTSFDPTTEFEQHAWVPIHIFGLDL
Ga0335070_1197053313300032829SoilMRLRVLLTTLALALVVPPAAFARGSFDPTAEFEQKEWVPIHLGPLN
Ga0335069_1048946313300032893SoilLTLRRAFVLVSTFALLLPGSAFASTSFDPTTEFEQHAWVPIHIFGLDL
Ga0335077_1162984033300033158SoilMKRALAALATLALLVPANAFARGSFDPTKEFEQREWV
Ga0314794_096880_509_6253300034669SoilMRRALLAASVFALALPTQAFARGEFDPTTEFEQHEWIPI
Ga0373948_0020231_1126_12663300034817Rhizosphere SoilMRRALLAASLFALVLPAQAFARGSFDPTTEFEQHEWVSIHVLGLNLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.