Basic Information | |
---|---|
Family ID | F012455 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 280 |
Average Sequence Length | 41 residues |
Representative Sequence | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ |
Number of Associated Samples | 185 |
Number of Associated Scaffolds | 280 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 44.40 % |
% of genes near scaffold ends (potentially truncated) | 21.79 % |
% of genes from short scaffolds (< 2000 bps) | 70.00 % |
Associated GOLD sequencing projects | 168 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.786 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.143 % of family members) |
Environment Ontology (ENVO) | Unclassified (82.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.571 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 280 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 7.50 |
PF13640 | 2OG-FeII_Oxy_3 | 0.71 |
PF01391 | Collagen | 0.71 |
PF07235 | DUF1427 | 0.36 |
PF13578 | Methyltransf_24 | 0.36 |
PF10145 | PhageMin_Tail | 0.36 |
PF04860 | Phage_portal | 0.36 |
PF00255 | GSHPx | 0.36 |
PF00041 | fn3 | 0.36 |
PF05050 | Methyltransf_21 | 0.36 |
PF04572 | Gb3_synth | 0.36 |
PF02675 | AdoMet_dc | 0.36 |
PF00210 | Ferritin | 0.36 |
PF00590 | TP_methylase | 0.36 |
PF14025 | DUF4241 | 0.36 |
PF01370 | Epimerase | 0.36 |
PF02867 | Ribonuc_red_lgC | 0.36 |
PF13524 | Glyco_trans_1_2 | 0.36 |
PF01464 | SLT | 0.36 |
COG ID | Name | Functional Category | % Frequency in 280 Family Scaffolds |
---|---|---|---|
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.36 |
COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.36 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.36 |
COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.79 % |
All Organisms | root | All Organisms | 43.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352004|2199788003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
2199352005|2199916473 | Not Available | 25101 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1007321 | Not Available | 6443 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1016627 | All Organisms → Viruses → Predicted Viral | 3588 | Open in IMG/M |
3300000756|JGI12421J11937_10125306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300000756|JGI12421J11937_10172759 | Not Available | 519 | Open in IMG/M |
3300001848|RCM47_1002035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2293 | Open in IMG/M |
3300002278|B570J29590_100545 | All Organisms → Viruses → Predicted Viral | 3583 | Open in IMG/M |
3300002298|B570J29599_1001320 | Not Available | 1899 | Open in IMG/M |
3300002306|B570J29618_1010939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300002408|B570J29032_109259278 | Not Available | 659 | Open in IMG/M |
3300002835|B570J40625_100000109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 112996 | Open in IMG/M |
3300002835|B570J40625_100000320 | Not Available | 77705 | Open in IMG/M |
3300002835|B570J40625_100074057 | All Organisms → Viruses → Predicted Viral | 4479 | Open in IMG/M |
3300002835|B570J40625_100222281 | All Organisms → Viruses → Predicted Viral | 2011 | Open in IMG/M |
3300002835|B570J40625_100230365 | Not Available | 1960 | Open in IMG/M |
3300002835|B570J40625_100669188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300002835|B570J40625_101201254 | Not Available | 635 | Open in IMG/M |
3300003277|JGI25908J49247_10000306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14701 | Open in IMG/M |
3300003388|JGI25910J50241_10031411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1795 | Open in IMG/M |
3300003393|JGI25909J50240_1119059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300003411|JGI25911J50253_10063711 | Not Available | 1214 | Open in IMG/M |
3300003499|JGI25930J51415_1015011 | Not Available | 1508 | Open in IMG/M |
3300003804|Ga0007817_1004280 | Not Available | 1061 | Open in IMG/M |
3300003806|Ga0007864_1001942 | Not Available | 2228 | Open in IMG/M |
3300003815|Ga0007856_1000789 | All Organisms → Viruses → Predicted Viral | 3589 | Open in IMG/M |
3300004692|Ga0065171_1035128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 808 | Open in IMG/M |
3300004770|Ga0007804_1083265 | Not Available | 821 | Open in IMG/M |
3300004770|Ga0007804_1108156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 705 | Open in IMG/M |
3300004806|Ga0007854_10042967 | All Organisms → Viruses → Predicted Viral | 2285 | Open in IMG/M |
3300004806|Ga0007854_10286543 | Not Available | 684 | Open in IMG/M |
3300004807|Ga0007809_10057667 | Not Available | 1249 | Open in IMG/M |
3300005517|Ga0070374_10223781 | Not Available | 965 | Open in IMG/M |
3300005527|Ga0068876_10007181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7521 | Open in IMG/M |
3300005527|Ga0068876_10512516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 658 | Open in IMG/M |
3300005580|Ga0049083_10322592 | Not Available | 515 | Open in IMG/M |
3300005581|Ga0049081_10253196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300005581|Ga0049081_10283113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300005581|Ga0049081_10301998 | Not Available | 551 | Open in IMG/M |
3300005582|Ga0049080_10191521 | Not Available | 677 | Open in IMG/M |
3300005584|Ga0049082_10110395 | Not Available | 962 | Open in IMG/M |
3300005585|Ga0049084_10292591 | Not Available | 541 | Open in IMG/M |
3300005662|Ga0078894_10126039 | All Organisms → Viruses → Predicted Viral | 2283 | Open in IMG/M |
3300005805|Ga0079957_1005681 | Not Available | 10112 | Open in IMG/M |
3300005805|Ga0079957_1064866 | Not Available | 2142 | Open in IMG/M |
3300005805|Ga0079957_1183835 | Not Available | 1025 | Open in IMG/M |
3300006071|Ga0007876_1000782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11503 | Open in IMG/M |
3300006071|Ga0007876_1011170 | Not Available | 2580 | Open in IMG/M |
3300006105|Ga0007819_1017269 | Not Available | 1760 | Open in IMG/M |
3300006108|Ga0007862_1051957 | Not Available | 833 | Open in IMG/M |
3300006109|Ga0007870_1003673 | All Organisms → Viruses → Predicted Viral | 3592 | Open in IMG/M |
3300006114|Ga0007815_1051378 | Not Available | 862 | Open in IMG/M |
3300006120|Ga0007867_1113662 | Not Available | 583 | Open in IMG/M |
3300006484|Ga0070744_10020119 | Not Available | 1982 | Open in IMG/M |
3300006484|Ga0070744_10244772 | Not Available | 507 | Open in IMG/M |
3300006639|Ga0079301_1000889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14428 | Open in IMG/M |
3300006917|Ga0075472_10562174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 570 | Open in IMG/M |
3300007735|Ga0104988_10865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34464 | Open in IMG/M |
3300007974|Ga0105747_1182927 | Not Available | 686 | Open in IMG/M |
3300008107|Ga0114340_1194276 | Not Available | 690 | Open in IMG/M |
3300008108|Ga0114341_10121868 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
3300008110|Ga0114343_1109304 | Not Available | 943 | Open in IMG/M |
3300008113|Ga0114346_1173919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300008114|Ga0114347_1035591 | All Organisms → Viruses → Predicted Viral | 3945 | Open in IMG/M |
3300008116|Ga0114350_1004189 | Not Available | 7369 | Open in IMG/M |
3300008116|Ga0114350_1046877 | Not Available | 2816 | Open in IMG/M |
3300008116|Ga0114350_1112117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
3300008259|Ga0114841_1029085 | Not Available | 2840 | Open in IMG/M |
3300008953|Ga0104241_1000369 | Not Available | 3686 | Open in IMG/M |
3300008962|Ga0104242_1050432 | Not Available | 701 | Open in IMG/M |
3300008962|Ga0104242_1061384 | Not Available | 630 | Open in IMG/M |
3300009026|Ga0102829_1017877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2006 | Open in IMG/M |
3300009026|Ga0102829_1261349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300009068|Ga0114973_10004558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9587 | Open in IMG/M |
3300009068|Ga0114973_10051907 | Not Available | 2419 | Open in IMG/M |
3300009068|Ga0114973_10077068 | Not Available | 1919 | Open in IMG/M |
3300009068|Ga0114973_10232427 | Not Available | 999 | Open in IMG/M |
3300009068|Ga0114973_10351075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300009068|Ga0114973_10537878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300009068|Ga0114973_10603870 | Not Available | 562 | Open in IMG/M |
3300009151|Ga0114962_10007902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8051 | Open in IMG/M |
3300009151|Ga0114962_10017005 | Not Available | 5201 | Open in IMG/M |
3300009151|Ga0114962_10018351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4988 | Open in IMG/M |
3300009152|Ga0114980_10357845 | Not Available | 841 | Open in IMG/M |
3300009154|Ga0114963_10042411 | All Organisms → Viruses → Predicted Viral | 2948 | Open in IMG/M |
3300009155|Ga0114968_10000102 | Not Available | 65137 | Open in IMG/M |
3300009155|Ga0114968_10420240 | Not Available | 727 | Open in IMG/M |
3300009155|Ga0114968_10532587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300009158|Ga0114977_10014451 | All Organisms → Viruses → Predicted Viral | 4983 | Open in IMG/M |
3300009158|Ga0114977_10349966 | Not Available | 832 | Open in IMG/M |
3300009159|Ga0114978_10204536 | Not Available | 1246 | Open in IMG/M |
3300009159|Ga0114978_10305668 | Not Available | 973 | Open in IMG/M |
3300009159|Ga0114978_10792299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300009163|Ga0114970_10715483 | Not Available | 531 | Open in IMG/M |
3300009164|Ga0114975_10412465 | Not Available | 736 | Open in IMG/M |
3300009181|Ga0114969_10131647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1586 | Open in IMG/M |
3300009183|Ga0114974_10675079 | Not Available | 563 | Open in IMG/M |
3300009184|Ga0114976_10294644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300010158|Ga0114960_10377693 | Not Available | 696 | Open in IMG/M |
3300010160|Ga0114967_10082847 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
3300010334|Ga0136644_10108811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1717 | Open in IMG/M |
3300011010|Ga0139557_1026094 | Not Available | 1048 | Open in IMG/M |
3300011010|Ga0139557_1034727 | Not Available | 884 | Open in IMG/M |
3300011010|Ga0139557_1069618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300011011|Ga0139556_1005487 | Not Available | 1850 | Open in IMG/M |
3300011113|Ga0151517_1550 | Not Available | 13133 | Open in IMG/M |
3300012000|Ga0119951_1006449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 5382 | Open in IMG/M |
3300012000|Ga0119951_1012440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3386 | Open in IMG/M |
3300012000|Ga0119951_1021028 | Not Available | 2331 | Open in IMG/M |
3300012000|Ga0119951_1084508 | Not Available | 794 | Open in IMG/M |
3300012000|Ga0119951_1126180 | Not Available | 580 | Open in IMG/M |
3300012013|Ga0153805_1091840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300012017|Ga0153801_1045126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300013004|Ga0164293_10553389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300013005|Ga0164292_10621887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300013006|Ga0164294_10389382 | Not Available | 956 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1244446 | Not Available | 642 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10159601 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10153494 | Not Available | 1516 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10474261 | Not Available | 692 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10370017 | Not Available | 901 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10418660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
3300013295|Ga0170791_10912785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300014050|Ga0119952_1132525 | Not Available | 550 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10152488 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10276511 | Not Available | 1016 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10538666 | Not Available | 648 | Open in IMG/M |
3300014819|Ga0119954_1000059 | Not Available | 34219 | Open in IMG/M |
3300017722|Ga0181347_1134227 | Not Available | 685 | Open in IMG/M |
3300017788|Ga0169931_10364014 | Not Available | 1091 | Open in IMG/M |
3300017788|Ga0169931_10520134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300017788|Ga0169931_10595993 | Not Available | 752 | Open in IMG/M |
3300019784|Ga0181359_1062631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
3300020048|Ga0207193_1829447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300020141|Ga0211732_1046108 | Not Available | 673 | Open in IMG/M |
3300020141|Ga0211732_1496727 | Not Available | 2305 | Open in IMG/M |
3300020151|Ga0211736_10203123 | Not Available | 646 | Open in IMG/M |
3300020151|Ga0211736_10410718 | Not Available | 586 | Open in IMG/M |
3300020151|Ga0211736_10453311 | Not Available | 536 | Open in IMG/M |
3300020159|Ga0211734_10836294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300020160|Ga0211733_10026807 | Not Available | 603 | Open in IMG/M |
3300020160|Ga0211733_10984790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300020160|Ga0211733_10994522 | Not Available | 852 | Open in IMG/M |
3300020161|Ga0211726_10124537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300020161|Ga0211726_10736146 | Not Available | 788 | Open in IMG/M |
3300020172|Ga0211729_10280834 | Not Available | 692 | Open in IMG/M |
3300020172|Ga0211729_10659386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300020172|Ga0211729_11246959 | Not Available | 1386 | Open in IMG/M |
3300020172|Ga0211729_11396754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300020494|Ga0208326_126910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300020506|Ga0208091_1016785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300020515|Ga0208234_1011259 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
3300020515|Ga0208234_1019478 | Not Available | 796 | Open in IMG/M |
3300020521|Ga0208482_1025276 | Not Available | 796 | Open in IMG/M |
3300020527|Ga0208232_1010611 | Not Available | 1425 | Open in IMG/M |
3300020529|Ga0208233_1003347 | Not Available | 2753 | Open in IMG/M |
3300020536|Ga0207939_1032920 | Not Available | 672 | Open in IMG/M |
3300020542|Ga0208857_1046278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300020543|Ga0208089_1002237 | Not Available | 4292 | Open in IMG/M |
3300020686|Ga0214194_100398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6636 | Open in IMG/M |
3300020727|Ga0214246_1014293 | Not Available | 1408 | Open in IMG/M |
3300021131|Ga0214206_1000278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14330 | Open in IMG/M |
3300021131|Ga0214206_1006089 | All Organisms → Viruses → Predicted Viral | 1981 | Open in IMG/M |
3300021131|Ga0214206_1017081 | Not Available | 929 | Open in IMG/M |
3300021131|Ga0214206_1019571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300021131|Ga0214206_1031533 | Not Available | 609 | Open in IMG/M |
3300021131|Ga0214206_1032588 | Not Available | 596 | Open in IMG/M |
3300021438|Ga0213920_1001123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15966 | Open in IMG/M |
3300021519|Ga0194048_10005716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5918 | Open in IMG/M |
3300021600|Ga0194059_1056448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1276 | Open in IMG/M |
3300022179|Ga0181353_1006802 | All Organisms → Viruses → Predicted Viral | 2758 | Open in IMG/M |
3300022591|Ga0236341_1003451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7430 | Open in IMG/M |
3300022602|Ga0248169_132429 | All Organisms → Viruses → Predicted Viral | 2728 | Open in IMG/M |
3300022752|Ga0214917_10011738 | Not Available | 8046 | Open in IMG/M |
3300022752|Ga0214917_10014512 | Not Available | 6923 | Open in IMG/M |
3300022752|Ga0214917_10038621 | Not Available | 3429 | Open in IMG/M |
3300022752|Ga0214917_10244873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300023174|Ga0214921_10001049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 48119 | Open in IMG/M |
3300023174|Ga0214921_10006304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16325 | Open in IMG/M |
3300023174|Ga0214921_10030024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5363 | Open in IMG/M |
3300023174|Ga0214921_10055399 | All Organisms → Viruses → Predicted Viral | 3422 | Open in IMG/M |
3300023174|Ga0214921_10247577 | Not Available | 1049 | Open in IMG/M |
3300023174|Ga0214921_10308506 | Not Available | 875 | Open in IMG/M |
3300023174|Ga0214921_10434303 | Not Available | 654 | Open in IMG/M |
3300023179|Ga0214923_10044258 | Not Available | 3484 | Open in IMG/M |
3300023184|Ga0214919_10795879 | Not Available | 517 | Open in IMG/M |
3300024346|Ga0244775_10537448 | Not Available | 952 | Open in IMG/M |
3300025336|Ga0208619_100781 | Not Available | 2128 | Open in IMG/M |
3300025336|Ga0208619_104378 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
3300025336|Ga0208619_119004 | Not Available | 509 | Open in IMG/M |
3300025379|Ga0208738_1053864 | Not Available | 573 | Open in IMG/M |
3300025383|Ga0208250_1001700 | Not Available | 5369 | Open in IMG/M |
3300025392|Ga0208380_1021698 | Not Available | 1055 | Open in IMG/M |
3300025401|Ga0207955_1024544 | Not Available | 1094 | Open in IMG/M |
3300025413|Ga0208614_1005059 | All Organisms → Viruses → Predicted Viral | 2753 | Open in IMG/M |
3300025413|Ga0208614_1016187 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
3300025426|Ga0208739_1016206 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
3300025429|Ga0208500_1017058 | Not Available | 984 | Open in IMG/M |
3300025435|Ga0208618_1005407 | All Organisms → Viruses → Predicted Viral | 3588 | Open in IMG/M |
3300025466|Ga0208497_1005154 | Not Available | 3923 | Open in IMG/M |
3300025598|Ga0208379_1036627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1322 | Open in IMG/M |
3300025781|Ga0208386_1050029 | Not Available | 564 | Open in IMG/M |
3300027114|Ga0208009_1000116 | Not Available | 22406 | Open in IMG/M |
3300027144|Ga0255102_1059930 | Not Available | 608 | Open in IMG/M |
3300027563|Ga0209552_1027839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1674 | Open in IMG/M |
3300027581|Ga0209651_1203365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300027586|Ga0208966_1081777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300027608|Ga0208974_1028021 | Not Available | 1712 | Open in IMG/M |
3300027608|Ga0208974_1068355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300027608|Ga0208974_1096597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300027608|Ga0208974_1132778 | Not Available | 643 | Open in IMG/M |
3300027608|Ga0208974_1185371 | Not Available | 510 | Open in IMG/M |
3300027621|Ga0208951_1118522 | Not Available | 710 | Open in IMG/M |
3300027649|Ga0208960_1054188 | Not Available | 1261 | Open in IMG/M |
3300027697|Ga0209033_1104754 | Not Available | 925 | Open in IMG/M |
3300027708|Ga0209188_1000085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 107984 | Open in IMG/M |
3300027708|Ga0209188_1003521 | Not Available | 10753 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1076379 | Not Available | 1736 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1106681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1107601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
3300027733|Ga0209297_1001006 | Not Available | 16779 | Open in IMG/M |
3300027733|Ga0209297_1036369 | Not Available | 2276 | Open in IMG/M |
3300027736|Ga0209190_1011348 | Not Available | 5292 | Open in IMG/M |
3300027736|Ga0209190_1029340 | Not Available | 2968 | Open in IMG/M |
3300027736|Ga0209190_1109054 | Not Available | 1262 | Open in IMG/M |
3300027741|Ga0209085_1004352 | Not Available | 7625 | Open in IMG/M |
3300027741|Ga0209085_1167281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 916 | Open in IMG/M |
3300027744|Ga0209355_1219800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300027759|Ga0209296_1000046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 109757 | Open in IMG/M |
3300027759|Ga0209296_1015543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4441 | Open in IMG/M |
3300027760|Ga0209598_10000031 | Not Available | 99582 | Open in IMG/M |
3300027770|Ga0209086_10251416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300027777|Ga0209829_10007713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 7074 | Open in IMG/M |
3300027782|Ga0209500_10075699 | Not Available | 1720 | Open in IMG/M |
3300027808|Ga0209354_10415666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300027808|Ga0209354_10435039 | Not Available | 506 | Open in IMG/M |
3300027963|Ga0209400_1060154 | All Organisms → Viruses → Predicted Viral | 1919 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1095965 | Not Available | 1341 | Open in IMG/M |
3300028025|Ga0247723_1034336 | Not Available | 1566 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1299303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1089142 | Not Available | 1471 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10240181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10698136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300031758|Ga0315907_10013119 | Not Available | 8043 | Open in IMG/M |
3300031758|Ga0315907_10186241 | Not Available | 1745 | Open in IMG/M |
3300031758|Ga0315907_10893930 | Not Available | 653 | Open in IMG/M |
3300031857|Ga0315909_10019516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6858 | Open in IMG/M |
3300031857|Ga0315909_11002285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300031951|Ga0315904_10810271 | Not Available | 769 | Open in IMG/M |
3300031951|Ga0315904_10848934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300031951|Ga0315904_10851066 | Not Available | 743 | Open in IMG/M |
3300032092|Ga0315905_10658386 | Not Available | 936 | Open in IMG/M |
3300033816|Ga0334980_0001533 | Not Available | 10645 | Open in IMG/M |
3300033979|Ga0334978_0070682 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
3300033980|Ga0334981_0008698 | Not Available | 5826 | Open in IMG/M |
3300033980|Ga0334981_0324389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300033995|Ga0335003_0461792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300033996|Ga0334979_0423793 | Not Available | 732 | Open in IMG/M |
3300034012|Ga0334986_0541066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300034018|Ga0334985_0674429 | Not Available | 563 | Open in IMG/M |
3300034061|Ga0334987_0616528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300034062|Ga0334995_0049612 | Not Available | 3440 | Open in IMG/M |
3300034062|Ga0334995_0118306 | All Organisms → Viruses → Predicted Viral | 1970 | Open in IMG/M |
3300034064|Ga0335001_0615318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300034066|Ga0335019_0296685 | Not Available | 1015 | Open in IMG/M |
3300034071|Ga0335028_0350867 | Not Available | 858 | Open in IMG/M |
3300034092|Ga0335010_0586155 | Not Available | 569 | Open in IMG/M |
3300034093|Ga0335012_0537250 | Not Available | 549 | Open in IMG/M |
3300034101|Ga0335027_0386908 | Not Available | 912 | Open in IMG/M |
3300034103|Ga0335030_0525253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300034106|Ga0335036_0372359 | Not Available | 926 | Open in IMG/M |
3300034107|Ga0335037_0195890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
3300034110|Ga0335055_0069788 | Not Available | 1616 | Open in IMG/M |
3300034110|Ga0335055_0244799 | Not Available | 781 | Open in IMG/M |
3300034200|Ga0335065_0321895 | Not Available | 970 | Open in IMG/M |
3300034283|Ga0335007_0711410 | Not Available | 560 | Open in IMG/M |
3300034284|Ga0335013_0471625 | Not Available | 757 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.14% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 11.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.71% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.43% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.36% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.21% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.21% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.43% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.07% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.07% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.71% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.71% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.71% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.36% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.36% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.36% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.36% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.36% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.36% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.36% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.36% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.36% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020521 | Freshwater microbial communities from Lake Mendota, WI - 26SEP2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025435 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199947473 | 2199352004 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKTKLQ |
2200104940 | 2199352005 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK |
TBL_comb48_EPIDRAFT_100732112 | 3300000439 | Freshwater | MDKVKRIQELRRSNAATAIPSKKKYTRKIKHKKAGN* |
TBL_comb48_EPIDRAFT_10166279 | 3300000439 | Freshwater | MNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDN* |
JGI12421J11937_101253061 | 3300000756 | Freshwater And Sediment | MLKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
JGI12421J11937_101727592 | 3300000756 | Freshwater And Sediment | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK*KYN* |
RCM47_10020355 | 3300001848 | Marine Plankton | MNNLKEKVNRIQELRRSNAATAIPNKKKYNRKQKHKNKYDF* |
B570J29590_1005453 | 3300002278 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLX* |
B570J29599_10013201 | 3300002298 | Freshwater | LALIVGSKMFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF* |
B570J29618_10109391 | 3300002306 | Freshwater | *IMIKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
B570J29032_1092592782 | 3300002408 | Freshwater | MINEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
B570J40625_10000010917 | 3300002835 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNKIK* |
B570J40625_10000032087 | 3300002835 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK* |
B570J40625_10007405715 | 3300002835 | Freshwater | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKTKHKNKLQ* |
B570J40625_1002222814 | 3300002835 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
B570J40625_1002303658 | 3300002835 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLQ* |
B570J40625_1006691882 | 3300002835 | Freshwater | MNKLFEKIIRIQELRRSNAATPIRNKKKYTRKIKHKNKLQ* |
B570J40625_1012012541 | 3300002835 | Freshwater | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKQ* |
JGI25908J49247_1000030617 | 3300003277 | Freshwater Lake | MFNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK* |
JGI25910J50241_100314112 | 3300003388 | Freshwater Lake | MFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK* |
JGI25909J50240_11190591 | 3300003393 | Freshwater Lake | MFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNXK* |
JGI25911J50253_100637115 | 3300003411 | Freshwater Lake | IVGSKMFNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK* |
JGI25930J51415_10150116 | 3300003499 | Freshwater Lake | MLKEIKNKITRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ* |
Ga0007817_10042804 | 3300003804 | Freshwater | LAVNKIMEKVKRIQELRRSNAATPIPSKKKYSRKIKFKK* |
Ga0007864_10019424 | 3300003806 | Freshwater | MEKLVGNKIMEKVKRIQELRRSNAATAIPSKKKYSRKIKHKNKLK* |
Ga0007856_10007895 | 3300003815 | Freshwater | VKLREKIMNKVNRVQELRRSNAATAIPSKKKYTRKNKYKNKFE* |
Ga0065171_10351282 | 3300004692 | Freshwater | MEQVVVNKIMDKVKRIQELRRSNAATAIPSKKKYSRKIKFKK* |
Ga0007804_10832651 | 3300004770 | Freshwater | VVVNKIMDKVKRIQELRRSNAATAIPSKKKYSRKIKFKK* |
Ga0007804_11081563 | 3300004770 | Freshwater | MRNKIMDKVKRIQELRRSNAATPLRNKKKYTRKEKYKNRLDN* |
Ga0007854_100429671 | 3300004806 | Freshwater | MEAMRNKIMEKVKRIQELRRSNAATPLRNKKKYTRKEKYKN |
Ga0007854_102865432 | 3300004806 | Freshwater | LREKIMNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDN* |
Ga0007809_100576674 | 3300004807 | Freshwater | MNMRNKIMEKVKRIQELRRSNAATAIPSKKKYTRKIKYKNKLDN* |
Ga0070374_102237811 | 3300005517 | Freshwater Lake | EIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK*KYN* |
Ga0068876_1000718112 | 3300005527 | Freshwater Lake | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK* |
Ga0068876_105125163 | 3300005527 | Freshwater Lake | QDKVKRIQELRRSNAAQPVRNKKKYTRKIKHKNKLNS* |
Ga0049083_103225922 | 3300005580 | Freshwater Lentic | KMFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK*KYN* |
Ga0049081_102531962 | 3300005581 | Freshwater Lentic | MFDKIKNKVIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
Ga0049081_102831131 | 3300005581 | Freshwater Lentic | MIKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLK* |
Ga0049081_103019982 | 3300005581 | Freshwater Lentic | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK* |
Ga0049080_101915214 | 3300005582 | Freshwater Lentic | MLKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK* |
Ga0049082_101103951 | 3300005584 | Freshwater Lentic | MLKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKH |
Ga0049084_102925912 | 3300005585 | Freshwater Lentic | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK*KYN* |
Ga0078894_101260394 | 3300005662 | Freshwater Lake | MLKEIKNKITRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
Ga0079957_100568119 | 3300005805 | Lake | MFNKIKNKVIRIQELRRSNAATPIANKKKYSRKIKHKNKLEQMF* |
Ga0079957_10648665 | 3300005805 | Lake | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKNKNKLEQTF* |
Ga0079957_11838351 | 3300005805 | Lake | MKKLLEKVIRIQELRRSNAATPIRNKKKYTRKIKHKNKLQ* |
Ga0007876_100078221 | 3300006071 | Freshwater | MEKVKRIQELRRSNAATPLQNKKKYNRKTKYKNKLVE* |
Ga0007876_10111705 | 3300006071 | Freshwater | LVVNKIMDKVKRIQELRRSNAATPIPSKKKYSRKIKFKK* |
Ga0007819_10172691 | 3300006105 | Freshwater | MNKVNRVQELRRSNAATAIPSKKKYTRKNKYKNKFE* |
Ga0007862_10519574 | 3300006108 | Freshwater | REKIMNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFE* |
Ga0007870_10036737 | 3300006109 | Freshwater | MEKVKRIQELRRSNAATPLRNKKKYTRKEKYKNRLDN* |
Ga0007815_10513781 | 3300006114 | Freshwater | REKIMNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDS* |
Ga0007867_11136621 | 3300006120 | Freshwater | IMNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDN* |
Ga0070744_100201198 | 3300006484 | Estuarine | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK* |
Ga0070744_100474041 | 3300006484 | Estuarine | LLALIVGSKMFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK*KYN* |
Ga0070744_102447721 | 3300006484 | Estuarine | LLALIVGSKMFNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK* |
Ga0079301_10008896 | 3300006639 | Deep Subsurface | MLKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKQ* |
Ga0075472_105621741 | 3300006917 | Aqueous | NAMMNKVRKVQELRRSNAATPIPSKKKYSRKIKHKRRGDLTN* |
Ga0104988_1086547 | 3300007735 | Freshwater | MLKEIKNKIIRIQELRRSNAATPIPNKKNYSRKIKHKNKLQ* |
Ga0105747_11829273 | 3300007974 | Estuary Water | EIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK* |
Ga0114340_11942762 | 3300008107 | Freshwater, Plankton | MIKEIKNKIIRIQELRRSNAATAIPNQKKYSRKIKHKNKLQ* |
Ga0114341_101218686 | 3300008108 | Freshwater, Plankton | MIKEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ* |
Ga0114343_11093043 | 3300008110 | Freshwater, Plankton | GVKMFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF* |
Ga0114346_11739191 | 3300008113 | Freshwater, Plankton | MIKEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKH |
Ga0114347_10355919 | 3300008114 | Freshwater, Plankton | MIKEIKNKIIRIQELRRSNAAIVIPSKKNYSRKIKHKNKLQ* |
Ga0114350_100418916 | 3300008116 | Freshwater, Plankton | MFNKIKNKVIRIQELRRSNAATPIANKKKYSRKIKHKNKLQ* |
Ga0114350_10468771 | 3300008116 | Freshwater, Plankton | MLNEIKNKIISIQELRRSNAATPIPNKKKYTRKVKHKNGKTK* |
Ga0114350_11121171 | 3300008116 | Freshwater, Plankton | MLNKLKNKVIRIQELRRSNAATPIPNKKNYSRKIKHKNKLQ* |
Ga0114841_10290857 | 3300008259 | Freshwater, Plankton | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK* |
Ga0104241_10003698 | 3300008953 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLK* |
Ga0104242_100153818 | 3300008962 | Freshwater | MKGKLMNTLKEKVIRIQELRRSNAATPIRNKKIYSRKQKHKNKFG* |
Ga0104242_10504321 | 3300008962 | Freshwater | NKIIRIQELRRSNAATAIPNKKKYTRKVKHKNGK* |
Ga0104242_10613843 | 3300008962 | Freshwater | KEIKNKIIRIQELRRSNAATAIPSKKKYSRKIKHKNKLQ* |
Ga0102829_10178773 | 3300009026 | Estuarine | MFNEIKNKIIRIQELRRSNAATPIQNKKKYSRKVKHKNAK* |
Ga0102829_12613492 | 3300009026 | Estuarine | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK* |
Ga0114973_100045581 | 3300009068 | Freshwater Lake | MLKEIKNKVIRIQELRRSNAATPITNKKKYTRKVKHKNKLQ* |
Ga0114973_100519072 | 3300009068 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ* |
Ga0114973_100770682 | 3300009068 | Freshwater Lake | MFNEIKNKIIRIQELRRSNAATPILNKKKYSRKTKHKNKLQ* |
Ga0114973_102324272 | 3300009068 | Freshwater Lake | MFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK* |
Ga0114973_103510754 | 3300009068 | Freshwater Lake | MLKEIKNKVIRIQELRRSNAATQIPNKKKYNRKVKHKNKLQ* |
Ga0114973_105378782 | 3300009068 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKDKLK* |
Ga0114973_106038701 | 3300009068 | Freshwater Lake | IKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
Ga0114962_1000790211 | 3300009151 | Freshwater Lake | MEKVKRIQELRRSNAATAIPSKKKYNRKRKYKNKFE* |
Ga0114962_100170051 | 3300009151 | Freshwater Lake | NKIMEKVKRIQELRRSNAATPIKNKKIYSRKNKYKNKFE* |
Ga0114962_100183511 | 3300009151 | Freshwater Lake | MEKVKRIQELRRSNAATPIKNKKIYSRKNKYKNKFE* |
Ga0114980_103578452 | 3300009152 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNGKQ* |
Ga0114963_1004241113 | 3300009154 | Freshwater Lake | LLKNKIMDKVKRIQELRRSNAATPIASKKKYNRKLKHKNQLDKLD* |
Ga0114968_1000010267 | 3300009155 | Freshwater Lake | MLKEIKNKVIRIQELRRSNAATPIPNKKKYTRKVKHKNKLQ* |
Ga0114968_104202401 | 3300009155 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ* |
Ga0114968_105325873 | 3300009155 | Freshwater Lake | MIKEIKNKIIRIQELRRSNAATAIPSKKKYSRKIKHKNKLQ* |
Ga0114977_1001445112 | 3300009158 | Freshwater Lake | MIKEIKNKIIRIQELRRSNAATAILNKKKYSRKIKHKNKLQ* |
Ga0114977_103499662 | 3300009158 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNGKQ* |
Ga0114978_102045363 | 3300009159 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATSIPNKKKYSRKIKHKNKLQ* |
Ga0114978_103056682 | 3300009159 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK* |
Ga0114978_107922992 | 3300009159 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKK* |
Ga0114970_107154831 | 3300009163 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAETAIPNKKKYTRKVKHKNGKQ* |
Ga0114975_104124651 | 3300009164 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNKLQ* |
Ga0114969_101316476 | 3300009181 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLK* |
Ga0114974_106750791 | 3300009183 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAASAIPNKKKYSRKTKHKNKLQ* |
Ga0114976_102946441 | 3300009184 | Freshwater Lake | EIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLQ* |
Ga0114960_103776931 | 3300010158 | Freshwater Lake | KVKRIQELRRSNAATPIKNKKIYSRKNKYKNKFE* |
Ga0114967_100828471 | 3300010160 | Freshwater Lake | EIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ* |
Ga0136644_101088112 | 3300010334 | Freshwater Lake | MDKVKRIQELRRSNAATPIASKKKYNRKLKHKNQLDKLD* |
Ga0139557_10260944 | 3300011010 | Freshwater | EIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK* |
Ga0139557_10347273 | 3300011010 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKTKHKNKLQ* |
Ga0139557_10696182 | 3300011010 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF* |
Ga0139556_10054871 | 3300011011 | Freshwater | NEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK* |
Ga0151517_15501 | 3300011113 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK* |
Ga0119951_100644915 | 3300012000 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPNKKKYTRKVKHKNGK* |
Ga0119951_10124407 | 3300012000 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPSKKKYTRKIKHKNKLQ* |
Ga0119951_10210284 | 3300012000 | Freshwater | MNTLKEKVIRIQELRRSNAATPIRNKKIYSRKQKHKNKFG* |
Ga0119951_10845083 | 3300012000 | Freshwater | NKMLKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLK* |
Ga0119951_11261801 | 3300012000 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPSKKKYSRKIKHKNKLQ* |
Ga0153805_10918403 | 3300012013 | Surface Ice | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKN |
Ga0153801_10451262 | 3300012017 | Freshwater | MIKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK* |
Ga0164293_105533891 | 3300013004 | Freshwater | KMINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKKIN* |
Ga0164292_106218871 | 3300013005 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKKIN* |
Ga0164294_103893822 | 3300013006 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK* |
(restricted) Ga0172374_12444462 | 3300013122 | Freshwater | MLDKIKNKVIRIQELRRSNAATPISNKKKYSRKIKNKNKLEQTF* |
(restricted) Ga0172368_101596012 | 3300013123 | Freshwater | MFDKIKNKVIRIQELRRSNAATSIPNKKKYSRKIKHKNKLEQTF* |
(restricted) Ga0172367_101534944 | 3300013126 | Freshwater | MIKEIKNKIIRIQELRRSNAATPISNKKKYSRKIKHKNKLEQTF* |
(restricted) Ga0172367_104742611 | 3300013126 | Freshwater | MLDKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKNKNKLEQTF* |
(restricted) Ga0172373_103700173 | 3300013131 | Freshwater | MLDKIKNKVIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK* |
(restricted) Ga0172362_104186602 | 3300013133 | Sediment | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKKIN* |
Ga0170791_109127852 | 3300013295 | Freshwater | MEKVKRIQELRRSNAATAIPSKKKYNRKRKHKGKIES* |
Ga0119952_11325251 | 3300014050 | Freshwater | GKNKMLKEIKNKIIRIQELRRSNAATAIPSKKKYTRKIKHKNKLQ* |
(restricted) Ga0172376_101524881 | 3300014720 | Freshwater | LGIKMLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK* |
(restricted) Ga0172376_102765113 | 3300014720 | Freshwater | MLDKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKKIN* |
(restricted) Ga0172376_105386662 | 3300014720 | Freshwater | MIKEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF* |
Ga0119954_100005939 | 3300014819 | Freshwater | MLNEIKNKVIRIQELRRSNAATAIPNKKKYTRKVKHKNGKTK* |
Ga0181347_11342272 | 3300017722 | Freshwater Lake | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAKXKYN |
Ga0169931_103640141 | 3300017788 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKKIN |
Ga0169931_105201343 | 3300017788 | Freshwater | MFDKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF |
Ga0169931_105959931 | 3300017788 | Freshwater | MLDKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKNKNKLEQTF |
Ga0181359_10626313 | 3300019784 | Freshwater Lake | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK |
Ga0207193_18294472 | 3300020048 | Freshwater Lake Sediment | MLKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKFQ |
Ga0211732_10461082 | 3300020141 | Freshwater | MLKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAKXKYN |
Ga0211732_14967277 | 3300020141 | Freshwater | MLKEIKNKIIRIQELRRSNAATPIPNKKNYSRKIKHKNKLQ |
Ga0211736_102031231 | 3300020151 | Freshwater | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ |
Ga0211736_104107181 | 3300020151 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKNKNKLEQTF |
Ga0211736_104533111 | 3300020151 | Freshwater | AQIVGNKMINEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNGK |
Ga0211734_108362941 | 3300020159 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0211733_100268071 | 3300020160 | Freshwater | MINEIKNKIIRIQELRRSNAATPITNKKKYTRKIKHKK |
Ga0211733_109847902 | 3300020160 | Freshwater | MLSEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNGKXKYN |
Ga0211733_109945224 | 3300020160 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKQ |
Ga0211726_101245373 | 3300020161 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKMQ |
Ga0211726_107361464 | 3300020161 | Freshwater | SKMLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNEKXKYN |
Ga0211729_102808341 | 3300020172 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNEK |
Ga0211729_106593863 | 3300020172 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKFK |
Ga0211729_112469593 | 3300020172 | Freshwater | MIKEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ |
Ga0211729_113967542 | 3300020172 | Freshwater | MLSEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNGK |
Ga0208326_1269101 | 3300020494 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF |
Ga0208091_10167854 | 3300020506 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNKIK |
Ga0208234_10112594 | 3300020515 | Freshwater | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKTKHKNKLQ |
Ga0208234_10194782 | 3300020515 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLK |
Ga0208482_10252761 | 3300020521 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKXKYN |
Ga0208232_10106113 | 3300020527 | Freshwater | MLSEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNEKQ |
Ga0208233_10033471 | 3300020529 | Freshwater | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNKIK |
Ga0207939_10329202 | 3300020536 | Freshwater | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNEKQ |
Ga0208857_10462782 | 3300020542 | Freshwater | MIKEIKNKIIRFQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0208089_100223714 | 3300020543 | Freshwater | LALIVGSKMFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF |
Ga0214194_1003985 | 3300020686 | Freshwater | MNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDN |
Ga0214246_10142933 | 3300020727 | Freshwater | MNIRNKIMEKVKRIQELRRSNAATAIPSKKKYTRKTKYKNKLDN |
Ga0214206_10002788 | 3300021131 | Freshwater | MDKVKRIQELRRSNAATAIPSKKKYTRKIKHKKAGN |
Ga0214206_10060893 | 3300021131 | Freshwater | LKGKIMEKVKRIQELRRSNAATAIKSKKVYSRKTKYKNKFE |
Ga0214206_10170814 | 3300021131 | Freshwater | LREKIMNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDN |
Ga0214206_10195711 | 3300021131 | Freshwater | MQKVKRIQELRRSNAATPMQNKKKYNRKIKYKNKLDN |
Ga0214206_10315331 | 3300021131 | Freshwater | MNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFE |
Ga0214206_10325881 | 3300021131 | Freshwater | MNKVNRVQELRRSNAATAIPSKKKYSRKNKYKNKFDN |
Ga0213920_100112329 | 3300021438 | Freshwater | MDKVKRIQELRRSNAATAIPSKKVYTRKQKHKNKFS |
Ga0194048_1000571610 | 3300021519 | Anoxic Zone Freshwater | MEKVKRIQELRRSNAATAIPSKKKYSRKEKYKNKLLE |
Ga0194059_10564483 | 3300021600 | Anoxic Zone Freshwater | MNNLKEKVNRIQELRRSNAATAIPSKKKYNRKIKYKNKFET |
Ga0181353_10068029 | 3300022179 | Freshwater Lake | MLKEIKNKITRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0236341_100345112 | 3300022591 | Freshwater | MDKVKRIQELRRSNAATAIPSKKKYTRKTKHKKRSF |
Ga0248169_1324297 | 3300022602 | Freshwater | MEKVKRIQELRRSNAATAIANKKKYTRKQKHKNKLDN |
Ga0214917_1001173820 | 3300022752 | Freshwater | MLDKIKNKVIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK |
Ga0214917_1001451219 | 3300022752 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPNKKKYSRKVKHKNGKQ |
Ga0214917_100386211 | 3300022752 | Freshwater | MLNEIKNKVIRIQELRRSNAATAIPNKKKYTRKVKHKNGKTK |
Ga0214917_102448732 | 3300022752 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPSKKKYTRKIKHKNKFY |
Ga0214921_1000104918 | 3300023174 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPSKKKYTRKIKHKNKFD |
Ga0214921_1000630428 | 3300023174 | Freshwater | MINEIKNKIIRIQELRRSNAATPISNKKKYSRKVKHKNGKQ |
Ga0214921_1003002412 | 3300023174 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPNKKKYTRKVKHKNGK |
Ga0214921_100553993 | 3300023174 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPSKKKYSRKIKHKNKLQ |
Ga0214921_102475772 | 3300023174 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK |
Ga0214921_103085061 | 3300023174 | Freshwater | LGIKMLDKIKNKVIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK |
Ga0214921_104343033 | 3300023174 | Freshwater | MLKEIKNKIIRIQELRRSNAATAIPSKKKYTRKIKHKNKLQ |
Ga0214921_105717311 | 3300023174 | Freshwater | SRIYLMKGKLMNNLKEKVIRIQELRRGNAATAIPSKKVYNRKRKHKNKFS |
Ga0214923_1004425812 | 3300023179 | Freshwater | MFNKIKNKVIRIQELRRSNAATAIPSKKKYSRKIKHKNKLQ |
Ga0214919_107958792 | 3300023184 | Freshwater | IKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0244775_105374481 | 3300024346 | Estuarine | MFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK |
Ga0208619_1007813 | 3300025336 | Freshwater | MEKLVGNKIMEKVKRIQELRRSNAATAIPSKKKYSRKIKHKNKLK |
Ga0208619_1043784 | 3300025336 | Freshwater | MRNKIMEKVKRIQELRRSNAATAIPSKKKYTRKIKYKNKLDN |
Ga0208619_1190042 | 3300025336 | Freshwater | MNKVNRVQELRRSNAATAIPSKKKYTRKNKYKNKFE |
Ga0208738_10538642 | 3300025379 | Freshwater | MRNKIMDKVKRIQELRRSNAATPLRNKKKYTRKEKYKNRLDN |
Ga0208250_10017004 | 3300025383 | Freshwater | VVNKIMDKVKRIQELRRSNAATPIPSKKKYSRKIKFKK |
Ga0208380_10216984 | 3300025392 | Freshwater | MRNKIMEKVKRIQELRRSNAATAIPSKKKYTRKIKYKK |
Ga0207955_10245443 | 3300025401 | Freshwater | MRNKIMEKVKRIQELRRSNAATAIPSKKKYTRKNKYKNKFDN |
Ga0208614_10050597 | 3300025413 | Freshwater | MEKVKRIQELRRSNAATAIPSKKKYTRKIKYKNKLDN |
Ga0208614_10161871 | 3300025413 | Freshwater | MEQVVVNKIMDKVKRIQELRRSNAATAIPSKKKYSR |
Ga0208739_10162062 | 3300025426 | Freshwater | MNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDS |
Ga0208500_10170583 | 3300025429 | Freshwater | EKIMNKVNRVQELRRSNAATPIRNKKKYTRKNKYKNKFDS |
Ga0208618_10054075 | 3300025435 | Freshwater | MEKVKRIQELRRSNAATPLRNKKKYTRKEKYKNRLDN |
Ga0208497_10051542 | 3300025466 | Freshwater | MDKVKRIQELRRSNAATPLRNKKKYTRKEKYKNRLDN |
Ga0208379_10366275 | 3300025598 | Freshwater | KIMEKVKRIQELRRSNAATAIPSKKKYSRKIKHKNKLK |
Ga0208386_10500291 | 3300025781 | Freshwater | NKIMEKVKRIQELRRSNAATAIPSKKKYTRKIKYKNKLDN |
Ga0208009_10001162 | 3300027114 | Deep Subsurface | MLKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKQ |
Ga0255102_10599302 | 3300027144 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK |
Ga0209552_10278396 | 3300027563 | Freshwater Lake | MFNEIKNKIVRIQELRRSNAATPIPNKKKYSRKVKH |
Ga0209651_12033651 | 3300027581 | Freshwater Lake | MFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK |
Ga0208966_10817772 | 3300027586 | Freshwater Lentic | MLKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK |
Ga0208974_10280212 | 3300027608 | Freshwater Lentic | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK |
Ga0208974_10683551 | 3300027608 | Freshwater Lentic | MFDKIKNKVIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0208974_10965971 | 3300027608 | Freshwater Lentic | MINEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0208974_11327781 | 3300027608 | Freshwater Lentic | MFNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK |
Ga0208974_11853712 | 3300027608 | Freshwater Lentic | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNGKQ |
Ga0208951_11185222 | 3300027621 | Freshwater Lentic | MLKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK |
Ga0208960_10541881 | 3300027649 | Freshwater Lentic | MLNEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK |
Ga0209033_11047542 | 3300027697 | Freshwater Lake | MLKEIKNKITRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ |
Ga0209188_100008527 | 3300027708 | Freshwater Lake | MEKVKRIQELRRSNAATAIPSKKKYNRKRKYKNKFE |
Ga0209188_100352110 | 3300027708 | Freshwater Lake | MEKVKRIQELRRSNAATPIKNKKIYSRKNKYKNKFE |
(restricted) Ga0247836_10763798 | 3300027728 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK |
(restricted) Ga0247836_11066817 | 3300027728 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK |
(restricted) Ga0247833_11076011 | 3300027730 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK |
Ga0209297_100100612 | 3300027733 | Freshwater Lake | MIKEIKNKIIRIQELRRSNAATAILNKKKYSRKIKHKNKLQ |
Ga0209297_10363692 | 3300027733 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNGKQ |
Ga0209190_101134815 | 3300027736 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ |
Ga0209190_10293402 | 3300027736 | Freshwater Lake | MFNEIKNKIIRIQELRRSNAATPILNKKKYSRKTKHKNKLQ |
Ga0209190_11090542 | 3300027736 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATAIPSKKNYSRKIKHKNKLK |
Ga0209085_100435219 | 3300027741 | Freshwater Lake | VKLGVNKIMEKVKRIQELRRSNAATPIKNKKIYSRKNKYKNKFE |
Ga0209085_11672812 | 3300027741 | Freshwater Lake | MDKVKRIQELRRSNAATPIASKKKYNRKLKHKNQLDKLD |
Ga0209355_12198003 | 3300027744 | Freshwater Lake | GSKMFNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAKXKYN |
Ga0209296_1000046128 | 3300027759 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAK |
Ga0209296_101554313 | 3300027759 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAASAIPNKKKYSRKTKHKNKLQ |
Ga0209598_1000003127 | 3300027760 | Freshwater Lake | MLKEIKNKVIRIQELRRSNAATPIPNKKKYTRKVKHKNKLQ |
Ga0209086_102514164 | 3300027770 | Freshwater Lake | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKIKHKDKLK |
Ga0209829_100077136 | 3300027777 | Freshwater Lake | LLKNKIMDKVKRIQELRRSNAATPIASKKKYNRKLKYKNKFDN |
Ga0209500_100756994 | 3300027782 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATSIPNKKKYSRKIKHKNKLQ |
Ga0209354_104156661 | 3300027808 | Freshwater Lake | LSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK |
Ga0209354_104350391 | 3300027808 | Freshwater Lake | MLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAK |
Ga0209400_10601542 | 3300027963 | Freshwater Lake | MLKEIKNKIIRIQELRRSNAATAIPNKKKYTRKVKHKNGKQ |
(restricted) Ga0247834_10959655 | 3300027977 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNAKXKYK |
Ga0247723_10343363 | 3300028025 | Deep Subsurface Sediment | MIKEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKQ |
(restricted) Ga0247831_12993032 | 3300028559 | Freshwater | NEIKNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNEK |
(restricted) Ga0247844_10891421 | 3300028571 | Freshwater | NEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAKXKYN |
(restricted) Ga0247840_102401811 | 3300028581 | Freshwater | INEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK |
(restricted) Ga0247841_106981361 | 3300029286 | Freshwater | NKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGKTK |
Ga0315907_100131197 | 3300031758 | Freshwater | MIKEIKNKIIRIQELRRSNAAIVIPSKKNYSRKIKHKNKLQ |
Ga0315907_101862412 | 3300031758 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIANKKKYSRKIKHKNKLQ |
Ga0315907_108939301 | 3300031758 | Freshwater | MFNKIKNKVIRIQELRRGNAATPIPNKKKYSRKIKHKNKLEQTF |
Ga0315909_1001951614 | 3300031857 | Freshwater | MFNKIKNKVIRIQELRRSNAATPILNKKKYSRKIKHKNKLEQTF |
Ga0315909_110022851 | 3300031857 | Freshwater | MLNKLKNKVIRIQELRRSNAATPIPNKKNYSRKIKHKNKLQ |
Ga0315904_108102711 | 3300031951 | Freshwater | MLNEIKNKIISIQELRRSNAATPIPNKKKYTRKVKHKNGKTK |
Ga0315904_108489342 | 3300031951 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0315904_108510663 | 3300031951 | Freshwater | KLLGIKMFNKIKNKVIRIQELRRSNAATPIANKKKYSRKIKHKNKLQ |
Ga0315905_106583864 | 3300032092 | Freshwater | GASMLSEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNGK |
Ga0334980_0001533_3137_3271 | 3300033816 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQTF |
Ga0334978_0070682_1224_1349 | 3300033979 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNEKQ |
Ga0334981_0008698_5227_5352 | 3300033980 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLK |
Ga0334981_0324389_497_622 | 3300033980 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLQ |
Ga0335003_0461792_426_530 | 3300033995 | Freshwater | MINEIKNKIIRIQELRRSNAATAIPNKKKYSRKIK |
Ga0334979_0423793_306_431 | 3300033996 | Freshwater | MLSEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0334986_0541066_60_185 | 3300034012 | Freshwater | MFNEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0334985_0674429_3_122 | 3300034018 | Freshwater | KNKIIRIQELRRSNAATPIPNKKKYTRKVKHKNAKWKYN |
Ga0334987_0616528_281_406 | 3300034061 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKHKLQ |
Ga0334995_0049612_2547_2672 | 3300034062 | Freshwater | MIKEIKNKITRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0334995_0118306_1416_1541 | 3300034062 | Freshwater | MIKEIKNKVIRIQELRRSNAATAIPSKKNYSRKIKHKNKFK |
Ga0335001_0615318_418_543 | 3300034064 | Freshwater | MIKEIKNKIIRIQELRRSNAATAIPSKKNYSRNIKHKNKLK |
Ga0335019_0296685_702_824 | 3300034066 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYTRKVKHKNAK |
Ga0335028_0350867_495_620 | 3300034071 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYSRKTKHKNKMQ |
Ga0335010_0586155_124_249 | 3300034092 | Freshwater | MLKEIKNKIIRIQELRRSNAATPIANKKKYSRKIKHKNKLQ |
Ga0335012_0537250_357_482 | 3300034093 | Freshwater | MIKEIKNKIISIQELRRSNAATAIPSKKNYSRKIKHKNKLK |
Ga0335027_0386908_92_217 | 3300034101 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKMQ |
Ga0335030_0525253_180_305 | 3300034103 | Freshwater | MLNEIKNKIIRIQELRRSNAATAIPNKKKYSRKIKHKNKLQ |
Ga0335036_0372359_2_112 | 3300034106 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKHK |
Ga0335037_0195890_978_1106 | 3300034107 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKIKHKNKLEQM |
Ga0335055_0069788_9_134 | 3300034110 | Freshwater | MFNKIKNKVIRIQELRRSNAATPIPNKKKYSRKTKHKNKMQ |
Ga0335055_0244799_669_779 | 3300034110 | Freshwater | KNKIIRIQELRRSNAATPIPNKKKYSRKVKHKNEKQ |
Ga0335065_0321895_861_968 | 3300034200 | Freshwater | MINEIKNKIIRIQELRRSNAATPIPNKKKYTRKVKH |
Ga0335007_0711410_176_298 | 3300034283 | Freshwater | MLNEIKNKIIRIQELRRSNAATPIPNKKKYTRNVKHKNAK |
Ga0335013_0471625_648_755 | 3300034284 | Freshwater | KNKIIRIQELRRSNAATPIPNKKKYSRKIKHKKIN |
⦗Top⦘ |